From 91c9b05208f8bea47fad2847c70d7f5c306bf513 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Sun, 26 May 2024 18:56:08 +0000 Subject: [PATCH] Bump github.com/caddyserver/certmagic from 0.20.0 to 0.21.2 Bumps [github.com/caddyserver/certmagic](https://github.com/caddyserver/certmagic) from 0.20.0 to 0.21.2. - [Release notes](https://github.com/caddyserver/certmagic/releases) - [Commits](https://github.com/caddyserver/certmagic/compare/v0.20.0...v0.21.2) --- updated-dependencies: - dependency-name: github.com/caddyserver/certmagic dependency-type: direct:production update-type: version-update:semver-minor ... Signed-off-by: dependabot[bot] --- go.mod | 28 +- go.sum | 62 +- .../caddyserver/certmagic/README.md | 53 +- .../caddyserver/certmagic/account.go | 34 +- .../caddyserver/certmagic/acmeclient.go | 129 +- .../caddyserver/certmagic/acmeissuer.go | 160 +- .../github.com/caddyserver/certmagic/cache.go | 21 +- .../caddyserver/certmagic/certificates.go | 230 +- .../caddyserver/certmagic/certmagic.go | 59 +- .../caddyserver/certmagic/config.go | 152 +- .../caddyserver/certmagic/crypto.go | 5 + .../caddyserver/certmagic/dnsutil.go | 99 +- .../caddyserver/certmagic/filestorage.go | 2 +- .../caddyserver/certmagic/handshake.go | 116 +- .../{httphandler.go => httphandlers.go} | 96 +- .../caddyserver/certmagic/maintain.go | 225 +- .../github.com/caddyserver/certmagic/ocsp.go | 16 +- .../caddyserver/certmagic/solvers.go | 289 +- .../caddyserver/certmagic/storage.go | 2 +- .../caddyserver/certmagic/zerosslissuer.go | 304 + .../github.com/caddyserver/zerossl/.gitignore | 2 + .../caddyserver/zerossl/LICENSE} | 12 +- .../github.com/caddyserver/zerossl/README.md | 6 + .../github.com/caddyserver/zerossl/client.go | 170 + .../caddyserver/zerossl/endpoints.go | 270 + .../github.com/caddyserver/zerossl/models.go | 94 + .../github.com/caddyserver/zerossl/zerossl.go | 64 + .../github.com/klauspost/cpuid/v2/README.md | 14 +- vendor/github.com/klauspost/cpuid/v2/cpuid.go | 457 +- .../klauspost/cpuid/v2/detect_x86.go | 2 + .../klauspost/cpuid/v2/featureid_string.go | 412 +- vendor/github.com/libdns/libdns/README.md | 18 +- vendor/github.com/libdns/libdns/libdns.go | 106 +- vendor/github.com/mholt/acmez/acme/ari.go | 205 - vendor/github.com/mholt/acmez/csr.go | 149 - .../mholt/acmez/{ => v2}/.gitignore | 0 .../github.com/mholt/acmez/{ => v2}/LICENSE | 0 .../github.com/mholt/acmez/{ => v2}/README.md | 34 +- .../mholt/acmez/{ => v2}/THIRD-PARTY | 0 .../mholt/acmez/{ => v2}/acme/account.go | 9 + vendor/github.com/mholt/acmez/v2/acme/ari.go | 215 + .../acmez/{ => v2}/acme/authorization.go | 0 .../mholt/acmez/{ => v2}/acme/certificate.go | 39 +- .../mholt/acmez/{ => v2}/acme/challenge.go | 30 + .../mholt/acmez/{ => v2}/acme/client.go | 0 .../mholt/acmez/{ => v2}/acme/http.go | 5 + .../mholt/acmez/{ => v2}/acme/jws.go | 14 +- .../mholt/acmez/{ => v2}/acme/order.go | 27 +- .../mholt/acmez/{ => v2}/acme/problem.go | 0 .../github.com/mholt/acmez/{ => v2}/client.go | 186 +- vendor/github.com/mholt/acmez/v2/csr.go | 316 + .../github.com/mholt/acmez/v2/mailreply00.go | 48 + .../github.com/mholt/acmez/{ => v2}/solver.go | 5 +- .../mholt/acmez/{ => v2}/tlsalpn01.go | 2 +- vendor/github.com/miekg/dns/README.md | 5 + vendor/github.com/miekg/dns/acceptfunc.go | 2 - vendor/github.com/miekg/dns/defaults.go | 40 +- vendor/github.com/miekg/dns/dnssec_keyscan.go | 5 +- vendor/github.com/miekg/dns/edns.go | 3 +- vendor/github.com/miekg/dns/generate.go | 35 +- .../miekg/dns/listen_no_reuseport.go | 10 +- .../github.com/miekg/dns/listen_reuseport.go | 30 +- vendor/github.com/miekg/dns/msg.go | 55 +- vendor/github.com/miekg/dns/msg_helpers.go | 50 +- vendor/github.com/miekg/dns/privaterr.go | 2 +- vendor/github.com/miekg/dns/scan.go | 151 +- vendor/github.com/miekg/dns/scan_rr.go | 450 +- vendor/github.com/miekg/dns/server.go | 10 +- vendor/github.com/miekg/dns/svcb.go | 59 +- vendor/github.com/miekg/dns/types.go | 38 +- vendor/github.com/miekg/dns/version.go | 2 +- vendor/github.com/miekg/dns/xfr.go | 28 +- vendor/github.com/miekg/dns/zduplicate.go | 35 + vendor/github.com/miekg/dns/zmsg.go | 60 + vendor/github.com/miekg/dns/ztypes.go | 19 + vendor/go.uber.org/atomic/.codecov.yml | 19 - vendor/go.uber.org/atomic/.gitignore | 15 - vendor/go.uber.org/atomic/CHANGELOG.md | 127 - vendor/go.uber.org/atomic/Makefile | 79 - vendor/go.uber.org/atomic/README.md | 63 - vendor/go.uber.org/atomic/bool.go | 88 - vendor/go.uber.org/atomic/doc.go | 23 - vendor/go.uber.org/atomic/duration.go | 89 - vendor/go.uber.org/atomic/duration_ext.go | 40 - vendor/go.uber.org/atomic/error.go | 72 - vendor/go.uber.org/atomic/error_ext.go | 39 - vendor/go.uber.org/atomic/float32.go | 77 - vendor/go.uber.org/atomic/float32_ext.go | 76 - vendor/go.uber.org/atomic/float64.go | 77 - vendor/go.uber.org/atomic/float64_ext.go | 76 - vendor/go.uber.org/atomic/gen.go | 27 - vendor/go.uber.org/atomic/int32.go | 109 - vendor/go.uber.org/atomic/int64.go | 109 - vendor/go.uber.org/atomic/nocmp.go | 35 - vendor/go.uber.org/atomic/pointer_go118.go | 31 - .../atomic/pointer_go118_pre119.go | 60 - vendor/go.uber.org/atomic/pointer_go119.go | 61 - vendor/go.uber.org/atomic/string.go | 72 - vendor/go.uber.org/atomic/string_ext.go | 54 - vendor/go.uber.org/atomic/time_ext.go | 36 - vendor/go.uber.org/atomic/uint32.go | 109 - vendor/go.uber.org/atomic/uint64.go | 109 - vendor/go.uber.org/atomic/uintptr.go | 109 - vendor/go.uber.org/atomic/unsafe_pointer.go | 65 - vendor/go.uber.org/atomic/value.go | 31 - vendor/go.uber.org/zap/.golangci.yml | 77 + vendor/go.uber.org/zap/.readme.tmpl | 10 +- vendor/go.uber.org/zap/CHANGELOG.md | 292 +- .../go.uber.org/zap/{LICENSE.txt => LICENSE} | 0 vendor/go.uber.org/zap/Makefile | 87 +- vendor/go.uber.org/zap/README.md | 78 +- vendor/go.uber.org/zap/array.go | 127 + vendor/go.uber.org/zap/array_go118.go | 156 - vendor/go.uber.org/zap/buffer/buffer.go | 5 + vendor/go.uber.org/zap/buffer/pool.go | 20 +- vendor/go.uber.org/zap/config.go | 84 +- vendor/go.uber.org/zap/error.go | 14 +- vendor/go.uber.org/zap/field.go | 196 +- vendor/go.uber.org/zap/http_handler.go | 19 +- .../go.uber.org/zap/internal/level_enabler.go | 2 + .../time.go => zap/internal/pool/pool.go} | 51 +- .../stacktrace/stack.go} | 81 +- vendor/go.uber.org/zap/level.go | 9 +- vendor/go.uber.org/zap/logger.go | 87 +- vendor/go.uber.org/zap/options.go | 15 + vendor/go.uber.org/zap/sink.go | 5 +- vendor/go.uber.org/zap/sugar.go | 108 +- vendor/go.uber.org/zap/writer.go | 12 +- .../zap/zapcore/console_encoder.go | 16 +- vendor/go.uber.org/zap/zapcore/core.go | 6 +- vendor/go.uber.org/zap/zapcore/encoder.go | 15 + vendor/go.uber.org/zap/zapcore/entry.go | 22 +- vendor/go.uber.org/zap/zapcore/error.go | 14 +- vendor/go.uber.org/zap/zapcore/field.go | 2 +- .../go.uber.org/zap/zapcore/json_encoder.go | 157 +- .../bool_ext.go => zap/zapcore/lazy_with.go} | 49 +- vendor/go.uber.org/zap/zapcore/sampler.go | 9 +- vendor/golang.org/x/mod/semver/semver.go | 6 +- vendor/golang.org/x/sync/LICENSE | 27 + vendor/golang.org/x/sync/PATENTS | 22 + vendor/golang.org/x/sync/errgroup/errgroup.go | 135 + vendor/golang.org/x/sync/errgroup/go120.go | 13 + .../golang.org/x/sync/errgroup/pre_go120.go | 14 + vendor/golang.org/x/sys/execabs/execabs.go | 102 - .../golang.org/x/sys/execabs/execabs_go118.go | 17 - .../golang.org/x/sys/execabs/execabs_go119.go | 20 - vendor/golang.org/x/sys/unix/asm_zos_s390x.s | 665 +- vendor/golang.org/x/sys/unix/bpxsvc_zos.go | 657 + vendor/golang.org/x/sys/unix/bpxsvc_zos.s | 192 + vendor/golang.org/x/sys/unix/epoll_zos.go | 220 - vendor/golang.org/x/sys/unix/fstatfs_zos.go | 163 - vendor/golang.org/x/sys/unix/mmap_nomremap.go | 2 +- vendor/golang.org/x/sys/unix/pagesize_unix.go | 2 +- .../x/sys/unix/readdirent_getdirentries.go | 2 +- vendor/golang.org/x/sys/unix/sockcmsg_zos.go | 58 + .../golang.org/x/sys/unix/symaddr_zos_s390x.s | 75 + .../x/sys/unix/syscall_zos_s390x.go | 1509 +- vendor/golang.org/x/sys/unix/sysvshm_unix.go | 2 +- .../x/sys/unix/sysvshm_unix_other.go | 2 +- vendor/golang.org/x/sys/unix/zerrors_linux.go | 9 + .../x/sys/unix/zerrors_zos_s390x.go | 233 +- .../x/sys/unix/zsymaddr_zos_s390x.s | 364 + .../x/sys/unix/zsyscall_zos_s390x.go | 3113 ++- .../x/sys/unix/zsysnum_linux_386.go | 5 + .../x/sys/unix/zsysnum_linux_amd64.go | 5 + .../x/sys/unix/zsysnum_linux_arm.go | 5 + .../x/sys/unix/zsysnum_linux_arm64.go | 5 + .../x/sys/unix/zsysnum_linux_loong64.go | 5 + .../x/sys/unix/zsysnum_linux_mips.go | 5 + .../x/sys/unix/zsysnum_linux_mips64.go | 5 + .../x/sys/unix/zsysnum_linux_mips64le.go | 5 + .../x/sys/unix/zsysnum_linux_mipsle.go | 5 + .../x/sys/unix/zsysnum_linux_ppc.go | 5 + .../x/sys/unix/zsysnum_linux_ppc64.go | 5 + .../x/sys/unix/zsysnum_linux_ppc64le.go | 5 + .../x/sys/unix/zsysnum_linux_riscv64.go | 5 + .../x/sys/unix/zsysnum_linux_s390x.go | 5 + .../x/sys/unix/zsysnum_linux_sparc64.go | 5 + .../x/sys/unix/zsysnum_zos_s390x.go | 5507 ++--- vendor/golang.org/x/sys/unix/ztypes_linux.go | 26 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 8 - .../x/sys/unix/ztypes_linux_amd64.go | 9 - .../golang.org/x/sys/unix/ztypes_linux_arm.go | 9 - .../x/sys/unix/ztypes_linux_arm64.go | 9 - .../x/sys/unix/ztypes_linux_loong64.go | 9 - .../x/sys/unix/ztypes_linux_mips.go | 9 - .../x/sys/unix/ztypes_linux_mips64.go | 9 - .../x/sys/unix/ztypes_linux_mips64le.go | 9 - .../x/sys/unix/ztypes_linux_mipsle.go | 9 - .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 9 - .../x/sys/unix/ztypes_linux_ppc64.go | 9 - .../x/sys/unix/ztypes_linux_ppc64le.go | 9 - .../x/sys/unix/ztypes_linux_riscv64.go | 9 - .../x/sys/unix/ztypes_linux_s390x.go | 9 - .../x/sys/unix/ztypes_linux_sparc64.go | 9 - .../golang.org/x/sys/unix/ztypes_zos_s390x.go | 146 +- vendor/golang.org/x/sys/windows/aliases.go | 2 +- vendor/golang.org/x/sys/windows/empty.s | 8 - .../x/sys/windows/syscall_windows.go | 82 + .../golang.org/x/sys/windows/types_windows.go | 24 + .../x/sys/windows/zsyscall_windows.go | 126 +- .../x/tools/go/gcexportdata/gcexportdata.go | 2 +- .../tools/go/internal/packagesdriver/sizes.go | 24 +- vendor/golang.org/x/tools/go/packages/doc.go | 46 +- .../x/tools/go/packages/external.go | 79 +- .../golang.org/x/tools/go/packages/golist.go | 128 +- .../x/tools/go/packages/golist_overlay.go | 492 - .../x/tools/go/packages/packages.go | 378 +- .../x/tools/go/types/objectpath/objectpath.go | 753 + .../x/tools/internal/aliases/aliases.go | 32 + .../x/tools/internal/aliases/aliases_go121.go | 31 + .../x/tools/internal/aliases/aliases_go122.go | 63 + .../x/tools/internal/event/keys/util.go | 21 + .../x/tools/internal/event/tag/tag.go | 59 - .../x/tools/internal/gcimporter/gcimporter.go | 10 +- .../x/tools/internal/gcimporter/iexport.go | 228 +- .../x/tools/internal/gcimporter/iimport.go | 301 +- .../internal/gcimporter/support_go117.go | 16 - .../internal/gcimporter/support_go118.go | 3 - .../x/tools/internal/gcimporter/unified_no.go | 4 +- .../tools/internal/gcimporter/unified_yes.go | 4 +- .../x/tools/internal/gcimporter/ureader_no.go | 19 - .../tools/internal/gcimporter/ureader_yes.go | 10 +- .../x/tools/internal/gocommand/invoke.go | 44 +- .../x/tools/internal/gocommand/vendor.go | 54 + .../internal/packagesinternal/packages.go | 8 - .../x/tools/internal/pkgbits/decoder.go | 4 + .../x/tools/internal/stdlib/manifest.go | 17320 ++++++++++++++++ .../x/tools/internal/stdlib/stdlib.go | 97 + .../internal/tokeninternal/tokeninternal.go | 28 +- .../x/tools/internal/typeparams/common.go | 198 - .../x/tools/internal/typeparams/coretype.go | 122 - .../internal/typeparams/enabled_go117.go | 12 - .../internal/typeparams/enabled_go118.go | 15 - .../x/tools/internal/typeparams/normalize.go | 218 - .../x/tools/internal/typeparams/termlist.go | 163 - .../internal/typeparams/typeparams_go117.go | 197 - .../internal/typeparams/typeparams_go118.go | 151 - .../x/tools/internal/typeparams/typeterm.go | 170 - .../tools/internal/typesinternal/errorcode.go | 6 +- .../x/tools/internal/typesinternal/recv.go | 43 + .../x/tools/internal/typesinternal/toonew.go | 89 + .../x/tools/internal/typesinternal/types.go | 2 - .../tools/internal/typesinternal/types_118.go | 19 - .../x/tools/internal/versions/features.go | 43 + .../x/tools/internal/versions/gover.go | 172 + .../x/tools/internal/versions/toolchain.go | 14 + .../internal/versions/toolchain_go119.go | 14 + .../internal/versions/toolchain_go120.go | 14 + .../internal/versions/toolchain_go121.go | 14 + .../x/tools/internal/versions/types.go | 19 + .../x/tools/internal/versions/types_go121.go | 30 + .../x/tools/internal/versions/types_go122.go | 41 + .../x/tools/internal/versions/versions.go | 57 + vendor/modules.txt | 56 +- 255 files changed, 34581 insertions(+), 11194 deletions(-) rename vendor/github.com/caddyserver/certmagic/{httphandler.go => httphandlers.go} (61%) create mode 100644 vendor/github.com/caddyserver/certmagic/zerosslissuer.go create mode 100644 vendor/github.com/caddyserver/zerossl/.gitignore rename vendor/{go.uber.org/atomic/LICENSE.txt => github.com/caddyserver/zerossl/LICENSE} (87%) create mode 100644 vendor/github.com/caddyserver/zerossl/README.md create mode 100644 vendor/github.com/caddyserver/zerossl/client.go create mode 100644 vendor/github.com/caddyserver/zerossl/endpoints.go create mode 100644 vendor/github.com/caddyserver/zerossl/models.go create mode 100644 vendor/github.com/caddyserver/zerossl/zerossl.go delete mode 100644 vendor/github.com/mholt/acmez/acme/ari.go delete mode 100644 vendor/github.com/mholt/acmez/csr.go rename vendor/github.com/mholt/acmez/{ => v2}/.gitignore (100%) rename vendor/github.com/mholt/acmez/{ => v2}/LICENSE (100%) rename vendor/github.com/mholt/acmez/{ => v2}/README.md (76%) rename vendor/github.com/mholt/acmez/{ => v2}/THIRD-PARTY (100%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/account.go (96%) create mode 100644 vendor/github.com/mholt/acmez/v2/acme/ari.go rename vendor/github.com/mholt/acmez/{ => v2}/acme/authorization.go (100%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/certificate.go (85%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/challenge.go (80%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/client.go (100%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/http.go (98%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/jws.go (93%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/order.go (91%) rename vendor/github.com/mholt/acmez/{ => v2}/acme/problem.go (100%) rename vendor/github.com/mholt/acmez/{ => v2}/client.go (79%) create mode 100644 vendor/github.com/mholt/acmez/v2/csr.go create mode 100644 vendor/github.com/mholt/acmez/v2/mailreply00.go rename vendor/github.com/mholt/acmez/{ => v2}/solver.go (94%) rename vendor/github.com/mholt/acmez/{ => v2}/tlsalpn01.go (98%) delete mode 100644 vendor/go.uber.org/atomic/.codecov.yml delete mode 100644 vendor/go.uber.org/atomic/.gitignore delete mode 100644 vendor/go.uber.org/atomic/CHANGELOG.md delete mode 100644 vendor/go.uber.org/atomic/Makefile delete mode 100644 vendor/go.uber.org/atomic/README.md delete mode 100644 vendor/go.uber.org/atomic/bool.go delete mode 100644 vendor/go.uber.org/atomic/doc.go delete mode 100644 vendor/go.uber.org/atomic/duration.go delete mode 100644 vendor/go.uber.org/atomic/duration_ext.go delete mode 100644 vendor/go.uber.org/atomic/error.go delete mode 100644 vendor/go.uber.org/atomic/error_ext.go delete mode 100644 vendor/go.uber.org/atomic/float32.go delete mode 100644 vendor/go.uber.org/atomic/float32_ext.go delete mode 100644 vendor/go.uber.org/atomic/float64.go delete mode 100644 vendor/go.uber.org/atomic/float64_ext.go delete mode 100644 vendor/go.uber.org/atomic/gen.go delete mode 100644 vendor/go.uber.org/atomic/int32.go delete mode 100644 vendor/go.uber.org/atomic/int64.go delete mode 100644 vendor/go.uber.org/atomic/nocmp.go delete mode 100644 vendor/go.uber.org/atomic/pointer_go118.go delete mode 100644 vendor/go.uber.org/atomic/pointer_go118_pre119.go delete mode 100644 vendor/go.uber.org/atomic/pointer_go119.go delete mode 100644 vendor/go.uber.org/atomic/string.go delete mode 100644 vendor/go.uber.org/atomic/string_ext.go delete mode 100644 vendor/go.uber.org/atomic/time_ext.go delete mode 100644 vendor/go.uber.org/atomic/uint32.go delete mode 100644 vendor/go.uber.org/atomic/uint64.go delete mode 100644 vendor/go.uber.org/atomic/uintptr.go delete mode 100644 vendor/go.uber.org/atomic/unsafe_pointer.go delete mode 100644 vendor/go.uber.org/atomic/value.go create mode 100644 vendor/go.uber.org/zap/.golangci.yml rename vendor/go.uber.org/zap/{LICENSE.txt => LICENSE} (100%) delete mode 100644 vendor/go.uber.org/zap/array_go118.go rename vendor/go.uber.org/{atomic/time.go => zap/internal/pool/pool.go} (56%) rename vendor/go.uber.org/zap/{stacktrace.go => internal/stacktrace/stack.go} (73%) rename vendor/go.uber.org/{atomic/bool_ext.go => zap/zapcore/lazy_with.go} (60%) create mode 100644 vendor/golang.org/x/sync/LICENSE create mode 100644 vendor/golang.org/x/sync/PATENTS create mode 100644 vendor/golang.org/x/sync/errgroup/errgroup.go create mode 100644 vendor/golang.org/x/sync/errgroup/go120.go create mode 100644 vendor/golang.org/x/sync/errgroup/pre_go120.go delete mode 100644 vendor/golang.org/x/sys/execabs/execabs.go delete mode 100644 vendor/golang.org/x/sys/execabs/execabs_go118.go delete mode 100644 vendor/golang.org/x/sys/execabs/execabs_go119.go create mode 100644 vendor/golang.org/x/sys/unix/bpxsvc_zos.go create mode 100644 vendor/golang.org/x/sys/unix/bpxsvc_zos.s delete mode 100644 vendor/golang.org/x/sys/unix/epoll_zos.go delete mode 100644 vendor/golang.org/x/sys/unix/fstatfs_zos.go create mode 100644 vendor/golang.org/x/sys/unix/sockcmsg_zos.go create mode 100644 vendor/golang.org/x/sys/unix/symaddr_zos_s390x.s create mode 100644 vendor/golang.org/x/sys/unix/zsymaddr_zos_s390x.s delete mode 100644 vendor/golang.org/x/sys/windows/empty.s create mode 100644 vendor/golang.org/x/tools/go/types/objectpath/objectpath.go create mode 100644 vendor/golang.org/x/tools/internal/aliases/aliases.go create mode 100644 vendor/golang.org/x/tools/internal/aliases/aliases_go121.go create mode 100644 vendor/golang.org/x/tools/internal/aliases/aliases_go122.go create mode 100644 vendor/golang.org/x/tools/internal/event/keys/util.go delete mode 100644 vendor/golang.org/x/tools/internal/event/tag/tag.go delete mode 100644 vendor/golang.org/x/tools/internal/gcimporter/support_go117.go delete mode 100644 vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go create mode 100644 vendor/golang.org/x/tools/internal/stdlib/manifest.go create mode 100644 vendor/golang.org/x/tools/internal/stdlib/stdlib.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/common.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/coretype.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/normalize.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/termlist.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go delete mode 100644 vendor/golang.org/x/tools/internal/typeparams/typeterm.go create mode 100644 vendor/golang.org/x/tools/internal/typesinternal/recv.go create mode 100644 vendor/golang.org/x/tools/internal/typesinternal/toonew.go delete mode 100644 vendor/golang.org/x/tools/internal/typesinternal/types_118.go create mode 100644 vendor/golang.org/x/tools/internal/versions/features.go create mode 100644 vendor/golang.org/x/tools/internal/versions/gover.go create mode 100644 vendor/golang.org/x/tools/internal/versions/toolchain.go create mode 100644 vendor/golang.org/x/tools/internal/versions/toolchain_go119.go create mode 100644 vendor/golang.org/x/tools/internal/versions/toolchain_go120.go create mode 100644 vendor/golang.org/x/tools/internal/versions/toolchain_go121.go create mode 100644 vendor/golang.org/x/tools/internal/versions/types.go create mode 100644 vendor/golang.org/x/tools/internal/versions/types_go121.go create mode 100644 vendor/golang.org/x/tools/internal/versions/types_go122.go create mode 100644 vendor/golang.org/x/tools/internal/versions/versions.go diff --git a/go.mod b/go.mod index 0e3cd91..ae3391e 100644 --- a/go.mod +++ b/go.mod @@ -3,26 +3,26 @@ module github.com/thesoulless/incase go 1.19 require ( - github.com/caddyserver/certmagic v0.20.0 + github.com/caddyserver/certmagic v0.21.2 github.com/go-chi/chi/v5 v5.0.12 github.com/rs/xid v1.5.0 golang.org/x/exp v0.0.0-20221217163422-3c43f8badb15 ) require ( - github.com/klauspost/cpuid/v2 v2.2.5 // indirect - github.com/libdns/libdns v0.2.1 // indirect - github.com/mholt/acmez v1.2.0 // indirect - github.com/miekg/dns v1.1.55 // indirect - github.com/pkg/errors v0.9.1 // indirect + github.com/caddyserver/zerossl v0.1.3 // indirect + github.com/klauspost/cpuid/v2 v2.2.7 // indirect + github.com/libdns/libdns v0.2.2 // indirect + github.com/mholt/acmez/v2 v2.0.1 // indirect + github.com/miekg/dns v1.1.59 // indirect github.com/zeebo/blake3 v0.2.3 // indirect - go.uber.org/atomic v1.11.0 // indirect go.uber.org/multierr v1.11.0 // indirect - go.uber.org/zap v1.24.0 // indirect - golang.org/x/crypto v0.21.0 // indirect - golang.org/x/mod v0.11.0 // indirect - golang.org/x/net v0.23.0 // indirect - golang.org/x/sys v0.18.0 // indirect - golang.org/x/text v0.14.0 // indirect - golang.org/x/tools v0.10.0 // indirect + go.uber.org/zap v1.27.0 // indirect + golang.org/x/crypto v0.23.0 // indirect + golang.org/x/mod v0.17.0 // indirect + golang.org/x/net v0.25.0 // indirect + golang.org/x/sync v0.7.0 // indirect + golang.org/x/sys v0.20.0 // indirect + golang.org/x/text v0.15.0 // indirect + golang.org/x/tools v0.21.0 // indirect ) diff --git a/go.sum b/go.sum index 12418bc..09cd9b5 100644 --- a/go.sum +++ b/go.sum @@ -1,51 +1,49 @@ -github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLju8= -github.com/caddyserver/certmagic v0.20.0 h1:bTw7LcEZAh9ucYCRXyCpIrSAGplplI0vGYJ4BpCQ/Fc= -github.com/caddyserver/certmagic v0.20.0/go.mod h1:N4sXgpICQUskEWpj7zVzvWD41p3NYacrNoZYiRM2jTg= +github.com/caddyserver/certmagic v0.21.2 h1:O18LtaYBGDooyy257cYePnhp4lPfz6TaJELil6Q1fDg= +github.com/caddyserver/certmagic v0.21.2/go.mod h1:Zq6pklO9nVRl3DIFUw9gVUfXKdpc/0qwTUAQMBlfgtI= +github.com/caddyserver/zerossl v0.1.3 h1:onS+pxp3M8HnHpN5MMbOMyNjmTheJyWRaZYwn+YTAyA= +github.com/caddyserver/zerossl v0.1.3/go.mod h1:CxA0acn7oEGO6//4rtrRjYgEoa4MFw/XofZnrYwGqG4= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/go-chi/chi/v5 v5.0.12 h1:9euLV5sTrTNTRUU9POmDUvfxyj6LAABLUcEWO+JJb4s= github.com/go-chi/chi/v5 v5.0.12/go.mod h1:DslCQbL2OYiznFReuXYUmQ2hGd1aDpCnlMNITLSKoi8= github.com/klauspost/cpuid/v2 v2.0.12/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= -github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= -github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= -github.com/libdns/libdns v0.2.1 h1:Wu59T7wSHRgtA0cfxC+n1c/e+O3upJGWytknkmFEDis= -github.com/libdns/libdns v0.2.1/go.mod h1:yQCXzk1lEZmmCPa857bnk4TsOiqYasqpyOEeSObbb40= -github.com/mholt/acmez v1.2.0 h1:1hhLxSgY5FvH5HCnGUuwbKY2VQVo8IU7rxXKSnZ7F30= -github.com/mholt/acmez v1.2.0/go.mod h1:VT9YwH1xgNX1kmYY89gY8xPJC84BFAisjo8Egigt4kE= -github.com/miekg/dns v1.1.55 h1:GoQ4hpsj0nFLYe+bWiCToyrBEJXkQfOOIvFGFy0lEgo= -github.com/miekg/dns v1.1.55/go.mod h1:uInx36IzPl7FYnDcMeVWxj9byh7DutNykX4G9Sj60FY= -github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= -github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= +github.com/klauspost/cpuid/v2 v2.2.7 h1:ZWSB3igEs+d0qvnxR/ZBzXVmxkgt8DdzP6m9pfuVLDM= +github.com/klauspost/cpuid/v2 v2.2.7/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= +github.com/libdns/libdns v0.2.2/go.mod h1:4Bj9+5CQiNMVGf87wjX4CY3HQJypUHRuLvlsfsZqLWQ= +github.com/mholt/acmez/v2 v2.0.1 h1:3/3N0u1pLjMK4sNEAFSI+bcvzbPhRpY383sy1kLHJ6k= +github.com/mholt/acmez/v2 v2.0.1/go.mod h1:fX4c9r5jYwMyMsC+7tkYRxHibkOTgta5DIFGoe67e1U= +github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= +github.com/miekg/dns v1.1.59/go.mod h1:nZpewl5p6IvctfgrckopVx2OlSEHPRO/U4SYkRklrEk= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/rs/xid v1.5.0 h1:mKX4bl4iPYJtEIxp6CYiUuLQ/8DYMoz0PUdtGgMFRVc= github.com/rs/xid v1.5.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg= -github.com/stretchr/testify v1.8.0 h1:pSgiaMZlXftHpm5L7V1+rVB+AZJydKsMxsQBIJw4PKk= +github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk= github.com/zeebo/assert v1.1.0 h1:hU1L1vLTHsnO8x8c9KAR5GmM5QscxHg5RNU5z5qbUWY= github.com/zeebo/assert v1.1.0/go.mod h1:Pq9JiuJQpG8JLJdtkwrJESF0Foym2/D9XMU5ciN/wJ0= github.com/zeebo/blake3 v0.2.3 h1:TFoLXsjeXqRNFxSbk35Dk4YtszE/MQQGK10BH4ptoTg= github.com/zeebo/blake3 v0.2.3/go.mod h1:mjJjZpnsyIVtVgTOSpJ9vmRE4wgDeyt2HU3qXvvKCaQ= github.com/zeebo/pcg v1.0.1 h1:lyqfGeWiv4ahac6ttHs+I5hwtH/+1mrhlCtVNQM2kHo= github.com/zeebo/pcg v1.0.1/go.mod h1:09F0S9iiKrwn9rlI5yjLkmrug154/YRW6KnnXVDM/l4= -go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= -go.uber.org/atomic v1.11.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0= -go.uber.org/goleak v1.1.11 h1:wy28qYRKZgnJTxGxvye5/wgWr1EKjmUDGYox5mGlRlI= +go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto= go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= go.uber.org/multierr v1.11.0/go.mod h1:20+QtiLqy0Nd6FdQB9TLXag12DsQkrbs3htMFfDN80Y= -go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= -go.uber.org/zap v1.24.0/go.mod h1:2kMP+WWQ8aoFoedH3T2sq6iJ2yDWpHbP0f6MQbS9Gkg= -golang.org/x/crypto v0.21.0 h1:X31++rzVUdKhX5sWmSOFZxx8UW/ldWx55cbf08iNAMA= -golang.org/x/crypto v0.21.0/go.mod h1:0BP7YvVV9gBbVKyeTG0Gyn+gZm94bibOW5BjDEYAOMs= +go.uber.org/zap v1.27.0 h1:aJMhYGrd5QSmlpLMr2MftRKl7t8J8PTZPA732ud/XR8= +go.uber.org/zap v1.27.0/go.mod h1:GB2qFLM7cTU87MWRP2mPIjqfIDnGu+VIO4V/SdhGo2E= +golang.org/x/crypto v0.23.0 h1:dIJU/v2J8Mdglj/8rJ6UUOM3Zc9zLZxVZwwxMooUSAI= +golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8= golang.org/x/exp v0.0.0-20221217163422-3c43f8badb15 h1:5oN1Pz/eDhCpbMbLstvIPa0b/BEQo6g6nwV3pLjfM6w= golang.org/x/exp v0.0.0-20221217163422-3c43f8badb15/go.mod h1:CxIveKay+FTh1D0yPZemJVgC/95VzuuOLq5Qi4xnoYc= -golang.org/x/mod v0.11.0 h1:bUO06HqtnRcc/7l71XBe4WcqTZ+3AH1J59zWDDwLKgU= -golang.org/x/mod v0.11.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= -golang.org/x/net v0.23.0 h1:7EYJ93RZ9vYSZAIb2x3lnuvqO5zneoD6IvWjuhfxjTs= -golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg= -golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E= +golang.org/x/mod v0.17.0 h1:zY54UmvipHiNd+pm+m0x9KhZ9hl1/7QNMyxXbc6ICqA= +golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c= +golang.org/x/net v0.25.0 h1:d/OCCoBEUq33pjydKrGQhw7IlUPI2Oylr+8qLx49kac= +golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM= +golang.org/x/sync v0.7.0 h1:YsImfSBoP9QPYL0xyKJPq0gcaJdG3rInoqxTWbfQu9M= +golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.18.0 h1:DBdB3niSjOA/O0blCZBqDefyWNYveAYMNF1Wum0DYQ4= -golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= -golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= -golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= -golang.org/x/tools v0.10.0 h1:tvDr/iQoUqNdohiYm0LmmKcBk+q86lb9EprIUFhHHGg= -golang.org/x/tools v0.10.0/go.mod h1:UJwyiVBsOA2uwvK/e5OY3GTpDUJriEd+/YlqAwLPmyM= +golang.org/x/sys v0.20.0 h1:Od9JTbYCk261bKm4M/mw7AklTlFYIa0bIp9BgSm1S8Y= +golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/text v0.15.0 h1:h1V/4gjBv8v9cjcR6+AR5+/cIYK5N/WAgiv4xlsEtAk= +golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= +golang.org/x/tools v0.21.0 h1:qc0xYgIbsSDt9EyWz05J5wfa7LOVW0YTLOXrqdLAWIw= +golang.org/x/tools v0.21.0/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= diff --git a/vendor/github.com/caddyserver/certmagic/README.md b/vendor/github.com/caddyserver/certmagic/README.md index 8e3b145..c1aa8f5 100644 --- a/vendor/github.com/caddyserver/certmagic/README.md +++ b/vendor/github.com/caddyserver/certmagic/README.md @@ -60,13 +60,16 @@ CertMagic - Automatic HTTPS using Let's Encrypt - [Advanced use](#advanced-use) - [Wildcard Certificates](#wildcard-certificates) - [Behind a load balancer (or in a cluster)](#behind-a-load-balancer-or-in-a-cluster) - - [The ACME Challenges](#the-acme-challenges) - - [HTTP Challenge](#http-challenge) - - [TLS-ALPN Challenge](#tls-alpn-challenge) - - [DNS Challenge](#dns-challenge) - - [On-Demand TLS](#on-demand-tls) - - [Storage](#storage) - - [Cache](#cache) +- [The ACME Challenges](#the-acme-challenges) + - [HTTP Challenge](#http-challenge) + - [TLS-ALPN Challenge](#tls-alpn-challenge) + - [DNS Challenge](#dns-challenge) +- [On-Demand TLS](#on-demand-tls) +- [Storage](#storage) +- [Cache](#cache) +- [Events](#events) +- [ZeroSSL](#zerossl) +- [FAQ](#faq) - [Contributing](#contributing) - [Project History](#project-history) - [Credits and License](#credits-and-license) @@ -87,7 +90,7 @@ CertMagic - Automatic HTTPS using Let's Encrypt - Exponential backoff with carefully-tuned intervals - Retries with optional test/staging CA endpoint instead of production, to avoid rate limits - Written in Go, a language with memory-safety guarantees -- Powered by [ACMEz](https://github.com/mholt/acmez), _the_ premier ACME client library for Go +- Powered by [ACMEz](https://github.com/mholt/acmez/v2), _the_ premier ACME client library for Go - All [libdns](https://github.com/libdns) DNS providers work out-of-the-box - Pluggable storage backends (default: file system) - Pluggable key sources @@ -110,6 +113,7 @@ CertMagic - Automatic HTTPS using Let's Encrypt - Cross-platform support! Mac, Windows, Linux, BSD, Android... - Scales to hundreds of thousands of names/certificates per instance - Use in conjunction with your own certificates +- Full support for [draft-ietf-acme-ari](https://datatracker.ietf.org/doc/draft-ietf-acme-ari/) (ACME Renewal Information; ARI) extension ## Requirements @@ -125,6 +129,7 @@ CertMagic - Automatic HTTPS using Let's Encrypt 4. Persistent storage - Typically the local file system (default) - Other integrations available/possible +5. Go 1.21 or newer **_Before using this library, your domain names MUST be pointed (A/AAAA records) at your server (unless you use the DNS challenge)!_** @@ -292,7 +297,7 @@ tlsConfig.NextProtos = append([]string{"h2", "http/1.1"}, tlsConfig.NextProtos.. // we can simply set its GetCertificate field and append the // TLS-ALPN challenge protocol to the NextProtos myTLSConfig.GetCertificate = magic.GetCertificate -myTLSConfig.NextProtos = append(myTLSConfig.NextProtos, tlsalpn01.ACMETLS1Protocol) +myTLSConfig.NextProtos = append(myTLSConfig.NextProtos, acmez.ACMETLS1Protocol) // the HTTP challenge has to be handled by your HTTP server; // if you don't have one, you should have disabled it earlier @@ -379,7 +384,7 @@ Or make two simple changes to an existing `tls.Config`: ```go myTLSConfig.GetCertificate = magic.GetCertificate -myTLSConfig.NextProtos = append(myTLSConfig.NextProtos, tlsalpn01.ACMETLS1Protocol} +myTLSConfig.NextProtos = append(myTLSConfig.NextProtos, acmez.ACMETLS1Protocol} ``` Then just make sure your TLS listener is listening on port 443: @@ -401,8 +406,10 @@ To enable it, just set the `DNS01Solver` field on a `certmagic.ACMEIssuer` struc import "github.com/libdns/cloudflare" certmagic.DefaultACME.DNS01Solver = &certmagic.DNS01Solver{ - DNSProvider: &cloudflare.Provider{ - APIToken: "topsecret", + DNSManager: certmagic.DNSManager{ + DNSProvider: &cloudflare.Provider{ + APIToken: "topsecret", + }, }, } ``` @@ -504,6 +511,26 @@ CertMagic emits events when possible things of interest happen. Set the [`OnEven `OnEvent` can return an error. Some events may be aborted by returning an error. For example, returning an error from `cert_obtained` can cancel obtaining the certificate. Only return an error from `OnEvent` if you want to abort program flow. +## ZeroSSL + +ZeroSSL has both ACME and HTTP API services for getting certificates. CertMagic works with both of them. + +To use ZeroSSL's ACME server, configure CertMagic with an [`ACMEIssuer`](https://pkg.go.dev/github.com/caddyserver/certmagic#ACMEIssuer) like you would with any other ACME CA (just adjust the directory URL). External Account Binding (EAB) is required for ZeroSSL. You can use the [ZeroSSL API](https://pkg.go.dev/github.com/caddyserver/zerossl) to generate one, or your account dashboard. + +To use ZeroSSL's API instead, use the [`ZeroSSLIssuer`](https://pkg.go.dev/github.com/caddyserver/certmagic#ZeroSSLIssuer). Here is a simple example: + +```go +magic := certmagic.NewDefault() + +magic.Issuers = []certmagic.Issuer{ + certmagic.ZeroSSLIssuer{ + APIKey: "", + }), +} + +err := magic.ManageSync(ctx, []string{"example.com"}) +``` + ## FAQ ### Can I use some of my own certificates while using CertMagic? @@ -540,7 +567,7 @@ We welcome your contributions! Please see our **[contributing guidelines](https: ## Project History -CertMagic is the core of Caddy's advanced TLS automation code, extracted into a library. The underlying ACME client implementation is [ACMEz](https://github.com/mholt/acmez). CertMagic's code was originally a central part of Caddy even before Let's Encrypt entered public beta in 2015. +CertMagic is the core of Caddy's advanced TLS automation code, extracted into a library. The underlying ACME client implementation is [ACMEz](https://github.com/mholt/acmez/v2). CertMagic's code was originally a central part of Caddy even before Let's Encrypt entered public beta in 2015. In the years since then, Caddy's TLS automation techniques have been widely adopted, tried and tested in production, and served millions of sites and secured trillions of connections. diff --git a/vendor/github.com/caddyserver/certmagic/account.go b/vendor/github.com/caddyserver/certmagic/account.go index f3cb755..f3b8d44 100644 --- a/vendor/github.com/caddyserver/certmagic/account.go +++ b/vendor/github.com/caddyserver/certmagic/account.go @@ -32,7 +32,7 @@ import ( "strings" "sync" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" ) // getAccount either loads or creates a new account, depending on if @@ -88,11 +88,18 @@ func (*ACMEIssuer) newAccount(email string) (acme.Account, error) { // If it does not exist in storage, it will be retrieved from the ACME server and added to storage. // The account must already exist; it does not create a new account. func (am *ACMEIssuer) GetAccount(ctx context.Context, privateKeyPEM []byte) (acme.Account, error) { - account, err := am.loadAccountByKey(ctx, privateKeyPEM) - if errors.Is(err, fs.ErrNotExist) { - account, err = am.lookUpAccount(ctx, privateKeyPEM) + email := am.getEmail() + if email == "" { + if account, err := am.loadAccountByKey(ctx, privateKeyPEM); err == nil { + return account, nil + } + } else { + keyBytes, err := am.config.Storage.Load(ctx, am.storageKeyUserPrivateKey(am.CA, email)) + if err == nil && bytes.Equal(bytes.TrimSpace(keyBytes), bytes.TrimSpace(privateKeyPEM)) { + return am.loadAccount(ctx, am.CA, email) + } } - return account, err + return am.lookUpAccount(ctx, privateKeyPEM) } // loadAccountByKey loads the account with the given private key from storage, if it exists. @@ -107,9 +114,14 @@ func (am *ACMEIssuer) loadAccountByKey(ctx context.Context, privateKeyPEM []byte email := path.Base(accountFolderKey) keyBytes, err := am.config.Storage.Load(ctx, am.storageKeyUserPrivateKey(am.CA, email)) if err != nil { - return acme.Account{}, err + // Try the next account: This one is missing its private key, if it turns out to be the one we're looking + // for we will try to save it again after confirming with the ACME server. + continue } if bytes.Equal(bytes.TrimSpace(keyBytes), bytes.TrimSpace(privateKeyPEM)) { + // Found the account with the correct private key, try loading it. If this fails we we will follow + // the same procedure as if the private key was not found and confirm with the ACME server before saving + // it again. return am.loadAccount(ctx, am.CA, email) } } @@ -171,6 +183,16 @@ func (am *ACMEIssuer) saveAccount(ctx context.Context, ca string, account acme.A return storeTx(ctx, am.config.Storage, all) } +// deleteAccountLocally deletes the registration info and private key of the account +// for the given CA from storage. +func (am *ACMEIssuer) deleteAccountLocally(ctx context.Context, ca string, account acme.Account) error { + primaryContact := getPrimaryContact(account) + if err := am.config.Storage.Delete(ctx, am.storageKeyUserReg(ca, primaryContact)); err != nil { + return err + } + return am.config.Storage.Delete(ctx, am.storageKeyUserPrivateKey(ca, primaryContact)) +} + // setEmail does everything it can to obtain an email address // from the user within the scope of memory and storage to use // for ACME TLS. If it cannot get an email address, it does nothing diff --git a/vendor/github.com/caddyserver/certmagic/acmeclient.go b/vendor/github.com/caddyserver/certmagic/acmeclient.go index e9569af..8d7888f 100644 --- a/vendor/github.com/caddyserver/certmagic/acmeclient.go +++ b/vendor/github.com/caddyserver/certmagic/acmeclient.go @@ -18,23 +18,19 @@ import ( "context" "crypto/x509" "fmt" - weakrand "math/rand" "net" + "net/http" "net/url" "strconv" "strings" "sync" "time" - "github.com/mholt/acmez" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" ) -func init() { - weakrand.Seed(time.Now().UnixNano()) -} - // acmeClient holds state necessary to perform ACME operations // for certificate management with an ACME account. Call // ACMEIssuer.newACMEClientWithAccount() to get a valid one. @@ -141,44 +137,21 @@ func (iss *ACMEIssuer) newACMEClientWithAccount(ctx context.Context, useTestCA, // independent of any particular ACME account. If useTestCA is true, am.TestCA // will be used if it is set; otherwise, the primary CA will be used. func (iss *ACMEIssuer) newACMEClient(useTestCA bool) (*acmez.Client, error) { - // ensure defaults are filled in - var caURL string - if useTestCA { - caURL = iss.TestCA - } - if caURL == "" { - caURL = iss.CA + client, err := iss.newBasicACMEClient() + if err != nil { + return nil, err } - if caURL == "" { - caURL = DefaultACME.CA + + // fill in a little more beyond a basic client + if useTestCA && iss.TestCA != "" { + client.Client.Directory = iss.TestCA } certObtainTimeout := iss.CertObtainTimeout if certObtainTimeout == 0 { certObtainTimeout = DefaultACME.CertObtainTimeout } - - // ensure endpoint is secure (assume HTTPS if scheme is missing) - if !strings.Contains(caURL, "://") { - caURL = "https://" + caURL - } - u, err := url.Parse(caURL) - if err != nil { - return nil, err - } - if u.Scheme != "https" && !isLoopback(u.Host) && !isInternal(u.Host) { - return nil, fmt.Errorf("%s: insecure CA URL (HTTPS required)", caURL) - } - - client := &acmez.Client{ - Client: &acme.Client{ - Directory: caURL, - PollTimeout: certObtainTimeout, - UserAgent: buildUAString(), - HTTPClient: iss.httpClient, - }, - ChallengeSolvers: make(map[string]acmez.Solver), - } - client.Logger = iss.Logger.Named("acme_client") + client.Client.PollTimeout = certObtainTimeout + client.ChallengeSolvers = make(map[string]acmez.Solver) // configure challenges (most of the time, DNS challenge is // exclusive of other ones because it is usually only used @@ -186,38 +159,24 @@ func (iss *ACMEIssuer) newACMEClient(useTestCA bool) (*acmez.Client, error) { if iss.DNS01Solver == nil { // enable HTTP-01 challenge if !iss.DisableHTTPChallenge { - useHTTPPort := HTTPChallengePort - if HTTPPort > 0 && HTTPPort != HTTPChallengePort { - useHTTPPort = HTTPPort - } - if iss.AltHTTPPort > 0 { - useHTTPPort = iss.AltHTTPPort - } client.ChallengeSolvers[acme.ChallengeTypeHTTP01] = distributedSolver{ storage: iss.config.Storage, storageKeyIssuerPrefix: iss.storageKeyCAPrefix(client.Directory), solver: &httpSolver{ - acmeIssuer: iss, - address: net.JoinHostPort(iss.ListenHost, strconv.Itoa(useHTTPPort)), + handler: iss.HTTPChallengeHandler(http.NewServeMux()), + address: net.JoinHostPort(iss.ListenHost, strconv.Itoa(iss.getHTTPPort())), }, } } // enable TLS-ALPN-01 challenge if !iss.DisableTLSALPNChallenge { - useTLSALPNPort := TLSALPNChallengePort - if HTTPSPort > 0 && HTTPSPort != TLSALPNChallengePort { - useTLSALPNPort = HTTPSPort - } - if iss.AltTLSALPNPort > 0 { - useTLSALPNPort = iss.AltTLSALPNPort - } client.ChallengeSolvers[acme.ChallengeTypeTLSALPN01] = distributedSolver{ storage: iss.config.Storage, storageKeyIssuerPrefix: iss.storageKeyCAPrefix(client.Directory), solver: &tlsALPNSolver{ config: iss.config, - address: net.JoinHostPort(iss.ListenHost, strconv.Itoa(useTLSALPNPort)), + address: net.JoinHostPort(iss.ListenHost, strconv.Itoa(iss.getTLSALPNPort())), }, } } @@ -248,6 +207,64 @@ func (iss *ACMEIssuer) newACMEClient(useTestCA bool) (*acmez.Client, error) { return client, nil } +// newBasicACMEClient sets up a basically-functional ACME client that is not capable +// of solving challenges but can provide basic interactions with the server. +func (iss *ACMEIssuer) newBasicACMEClient() (*acmez.Client, error) { + caURL := iss.CA + if caURL == "" { + caURL = DefaultACME.CA + } + // ensure endpoint is secure (assume HTTPS if scheme is missing) + if !strings.Contains(caURL, "://") { + caURL = "https://" + caURL + } + u, err := url.Parse(caURL) + if err != nil { + return nil, err + } + if u.Scheme != "https" && !SubjectIsInternal(u.Host) { + return nil, fmt.Errorf("%s: insecure CA URL (HTTPS required for non-internal CA)", caURL) + } + return &acmez.Client{ + Client: &acme.Client{ + Directory: caURL, + UserAgent: buildUAString(), + HTTPClient: iss.httpClient, + Logger: iss.Logger.Named("acme_client"), + }, + }, nil +} + +func (iss *ACMEIssuer) getRenewalInfo(ctx context.Context, cert Certificate) (acme.RenewalInfo, error) { + acmeClient, err := iss.newBasicACMEClient() + if err != nil { + return acme.RenewalInfo{}, err + } + return acmeClient.GetRenewalInfo(ctx, cert.Certificate.Leaf) +} + +func (iss *ACMEIssuer) getHTTPPort() int { + useHTTPPort := HTTPChallengePort + if HTTPPort > 0 && HTTPPort != HTTPChallengePort { + useHTTPPort = HTTPPort + } + if iss.AltHTTPPort > 0 { + useHTTPPort = iss.AltHTTPPort + } + return useHTTPPort +} + +func (iss *ACMEIssuer) getTLSALPNPort() int { + useTLSALPNPort := TLSALPNChallengePort + if HTTPSPort > 0 && HTTPSPort != TLSALPNChallengePort { + useTLSALPNPort = HTTPSPort + } + if iss.AltTLSALPNPort > 0 { + useTLSALPNPort = iss.AltTLSALPNPort + } + return useTLSALPNPort +} + func (c *acmeClient) throttle(ctx context.Context, names []string) error { email := c.iss.getEmail() diff --git a/vendor/github.com/caddyserver/certmagic/acmeissuer.go b/vendor/github.com/caddyserver/certmagic/acmeissuer.go index 580a772..87fa5ff 100644 --- a/vendor/github.com/caddyserver/certmagic/acmeissuer.go +++ b/vendor/github.com/caddyserver/certmagic/acmeissuer.go @@ -1,3 +1,17 @@ +// Copyright 2015 Matthew Holt +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + package certmagic import ( @@ -14,8 +28,8 @@ import ( "sync" "time" - "github.com/mholt/acmez" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" ) @@ -55,6 +69,13 @@ type ACMEIssuer struct { // with this ACME account ExternalAccount *acme.EAB + // Optionally specify the validity period of + // the certificate(s) here as offsets from the + // approximate time of certificate issuance, + // but note that not all CAs support this + // (EXPERIMENTAL: Subject to change) + NotBefore, NotAfter time.Duration + // Disable all HTTP challenges DisableHTTPChallenge bool @@ -169,6 +190,12 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer { if template.ExternalAccount == nil { template.ExternalAccount = DefaultACME.ExternalAccount } + if template.NotBefore == 0 { + template.NotBefore = DefaultACME.NotBefore + } + if template.NotAfter == 0 { + template.NotAfter = DefaultACME.NotAfter + } if !template.DisableHTTPChallenge { template.DisableHTTPChallenge = DefaultACME.DisableHTTPChallenge } @@ -296,14 +323,32 @@ func (iss *ACMEIssuer) isAgreed() bool { // PreCheck performs a few simple checks before obtaining or // renewing a certificate with ACME, and returns whether this -// batch is eligible for certificates if using Let's Encrypt. -// It also ensures that an email address is available. +// batch is eligible for certificates. It also ensures that an +// email address is available if possible. +// +// IP certificates via ACME are defined in RFC 8738. func (am *ACMEIssuer) PreCheck(ctx context.Context, names []string, interactive bool) error { - publicCA := strings.Contains(am.CA, "api.letsencrypt.org") || strings.Contains(am.CA, "acme.zerossl.com") || strings.Contains(am.CA, "api.pki.goog") + publicCAsAndIPCerts := map[string]bool{ // map of public CAs to whether they support IP certificates (last updated: Q1 2024) + "api.letsencrypt.org": false, // https://community.letsencrypt.org/t/certificate-for-static-ip/84/2?u=mholt + "acme.zerossl.com": false, // only supported via their API, not ACME endpoint + "api.pki.goog": true, // https://pki.goog/faq/#faq-IPCerts + "api.buypass.com": false, // https://community.buypass.com/t/h7hm76w/buypass-support-for-rfc-8738 + "acme.ssl.com": false, + } + var publicCA, ipCertAllowed bool + for caSubstr, ipCert := range publicCAsAndIPCerts { + if strings.Contains(am.CA, caSubstr) { + publicCA, ipCertAllowed = true, ipCert + break + } + } if publicCA { for _, name := range names { if !SubjectQualifiesForPublicCert(name) { - return fmt.Errorf("subject does not qualify for a public certificate: %s", name) + return fmt.Errorf("subject '%s' does not qualify for a public certificate", name) + } + if !ipCertAllowed && SubjectIsIP(name) { + return fmt.Errorf("subject '%s' cannot have public IP certificate from %s (if CA's policy has changed, please notify the developers in an issue)", name, am.CA) } } } @@ -317,12 +362,13 @@ func (am *ACMEIssuer) Issue(ctx context.Context, csr *x509.CertificateRequest) ( panic("missing config pointer (must use NewACMEIssuer)") } - var isRetry bool - if attempts, ok := ctx.Value(AttemptsCtxKey).(*int); ok { - isRetry = *attempts > 0 + var attempts int + if attemptsPtr, ok := ctx.Value(AttemptsCtxKey).(*int); ok { + attempts = *attemptsPtr } + isRetry := attempts > 0 - cert, usedTestCA, err := am.doIssue(ctx, csr, isRetry) + cert, usedTestCA, err := am.doIssue(ctx, csr, attempts) if err != nil { return nil, err } @@ -350,7 +396,7 @@ func (am *ACMEIssuer) Issue(ctx context.Context, csr *x509.CertificateRequest) ( // other endpoint. This is more likely to happen if a user is testing with // the staging CA as the main CA, then changes their configuration once they // think they are ready for the production endpoint. - cert, _, err = am.doIssue(ctx, csr, false) + cert, _, err = am.doIssue(ctx, csr, 0) if err != nil { // succeeded with test CA but failed just now with the production CA; // either we are observing differing internal states of each CA that will @@ -378,7 +424,8 @@ func (am *ACMEIssuer) Issue(ctx context.Context, csr *x509.CertificateRequest) ( return cert, err } -func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, useTestCA bool) (*IssuedCertificate, bool, error) { +func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, attempts int) (*IssuedCertificate, bool, error) { + useTestCA := attempts > 0 client, err := am.newACMEClientWithAccount(ctx, useTestCA, false) if err != nil { return nil, false, err @@ -393,12 +440,72 @@ func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, } } - certChains, err := client.acmeClient.ObtainCertificateUsingCSR(ctx, client.account, csr) + params, err := acmez.OrderParametersFromCSR(client.account, csr) if err != nil { - return nil, usingTestCA, fmt.Errorf("%v %w (ca=%s)", nameSet, err, client.acmeClient.Directory) + return nil, false, fmt.Errorf("generating order parameters from CSR: %v", err) + } + if am.NotBefore != 0 { + params.NotBefore = time.Now().Add(am.NotBefore) + } + if am.NotAfter != 0 { + params.NotAfter = time.Now().Add(am.NotAfter) + } + + // Notify the ACME server we are replacing a certificate (if the caller says we are), + // only if the following conditions are met: + // - The caller has set a Replaces value in the context, indicating this is a renewal. + // - Not using test CA. This should be obvious, but a test CA should be in a separate + // environment from production, and thus not have knowledge of the cert being replaced. + // - Not a certain attempt number. We skip setting Replaces once early on in the retries + // in case the reason the order is failing is only because there is a state inconsistency + // between client and server or some sort of bookkeeping error with regards to the certID + // and the server is rejecting the ARI certID. In any case, an invalid certID may cause + // orders to fail. So try once without setting it. + if !usingTestCA && attempts != 2 { + if replacing, ok := ctx.Value(ctxKeyARIReplaces).(*x509.Certificate); ok { + params.Replaces = replacing + } } - if len(certChains) == 0 { - return nil, usingTestCA, fmt.Errorf("no certificate chains") + + // do this in a loop because there's an error case that may necessitate a retry, but not more than once + var certChains []acme.Certificate + for i := 0; i < 2; i++ { + am.Logger.Info("using ACME account", + zap.String("account_id", params.Account.Location), + zap.Strings("account_contact", params.Account.Contact)) + + certChains, err = client.acmeClient.ObtainCertificate(ctx, params) + if err != nil { + var prob acme.Problem + if errors.As(err, &prob) && prob.Type == acme.ProblemTypeAccountDoesNotExist { + am.Logger.Warn("ACME account does not exist on server; attempting to recreate", + zap.String("account_id", client.account.Location), + zap.Strings("account_contact", client.account.Contact), + zap.String("key_location", am.storageKeyUserPrivateKey(client.acmeClient.Directory, am.getEmail())), + zap.Object("problem", prob)) + + // the account we have no longer exists on the CA, so we need to create a new one; + // we could use the same key pair, but this is a good opportunity to rotate keys + // (see https://caddy.community/t/acme-account-is-not-regenerated-when-acme-server-gets-reinstalled/22627) + // (basically this happens if the CA gets reset or reinstalled; usually just internal PKI) + err := am.deleteAccountLocally(ctx, client.iss.CA, client.account) + if err != nil { + return nil, usingTestCA, fmt.Errorf("%v ACME account no longer exists on CA, but resetting our local copy of the account info failed: %v", nameSet, err) + } + + // recreate account and try again + client, err = am.newACMEClientWithAccount(ctx, useTestCA, false) + if err != nil { + return nil, false, err + } + continue + } + return nil, usingTestCA, fmt.Errorf("%v %w (ca=%s)", nameSet, err, client.acmeClient.Directory) + } + if len(certChains) == 0 { + return nil, usingTestCA, fmt.Errorf("no certificate chains") + } + break } preferredChain := am.selectPreferredChain(certChains) @@ -408,6 +515,8 @@ func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, Metadata: preferredChain, } + am.Logger.Debug("selected certificate chain", zap.String("url", preferredChain.URL)) + return ic, usingTestCA, nil } @@ -523,16 +632,27 @@ var DefaultACME = ACMEIssuer{ HTTPProxy: http.ProxyFromEnvironment, } -// Some well-known CA endpoints available to use. +// Some well-known CA endpoints available to use. See +// the documentation for each service; some may require +// External Account Binding (EAB) and possibly payment. +// COMPATIBILITY NOTICE: These constants refer to external +// resources and are thus subject to change or removal +// without a major version bump. const ( - LetsEncryptStagingCA = "https://acme-staging-v02.api.letsencrypt.org/directory" - LetsEncryptProductionCA = "https://acme-v02.api.letsencrypt.org/directory" - ZeroSSLProductionCA = "https://acme.zerossl.com/v2/DV90" + LetsEncryptStagingCA = "https://acme-staging-v02.api.letsencrypt.org/directory" // https://letsencrypt.org/docs/staging-environment/ + LetsEncryptProductionCA = "https://acme-v02.api.letsencrypt.org/directory" // https://letsencrypt.org/getting-started/ + ZeroSSLProductionCA = "https://acme.zerossl.com/v2/DV90" // https://zerossl.com/documentation/acme/ + GoogleTrustStagingCA = "https://dv.acme-v02.test-api.pki.goog/directory" // https://cloud.google.com/certificate-manager/docs/public-ca-tutorial + GoogleTrustProductionCA = "https://dv.acme-v02.api.pki.goog/directory" // https://cloud.google.com/certificate-manager/docs/public-ca-tutorial ) // prefixACME is the storage key prefix used for ACME-specific assets. const prefixACME = "acme" +type ctxKey string + +const ctxKeyARIReplaces = ctxKey("ari_replaces") + // Interface guards var ( _ PreChecker = (*ACMEIssuer)(nil) diff --git a/vendor/github.com/caddyserver/certmagic/cache.go b/vendor/github.com/caddyserver/certmagic/cache.go index 152fe18..73d698f 100644 --- a/vendor/github.com/caddyserver/certmagic/cache.go +++ b/vendor/github.com/caddyserver/certmagic/cache.go @@ -16,7 +16,7 @@ package certmagic import ( "fmt" - weakrand "math/rand" // seeded elsewhere + weakrand "math/rand" "strings" "sync" "time" @@ -394,17 +394,26 @@ func (certCache *Cache) AllMatchingCertificates(name string) []Certificate { return certs } +// SubjectIssuer pairs a subject name with an issuer ID/key. +type SubjectIssuer struct { + Subject, IssuerKey string +} + // RemoveManaged removes managed certificates for the given subjects from the cache. -// This effectively stops maintenance of those certificates. -func (certCache *Cache) RemoveManaged(subjects []string) { +// This effectively stops maintenance of those certificates. If an IssuerKey is +// specified alongside the subject, only certificates for that subject from the +// specified issuer will be removed. +func (certCache *Cache) RemoveManaged(subjects []SubjectIssuer) { deleteQueue := make([]string, 0, len(subjects)) - for _, subject := range subjects { - certs := certCache.getAllMatchingCerts(subject) // does NOT expand wildcards; exact matches only + for _, subj := range subjects { + certs := certCache.getAllMatchingCerts(subj.Subject) // does NOT expand wildcards; exact matches only for _, cert := range certs { if !cert.managed { continue } - deleteQueue = append(deleteQueue, cert.hash) + if subj.IssuerKey == "" || cert.issuerKey == subj.IssuerKey { + deleteQueue = append(deleteQueue, cert.hash) + } } } certCache.Remove(deleteQueue) diff --git a/vendor/github.com/caddyserver/certmagic/certificates.go b/vendor/github.com/caddyserver/certmagic/certificates.go index dbee2aa..a5147a2 100644 --- a/vendor/github.com/caddyserver/certmagic/certificates.go +++ b/vendor/github.com/caddyserver/certmagic/certificates.go @@ -18,12 +18,15 @@ import ( "context" "crypto/tls" "crypto/x509" + "encoding/json" "fmt" + "math/rand" "net" "os" "strings" "time" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -56,6 +59,9 @@ type Certificate struct { // The unique string identifying the issuer of this certificate. issuerKey string + + // ACME Renewal Information, if available + ari acme.RenewalInfo } // Empty returns true if the certificate struct is not filled out; at @@ -67,10 +73,106 @@ func (cert Certificate) Empty() bool { // Hash returns a checksum of the certificate chain's DER-encoded bytes. func (cert Certificate) Hash() string { return cert.hash } -// NeedsRenewal returns true if the certificate is -// expiring soon (according to cfg) or has expired. +// NeedsRenewal returns true if the certificate is expiring +// soon (according to ARI and/or cfg) or has expired. func (cert Certificate) NeedsRenewal(cfg *Config) bool { - return currentlyInRenewalWindow(cert.Leaf.NotBefore, expiresAt(cert.Leaf), cfg.RenewalWindowRatio) + return cfg.certNeedsRenewal(cert.Leaf, cert.ari, true) +} + +// certNeedsRenewal consults ACME Renewal Info (ARI) and certificate expiration to determine +// whether the leaf certificate needs to be renewed yet. If true is returned, the certificate +// should be renewed as soon as possible. The reasoning for a true return value is logged +// unless emitLogs is false; this can be useful to suppress noisy logs in the case where you +// first call this to determine if a cert in memory needs renewal, and then right after you +// call it again to see if the cert in storage still needs renewal -- you probably don't want +// to log the second time for checking the cert in storage which is mainly for synchronization. +func (cfg *Config) certNeedsRenewal(leaf *x509.Certificate, ari acme.RenewalInfo, emitLogs bool) bool { + expiration := expiresAt(leaf) + + var logger *zap.Logger + if emitLogs { + logger = cfg.Logger.With( + zap.Strings("subjects", leaf.DNSNames), + zap.Time("expiration", expiration), + zap.String("ari_cert_id", ari.UniqueIdentifier), + zap.Timep("next_ari_update", ari.RetryAfter), + zap.Duration("renew_check_interval", cfg.certCache.options.RenewCheckInterval), + zap.Time("window_start", ari.SuggestedWindow.Start), + zap.Time("window_end", ari.SuggestedWindow.End)) + } else { + logger = zap.NewNop() + } + + // first check ARI: if it says it's time to renew, it's time to renew + // (notice that we don't strictly require an ARI window to also exist; we presume + // that if a time has been selected, a window does or did exist, even if it didn't + // get stored/encoded for some reason - but also: this allows administrators to + // manually or explicitly schedule a renewal time indepedently of ARI which could + // be useful) + selectedTime := ari.SelectedTime + + // if, for some reason a random time in the window hasn't been selected yet, but an ARI + // window does exist, we can always improvise one... even if this is called repeatedly, + // a random time is a random time, whether you generate it once or more :D + // (code borrowed from our acme package) + if selectedTime.IsZero() && + (!ari.SuggestedWindow.Start.IsZero() && !ari.SuggestedWindow.End.IsZero()) { + start, end := ari.SuggestedWindow.Start.Unix()+1, ari.SuggestedWindow.End.Unix() + selectedTime = time.Unix(rand.Int63n(end-start)+start, 0).UTC() + logger.Warn("no renewal time had been selected with ARI; chose an ephemeral one for now", + zap.Time("ephemeral_selected_time", selectedTime)) + } + + // if a renewal time has been selected, start with that + if !selectedTime.IsZero() { + // ARI spec recommends an algorithm that renews after the randomly-selected + // time OR just before it if the next waking time would be after it; this + // cutoff can actually be before the start of the renewal window, but the spec + // author says that's OK: https://github.com/aarongable/draft-acme-ari/issues/71 + cutoff := ari.SelectedTime.Add(-cfg.certCache.options.RenewCheckInterval) + if time.Now().After(cutoff) { + logger.Info("certificate needs renewal based on ARI window", + zap.Time("selected_time", selectedTime), + zap.Time("renewal_cutoff", cutoff)) + return true + } + + // according to ARI, we are not ready to renew; however, we do not rely solely on + // ARI calculations... what if there is a bug in our implementation, or in the + // server's, or the stored metadata? for redundancy, give credence to the expiration + // date; ignore ARI if we are past a "dangerously close" limit, to avoid any + // possibility of a bug in ARI compromising a site's uptime: we should always always + // always give heed to actual validity period + if currentlyInRenewalWindow(leaf.NotBefore, expiration, 1.0/20.0) { + logger.Warn("certificate is in emergency renewal window; superceding ARI", + zap.Duration("remaining", time.Until(expiration)), + zap.Time("renewal_cutoff", cutoff)) + return true + } + + } + + // the normal check, in the absence of ARI, is to determine if we're near enough (or past) + // the expiration date based on the configured remaining:lifetime ratio + if currentlyInRenewalWindow(leaf.NotBefore, expiration, cfg.RenewalWindowRatio) { + logger.Info("certificate is in configured renewal window based on expiration date", + zap.Duration("remaining", time.Until(expiration))) + return true + } + + // finally, if the certificate is expiring imminently, always attempt a renewal; + // we check both a (very low) lifetime ratio and also a strict difference between + // the time until expiration and the interval at which we run the standard maintenance + // routine to check for renewals, to accommodate both exceptionally long and short + // cert lifetimes + if currentlyInRenewalWindow(leaf.NotBefore, expiration, 1.0/50.0) || + time.Until(expiration) < cfg.certCache.options.RenewCheckInterval*5 { + logger.Warn("certificate is in emergency renewal window; expiration imminent", + zap.Duration("remaining", time.Until(expiration))) + return true + } + + return false } // Expired returns true if the certificate has expired. @@ -85,10 +187,12 @@ func (cert Certificate) Expired() bool { return time.Now().After(expiresAt(cert.Leaf)) } -// currentlyInRenewalWindow returns true if the current time is -// within the renewal window, according to the given start/end +// currentlyInRenewalWindow returns true if the current time is within +// (or after) the renewal window, according to the given start/end // dates and the ratio of the renewal window. If true is returned, -// the certificate being considered is due for renewal. +// the certificate being considered is due for renewal. The ratio +// is remaining:total time, i.e. 1/3 = 1/3 of lifetime remaining, +// or 9/10 = 9/10 of time lifetime remaining. func currentlyInRenewalWindow(notBefore, notAfter time.Time, renewalWindowRatio float64) bool { if notAfter.IsZero() { return false @@ -130,6 +234,7 @@ func expiresAt(cert *x509.Certificate) time.Time { // // This method is safe for concurrent use. func (cfg *Config) CacheManagedCertificate(ctx context.Context, domain string) (Certificate, error) { + domain = cfg.transformSubject(ctx, nil, domain) cert, err := cfg.loadManagedCertificate(ctx, domain) if err != nil { return cert, err @@ -153,16 +258,44 @@ func (cfg *Config) loadManagedCertificate(ctx context.Context, domain string) (C } cert.managed = true cert.issuerKey = certRes.issuerKey + if ari, err := certRes.getARI(); err == nil && ari != nil { + cert.ari = *ari + } return cert, nil } +// getARI unpacks ACME Renewal Information from the issuer data, if available. +// It is only an error if there is invalid JSON. +func (certRes CertificateResource) getARI() (*acme.RenewalInfo, error) { + acmeData, err := certRes.getACMEData() + if err != nil { + return nil, err + } + return acmeData.RenewalInfo, nil +} + +// getACMEData returns the ACME certificate metadata from the IssuerData, but +// note that a non-ACME-issued certificate may return an empty value and nil +// since the JSON may still decode successfully but just not match any or all +// of the fields. Remember that the IssuerKey is used to store and access the +// cert files in the first place (it is part of the path) so in theory if you +// load a CertificateResource from an ACME issuer it should work as expected. +func (certRes CertificateResource) getACMEData() (acme.Certificate, error) { + if len(certRes.IssuerData) == 0 { + return acme.Certificate{}, nil + } + var acmeCert acme.Certificate + err := json.Unmarshal(certRes.IssuerData, &acmeCert) + return acmeCert, err +} + // CacheUnmanagedCertificatePEMFile loads a certificate for host using certFile // and keyFile, which must be in PEM format. It stores the certificate in // the in-memory cache and returns the hash, useful for removing from the cache. // // This method is safe for concurrent use. func (cfg *Config) CacheUnmanagedCertificatePEMFile(ctx context.Context, certFile, keyFile string, tags []string) (string, error) { - cert, err := cfg.makeCertificateFromDiskWithOCSP(ctx, cfg.Storage, certFile, keyFile) + cert, err := cfg.makeCertificateFromDiskWithOCSP(ctx, certFile, keyFile) if err != nil { return "", err } @@ -185,6 +318,15 @@ func (cfg *Config) CacheUnmanagedTLSCertificate(ctx context.Context, tlsCert tls if err != nil { return "", err } + if time.Now().After(cert.Leaf.NotAfter) { + cfg.Logger.Warn("unmanaged certificate has expired", + zap.Time("not_after", cert.Leaf.NotAfter), + zap.Strings("sans", cert.Names)) + } else if time.Until(cert.Leaf.NotAfter) < 24*time.Hour { + cfg.Logger.Warn("unmanaged certificate expires within 1 day", + zap.Time("not_after", cert.Leaf.NotAfter), + zap.Strings("sans", cert.Names)) + } err = stapleOCSP(ctx, cfg.OCSP, cfg.Storage, &cert, nil) if err != nil { cfg.Logger.Warn("stapling OCSP", zap.Error(err)) @@ -215,7 +357,7 @@ func (cfg *Config) CacheUnmanagedCertificatePEMBytes(ctx context.Context, certBy // certificate and key files. It fills out all the fields in // the certificate except for the Managed and OnDemand flags. // (It is up to the caller to set those.) It staples OCSP. -func (cfg Config) makeCertificateFromDiskWithOCSP(ctx context.Context, storage Storage, certFile, keyFile string) (Certificate, error) { +func (cfg Config) makeCertificateFromDiskWithOCSP(ctx context.Context, certFile, keyFile string) (Certificate, error) { certPEMBlock, err := os.ReadFile(certFile) if err != nil { return Certificate{}, err @@ -319,21 +461,22 @@ func fillCertFromLeaf(cert *Certificate, tlsCert tls.Certificate) error { return nil } -// managedCertInStorageExpiresSoon returns true if cert (being a -// managed certificate) is expiring within RenewDurationBefore. -// It returns false if there was an error checking the expiration -// of the certificate as found in storage, or if the certificate -// in storage is NOT expiring soon. A certificate that is expiring +// managedCertInStorageNeedsRenewal returns true if cert (being a +// managed certificate) is expiring soon (according to cfg) or if +// ACME Renewal Information (ARI) is available and says that it is +// time to renew (it uses existing ARI; it does not update it). +// It returns false if there was an error, the cert is not expiring +// soon, and ARI window is still future. A certificate that is expiring // soon in our cache but is not expiring soon in storage probably // means that another instance renewed the certificate in the // meantime, and it would be a good idea to simply load the cert // into our cache rather than repeating the renewal process again. -func (cfg *Config) managedCertInStorageExpiresSoon(ctx context.Context, cert Certificate) (bool, error) { +func (cfg *Config) managedCertInStorageNeedsRenewal(ctx context.Context, cert Certificate) (bool, error) { certRes, err := cfg.loadCertResourceAnyIssuer(ctx, cert.Names[0]) if err != nil { return false, err } - _, needsRenew := cfg.managedCertNeedsRenewal(certRes) + _, _, needsRenew := cfg.managedCertNeedsRenewal(certRes, false) return needsRenew, nil } @@ -376,8 +519,8 @@ func SubjectQualifiesForCert(subj string) bool { // SubjectQualifiesForPublicCert returns true if the subject // name appears eligible for automagic TLS with a public -// CA such as Let's Encrypt. For example: localhost and IP -// addresses are not eligible because we cannot obtain certs +// CA such as Let's Encrypt. For example: internal IP addresses +// and localhost are not eligible because we cannot obtain certs // for those names with a public CA. Wildcard names are // allowed, as long as they conform to CABF requirements (only // one wildcard label, and it must be the left-most label). @@ -385,13 +528,9 @@ func SubjectQualifiesForPublicCert(subj string) bool { // must at least qualify for a certificate return SubjectQualifiesForCert(subj) && - // localhost, .localhost TLD, and .local TLD are ineligible + // loopback hosts and internal IPs are ineligible !SubjectIsInternal(subj) && - // cannot be an IP address (as of yet), see - // https://community.letsencrypt.org/t/certificate-for-static-ip/84/2?u=mholt - !SubjectIsIP(subj) && - // only one wildcard label allowed, and it must be left-most, with 3+ labels (!strings.Contains(subj, "*") || (strings.Count(subj, "*") == 1 && @@ -406,12 +545,55 @@ func SubjectIsIP(subj string) bool { } // SubjectIsInternal returns true if subj is an internal-facing -// hostname or address. +// hostname or address, including localhost/loopback hosts. +// Ports are ignored, if present. func SubjectIsInternal(subj string) bool { + subj = strings.ToLower(strings.TrimSuffix(hostOnly(subj), ".")) return subj == "localhost" || strings.HasSuffix(subj, ".localhost") || strings.HasSuffix(subj, ".local") || - strings.HasSuffix(subj, ".home.arpa") + strings.HasSuffix(subj, ".home.arpa") || + isInternalIP(subj) +} + +// isInternalIP returns true if the IP of addr +// belongs to a private network IP range. addr +// must only be an IP or an IP:port combination. +func isInternalIP(addr string) bool { + privateNetworks := []string{ + "127.0.0.0/8", // IPv4 loopback + "0.0.0.0/16", + "10.0.0.0/8", // RFC1918 + "172.16.0.0/12", // RFC1918 + "192.168.0.0/16", // RFC1918 + "169.254.0.0/16", // RFC3927 link-local + "::1/7", // IPv6 loopback + "fe80::/10", // IPv6 link-local + "fc00::/7", // IPv6 unique local addr + } + host := hostOnly(addr) + ip := net.ParseIP(host) + if ip == nil { + return false + } + for _, privateNetwork := range privateNetworks { + _, ipnet, _ := net.ParseCIDR(privateNetwork) + if ipnet.Contains(ip) { + return true + } + } + return false +} + +// hostOnly returns only the host portion of hostport. +// If there is no port or if there is an error splitting +// the port off, the whole input string is returned. +func hostOnly(hostport string) string { + host, _, err := net.SplitHostPort(hostport) + if err != nil { + return hostport // OK; probably had no port to begin with + } + return host } // MatchWildcard returns true if subject (a candidate DNS name) diff --git a/vendor/github.com/caddyserver/certmagic/certmagic.go b/vendor/github.com/caddyserver/certmagic/certmagic.go index 860f5e7..6b7be63 100644 --- a/vendor/github.com/caddyserver/certmagic/certmagic.go +++ b/vendor/github.com/caddyserver/certmagic/certmagic.go @@ -39,6 +39,7 @@ import ( "crypto" "crypto/tls" "crypto/x509" + "encoding/json" "fmt" "log" "net" @@ -302,52 +303,6 @@ type OnDemandConfig struct { hostAllowlist map[string]struct{} } -// isLoopback returns true if the hostname of addr looks -// explicitly like a common local hostname. addr must only -// be a host or a host:port combination. -func isLoopback(addr string) bool { - host := hostOnly(addr) - return host == "localhost" || - strings.Trim(host, "[]") == "::1" || - strings.HasPrefix(host, "127.") -} - -// isInternal returns true if the IP of addr -// belongs to a private network IP range. addr -// must only be an IP or an IP:port combination. -// Loopback addresses are considered false. -func isInternal(addr string) bool { - privateNetworks := []string{ - "10.0.0.0/8", - "172.16.0.0/12", - "192.168.0.0/16", - "fc00::/7", - } - host := hostOnly(addr) - ip := net.ParseIP(host) - if ip == nil { - return false - } - for _, privateNetwork := range privateNetworks { - _, ipnet, _ := net.ParseCIDR(privateNetwork) - if ipnet.Contains(ip) { - return true - } - } - return false -} - -// hostOnly returns only the host portion of hostport. -// If there is no port or if there is an error splitting -// the port off, the whole input string is returned. -func hostOnly(hostport string) string { - host, _, err := net.SplitHostPort(hostport) - if err != nil { - return hostport // OK; probably had no port to begin with - } - return host -} - // PreChecker is an interface that can be optionally implemented by // Issuers. Pre-checks are performed before each call (or batch of // identical calls) to Issue(), giving the issuer the option to ensure @@ -394,7 +349,12 @@ type Revoker interface { type Manager interface { // GetCertificate returns the certificate to use to complete the handshake. // Since this is called during every TLS handshake, it must be very fast and not block. - // Returning (nil, nil) is valid and is simply treated as a no-op. + // Returning any non-nil value indicates that this Manager manages a certificate + // for the described handshake. Returning (nil, nil) is valid and is simply treated as + // a no-op Return (nil, nil) when the Manager has no certificate for this handshake. + // Return an error or a certificate only if the Manager is supposed to get a certificate + // for this handshake. Returning (nil, nil) other Managers or Issuers to try to get + // a certificate for the handshake. GetCertificate(context.Context, *tls.ClientHelloInfo) (*tls.Certificate, error) } @@ -429,7 +389,8 @@ type IssuedCertificate struct { Certificate []byte // Any extra information to serialize alongside the - // certificate in storage. + // certificate in storage. It MUST be serializable + // as JSON in order to be preserved. Metadata any } @@ -450,7 +411,7 @@ type CertificateResource struct { // Any extra information associated with the certificate, // usually provided by the issuer implementation. - IssuerData any `json:"issuer_data,omitempty"` + IssuerData json.RawMessage `json:"issuer_data,omitempty"` // The unique string identifying the issuer of the // certificate; internally useful for storage access. diff --git a/vendor/github.com/caddyserver/certmagic/config.go b/vendor/github.com/caddyserver/certmagic/config.go index 3d80a7e..5a9cf49 100644 --- a/vendor/github.com/caddyserver/certmagic/config.go +++ b/vendor/github.com/caddyserver/certmagic/config.go @@ -24,17 +24,19 @@ import ( "crypto/x509/pkix" "encoding/asn1" "encoding/json" + "encoding/pem" "errors" "fmt" "io/fs" weakrand "math/rand" "net" + "net/http" "net/url" "strings" "time" - "github.com/mholt/acmez" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" "golang.org/x/net/idna" @@ -50,6 +52,7 @@ type Config struct { // it should be renewed; for most certificates, the // global default is good, but for extremely short- // lived certs, you may want to raise this to ~0.5. + // Ratio is remaining:total lifetime. RenewalWindowRatio float64 // An optional event callback clients can set @@ -135,9 +138,17 @@ type Config struct { // storage is properly configured and has sufficient // space, you can disable this check to reduce I/O // if that is expensive for you. - // EXPERIMENTAL: Option subject to change or removal. + // EXPERIMENTAL: Subject to change or removal. DisableStorageCheck bool + // SubjectTransformer is a hook that can transform the + // subject (SAN) of a certificate being loaded or issued. + // For example, a common use case is to replace the + // left-most label with an asterisk (*) to become a + // wildcard certificate. + // EXPERIMENTAL: Subject to change or removal. + SubjectTransformer func(ctx context.Context, domain string) string + // Set a logger to enable logging. If not set, // a default logger will be created. Logger *zap.Logger @@ -436,6 +447,15 @@ func (cfg *Config) manageOne(ctx context.Context, domainName string, async bool) return err } + // ensure ARI is updated before we check whether the cert needs renewing + // (we ignore the second return value because we already check if needs renewing anyway) + if cert.ari.NeedsRefresh() { + cert, _, err = cfg.updateARI(ctx, cert, cfg.Logger) + if err != nil { + cfg.Logger.Error("updating ARI upon managing", zap.Error(err)) + } + } + // otherwise, simply renew the certificate if needed if cert.NeedsRenewal(cfg) { var err error @@ -484,6 +504,10 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool return fmt.Errorf("no issuers configured; impossible to obtain or check for existing certificate in storage") } + log := cfg.Logger.Named("obtain") + + name = cfg.transformSubject(ctx, log, name) + // if storage has all resources for this certificate, obtain is a no-op if cfg.storageHasCertResourcesAnyIssuer(ctx, name) { return nil @@ -496,8 +520,6 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool return fmt.Errorf("failed storage check: %v - storage is probably misconfigured", err) } - log := cfg.Logger.Named("obtain") - log.Info("acquiring lock", zap.String("identifier", name)) // ensure idempotency of the obtain operation for this name @@ -561,7 +583,7 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool } } - csr, err := cfg.generateCSR(privKey, []string{name}) + csr, err := cfg.generateCSR(privKey, []string{name}, false) if err != nil { return err } @@ -583,7 +605,19 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool } } - issuedCert, err = issuer.Issue(ctx, csr) + // TODO: ZeroSSL's API currently requires CommonName to be set, and requires it be + // distinct from SANs. If this was a cert it would violate the BRs, but their certs + // are compliant, so their CSR requirements just needlessly add friction, complexity, + // and inefficiency for clients. CommonName has been deprecated for 25+ years. + useCSR := csr + if issuer.IssuerKey() == zerosslIssuerKey { + useCSR, err = cfg.generateCSR(privKey, []string{name}, true) + if err != nil { + return err + } + } + + issuedCert, err = issuer.Issue(ctx, useCSR) if err == nil { issuerUsed = issuer break @@ -615,11 +649,15 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool issuerKey := issuerUsed.IssuerKey() // success - immediately save the certificate resource + metaJSON, err := json.Marshal(issuedCert.Metadata) + if err != nil { + log.Error("unable to encode certificate metadata", zap.Error(err)) + } certRes := CertificateResource{ SANs: namesFromCSR(csr), CertificatePEM: issuedCert.Certificate, PrivateKeyPEM: privKeyPEM, - IssuerData: issuedCert.Metadata, + IssuerData: metaJSON, issuerKey: issuerUsed.IssuerKey(), } err = cfg.saveCertResource(ctx, issuerUsed, certRes) @@ -627,7 +665,9 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool return fmt.Errorf("[%s] Obtain: saving assets: %v", name, err) } - log.Info("certificate obtained successfully", zap.String("identifier", name)) + log.Info("certificate obtained successfully", + zap.String("identifier", name), + zap.String("issuer", issuerUsed.IssuerKey())) certKey := certRes.NamesKey() @@ -639,6 +679,10 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool "private_key_path": StorageKeys.SitePrivateKey(issuerKey, certKey), "certificate_path": StorageKeys.SiteCert(issuerKey, certKey), "metadata_path": StorageKeys.SiteMeta(issuerKey, certKey), + "csr_pem": pem.EncodeToMemory(&pem.Block{ + Type: "CERTIFICATE REQUEST", + Bytes: csr.Raw, + }), }) return nil @@ -723,6 +767,10 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv return fmt.Errorf("no issuers configured; impossible to renew or check existing certificate in storage") } + log := cfg.Logger.Named("renew") + + name = cfg.transformSubject(ctx, log, name) + // ensure storage is writeable and readable // TODO: this is not necessary every time; should only perform check once every so often for each storage, which may require some global state... err := cfg.checkStorage(ctx) @@ -730,8 +778,6 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv return fmt.Errorf("failed storage check: %v - storage is probably misconfigured", err) } - log := cfg.Logger.Named("renew") - log.Info("acquiring lock", zap.String("identifier", name)) // ensure idempotency of the renew operation for this name @@ -760,7 +806,7 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv } // check if renew is still needed - might have been renewed while waiting for lock - timeLeft, needsRenew := cfg.managedCertNeedsRenewal(certRes) + timeLeft, leaf, needsRenew := cfg.managedCertNeedsRenewal(certRes, false) if !needsRenew { if force { log.Info("certificate does not need to be renewed, but renewal is being forced", @@ -807,7 +853,7 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv } } - csr, err := cfg.generateCSR(privateKey, []string{name}) + csr, err := cfg.generateCSR(privateKey, []string{name}, false) if err != nil { return err } @@ -817,6 +863,18 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv var issuerUsed Issuer var issuerKeys []string for _, issuer := range cfg.Issuers { + // TODO: ZeroSSL's API currently requires CommonName to be set, and requires it be + // distinct from SANs. If this was a cert it would violate the BRs, but their certs + // are compliant, so their CSR requirements just needlessly add friction, complexity, + // and inefficiency for clients. CommonName has been deprecated for 25+ years. + useCSR := csr + if _, ok := issuer.(*ZeroSSLIssuer); ok { + useCSR, err = cfg.generateCSR(privateKey, []string{name}, true) + if err != nil { + return err + } + } + issuerKeys = append(issuerKeys, issuer.IssuerKey()) if prechecker, ok := issuer.(PreChecker); ok { err = prechecker.PreCheck(ctx, []string{name}, interactive) @@ -825,7 +883,19 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv } } - issuedCert, err = issuer.Issue(ctx, csr) + // if we're renewing with the same ACME CA as before, have the ACME + // client tell the server we are replacing a certificate (but doing + // this on the wrong CA, or when the CA doesn't recognize the certID, + // can fail the order) + if acmeData, err := certRes.getACMEData(); err == nil && acmeData.CA != "" { + if acmeIss, ok := issuer.(*ACMEIssuer); ok { + if acmeIss.CA == acmeData.CA { + ctx = context.WithValue(ctx, ctxKeyARIReplaces, leaf) + } + } + } + + issuedCert, err = issuer.Issue(ctx, useCSR) if err == nil { issuerUsed = issuer break @@ -858,11 +928,15 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv issuerKey := issuerUsed.IssuerKey() // success - immediately save the renewed certificate resource + metaJSON, err := json.Marshal(issuedCert.Metadata) + if err != nil { + log.Error("unable to encode certificate metadata", zap.Error(err)) + } newCertRes := CertificateResource{ SANs: namesFromCSR(csr), CertificatePEM: issuedCert.Certificate, PrivateKeyPEM: certRes.PrivateKeyPEM, - IssuerData: issuedCert.Metadata, + IssuerData: metaJSON, issuerKey: issuerKey, } err = cfg.saveCertResource(ctx, issuerUsed, newCertRes) @@ -870,7 +944,9 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv return fmt.Errorf("[%s] Renew: saving assets: %v", name, err) } - log.Info("certificate renewed successfully", zap.String("identifier", name)) + log.Info("certificate renewed successfully", + zap.String("identifier", name), + zap.String("issuer", issuerKey)) certKey := newCertRes.NamesKey() @@ -883,6 +959,10 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv "private_key_path": StorageKeys.SitePrivateKey(issuerKey, certKey), "certificate_path": StorageKeys.SiteCert(issuerKey, certKey), "metadata_path": StorageKeys.SiteMeta(issuerKey, certKey), + "csr_pem": pem.EncodeToMemory(&pem.Block{ + Type: "CERTIFICATE REQUEST", + Bytes: csr.Raw, + }), }) return nil @@ -897,10 +977,16 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv return err } -func (cfg *Config) generateCSR(privateKey crypto.PrivateKey, sans []string) (*x509.CertificateRequest, error) { +// generateCSR generates a CSR for the given SANs. If useCN is true, CommonName will get the first SAN (TODO: this is only a temporary hack for ZeroSSL API support). +func (cfg *Config) generateCSR(privateKey crypto.PrivateKey, sans []string, useCN bool) (*x509.CertificateRequest, error) { csrTemplate := new(x509.CertificateRequest) for _, name := range sans { + // TODO: This is a temporary hack to support ZeroSSL API... + if useCN && csrTemplate.Subject.CommonName == "" && len(name) <= 64 { + csrTemplate.Subject.CommonName = name + continue + } if ip := net.ParseIP(name); ip != nil { csrTemplate.IPAddresses = append(csrTemplate.IPAddresses, ip) } else if strings.Contains(name, "@") { @@ -1052,6 +1138,19 @@ func (cfg *Config) getChallengeInfo(ctx context.Context, identifier string) (Cha return Challenge{Challenge: chalInfo}, true, nil } +func (cfg *Config) transformSubject(ctx context.Context, logger *zap.Logger, name string) string { + if cfg.SubjectTransformer == nil { + return name + } + transformedName := cfg.SubjectTransformer(ctx, name) + if logger != nil && transformedName != name { + logger.Debug("transformed subject name", + zap.String("original", name), + zap.String("transformed", transformedName)) + } + return transformedName +} + // checkStorage tests the storage by writing random bytes // to a random key, and then loading those bytes and // comparing the loaded value. If this fails, the provided @@ -1137,14 +1236,19 @@ func (cfg *Config) lockKey(op, domainName string) string { // managedCertNeedsRenewal returns true if certRes is expiring soon or already expired, // or if the process of decoding the cert and checking its expiration returned an error. -func (cfg *Config) managedCertNeedsRenewal(certRes CertificateResource) (time.Duration, bool) { +// If there wasn't an error, the leaf cert is also returned, so it can be reused if +// necessary, since we are parsing the PEM bundle anyway. +func (cfg *Config) managedCertNeedsRenewal(certRes CertificateResource, emitLogs bool) (time.Duration, *x509.Certificate, bool) { certChain, err := parseCertsFromPEMBundle(certRes.CertificatePEM) - if err != nil { - return 0, true + if err != nil || len(certChain) == 0 { + return 0, nil, true + } + var ari acme.RenewalInfo + if ariPtr, err := certRes.getARI(); err == nil && ariPtr != nil { + ari = *ariPtr } remaining := time.Until(expiresAt(certChain[0])) - needsRenew := currentlyInRenewalWindow(certChain[0].NotBefore, expiresAt(certChain[0]), cfg.RenewalWindowRatio) - return remaining, needsRenew + return remaining, certChain[0], cfg.certNeedsRenewal(certChain[0], ari, emitLogs) } func (cfg *Config) emit(ctx context.Context, eventName string, data map[string]any) error { @@ -1173,6 +1277,10 @@ type OCSPConfig struct { // embedded in certificates. Mapping to an empty // URL will disable OCSP from that responder. ResponderOverrides map[string]string + + // Optionally specify a function that can return the URL + // for an HTTP proxy to use for OCSP-related HTTP requests. + HTTPProxy func(*http.Request) (*url.URL, error) } // certIssueLockOp is the name of the operation used diff --git a/vendor/github.com/caddyserver/certmagic/crypto.go b/vendor/github.com/caddyserver/certmagic/crypto.go index 5855ad7..879f6ae 100644 --- a/vendor/github.com/caddyserver/certmagic/crypto.go +++ b/vendor/github.com/caddyserver/certmagic/crypto.go @@ -280,6 +280,11 @@ func hashCertificateChain(certChain [][]byte) string { func namesFromCSR(csr *x509.CertificateRequest) []string { var nameSet []string + // TODO: CommonName should not be used (it has been deprecated for 25+ years, + // but ZeroSSL CA still requires it to be filled out and not overlap SANs...) + if csr.Subject.CommonName != "" { + nameSet = append(nameSet, csr.Subject.CommonName) + } nameSet = append(nameSet, csr.DNSNames...) nameSet = append(nameSet, csr.EmailAddresses...) for _, v := range csr.IPAddresses { diff --git a/vendor/github.com/caddyserver/certmagic/dnsutil.go b/vendor/github.com/caddyserver/certmagic/dnsutil.go index fc93dc2..81fc192 100644 --- a/vendor/github.com/caddyserver/certmagic/dnsutil.go +++ b/vendor/github.com/caddyserver/certmagic/dnsutil.go @@ -9,6 +9,7 @@ import ( "time" "github.com/miekg/dns" + "go.uber.org/zap" ) // Code in this file adapted from go-acme/lego, July 2020: @@ -19,19 +20,21 @@ import ( // findZoneByFQDN determines the zone apex for the given fqdn by recursing // up the domain labels until the nameserver returns a SOA record in the -// answer section. -func findZoneByFQDN(fqdn string, nameservers []string) (string, error) { +// answer section. The logger must be non-nil. +func findZoneByFQDN(logger *zap.Logger, fqdn string, nameservers []string) (string, error) { if !strings.HasSuffix(fqdn, ".") { fqdn += "." } - soa, err := lookupSoaByFqdn(fqdn, nameservers) + soa, err := lookupSoaByFqdn(logger, fqdn, nameservers) if err != nil { return "", err } return soa.zone, nil } -func lookupSoaByFqdn(fqdn string, nameservers []string) (*soaCacheEntry, error) { +func lookupSoaByFqdn(logger *zap.Logger, fqdn string, nameservers []string) (*soaCacheEntry, error) { + logger = logger.Named("soa_lookup") + if !strings.HasSuffix(fqdn, ".") { fqdn += "." } @@ -41,10 +44,11 @@ func lookupSoaByFqdn(fqdn string, nameservers []string) (*soaCacheEntry, error) // prefer cached version if fresh if ent := fqdnSOACache[fqdn]; ent != nil && !ent.isExpired() { + logger.Debug("using cached SOA result", zap.String("entry", ent.zone)) return ent, nil } - ent, err := fetchSoaByFqdn(fqdn, nameservers) + ent, err := fetchSoaByFqdn(logger, fqdn, nameservers) if err != nil { return nil, err } @@ -62,7 +66,7 @@ func lookupSoaByFqdn(fqdn string, nameservers []string) (*soaCacheEntry, error) return ent, nil } -func fetchSoaByFqdn(fqdn string, nameservers []string) (*soaCacheEntry, error) { +func fetchSoaByFqdn(logger *zap.Logger, fqdn string, nameservers []string) (*soaCacheEntry, error) { var err error var in *dns.Msg @@ -77,6 +81,7 @@ func fetchSoaByFqdn(fqdn string, nameservers []string) (*soaCacheEntry, error) { if in == nil { continue } + logger.Debug("fetched SOA", zap.String("msg", in.String())) switch in.Rcode { case dns.RcodeSuccess: @@ -210,36 +215,46 @@ func populateNameserverPorts(servers []string) { } } -// checkDNSPropagation checks if the expected TXT record has been propagated to all authoritative nameservers. -func checkDNSPropagation(fqdn, value string, resolvers []string) (bool, error) { +// checkDNSPropagation checks if the expected record has been propagated to all authoritative nameservers. +func checkDNSPropagation(logger *zap.Logger, fqdn string, recType uint16, expectedValue string, checkAuthoritativeServers bool, resolvers []string) (bool, error) { + logger = logger.Named("propagation") + if !strings.HasSuffix(fqdn, ".") { fqdn += "." } - // Initial attempt to resolve at the recursive NS - r, err := dnsQuery(fqdn, dns.TypeTXT, resolvers, true) - if err != nil { - return false, err - } - - if r.Rcode == dns.RcodeSuccess { - fqdn = updateDomainWithCName(r, fqdn) + // Initial attempt to resolve at the recursive NS - but do not actually + // dereference (follow) a CNAME record if we are targeting a CNAME record + // itself + if recType != dns.TypeCNAME { + r, err := dnsQuery(fqdn, recType, resolvers, true) + if err != nil { + return false, fmt.Errorf("CNAME dns query: %v", err) + } + if r.Rcode == dns.RcodeSuccess { + fqdn = updateDomainWithCName(r, fqdn) + } } - authoritativeNss, err := lookupNameservers(fqdn, resolvers) - if err != nil { - return false, err + if checkAuthoritativeServers { + authoritativeServers, err := lookupNameservers(logger, fqdn, resolvers) + if err != nil { + return false, fmt.Errorf("looking up authoritative nameservers: %v", err) + } + populateNameserverPorts(authoritativeServers) + resolvers = authoritativeServers } + logger.Debug("checking authoritative nameservers", zap.Strings("resolvers", resolvers)) - return checkAuthoritativeNss(fqdn, value, authoritativeNss) + return checkAuthoritativeNss(fqdn, recType, expectedValue, resolvers) } -// checkAuthoritativeNss queries each of the given nameservers for the expected TXT record. -func checkAuthoritativeNss(fqdn, value string, nameservers []string) (bool, error) { +// checkAuthoritativeNss queries each of the given nameservers for the expected record. +func checkAuthoritativeNss(fqdn string, recType uint16, expectedValue string, nameservers []string) (bool, error) { for _, ns := range nameservers { - r, err := dnsQuery(fqdn, dns.TypeTXT, []string{net.JoinHostPort(ns, "53")}, true) + r, err := dnsQuery(fqdn, recType, []string{ns}, true) if err != nil { - return false, err + return false, fmt.Errorf("querying authoritative nameservers: %v", err) } if r.Rcode != dns.RcodeSuccess { @@ -252,37 +267,43 @@ func checkAuthoritativeNss(fqdn, value string, nameservers []string) (bool, erro return false, fmt.Errorf("NS %s returned %s for %s", ns, dns.RcodeToString[r.Rcode], fqdn) } - var found bool for _, rr := range r.Answer { - if txt, ok := rr.(*dns.TXT); ok { - record := strings.Join(txt.Txt, "") - if record == value { - found = true - break + switch recType { + case dns.TypeTXT: + if txt, ok := rr.(*dns.TXT); ok { + record := strings.Join(txt.Txt, "") + if record == expectedValue { + return true, nil + } + } + case dns.TypeCNAME: + if cname, ok := rr.(*dns.CNAME); ok { + // TODO: whether a DNS provider assumes a trailing dot or not varies, and we may have to standardize this in libdns packages + if strings.TrimSuffix(cname.Target, ".") == strings.TrimSuffix(expectedValue, ".") { + return true, nil + } } + default: + return false, fmt.Errorf("unsupported record type: %d", recType) } } - - if !found { - return false, nil - } } - return true, nil + return false, nil } // lookupNameservers returns the authoritative nameservers for the given fqdn. -func lookupNameservers(fqdn string, resolvers []string) ([]string, error) { +func lookupNameservers(logger *zap.Logger, fqdn string, resolvers []string) ([]string, error) { var authoritativeNss []string - zone, err := findZoneByFQDN(fqdn, resolvers) + zone, err := findZoneByFQDN(logger, fqdn, resolvers) if err != nil { - return nil, fmt.Errorf("could not determine the zone: %w", err) + return nil, fmt.Errorf("could not determine the zone for '%s': %w", fqdn, err) } r, err := dnsQuery(zone, dns.TypeNS, resolvers, true) if err != nil { - return nil, err + return nil, fmt.Errorf("querying NS resolver for zone '%s' recursively: %v", zone, err) } for _, rr := range r.Answer { diff --git a/vendor/github.com/caddyserver/certmagic/filestorage.go b/vendor/github.com/caddyserver/certmagic/filestorage.go index 8144ae9..f6f1360 100644 --- a/vendor/github.com/caddyserver/certmagic/filestorage.go +++ b/vendor/github.com/caddyserver/certmagic/filestorage.go @@ -92,7 +92,7 @@ func (s *FileStorage) Load(_ context.Context, key string) ([]byte, error) { // Delete deletes the value at key. func (s *FileStorage) Delete(_ context.Context, key string) error { - return os.Remove(s.Filename(key)) + return os.RemoveAll(s.Filename(key)) } // List returns all keys that match prefix. diff --git a/vendor/github.com/caddyserver/certmagic/handshake.go b/vendor/github.com/caddyserver/certmagic/handshake.go index 9c923f6..fd57699 100644 --- a/vendor/github.com/caddyserver/certmagic/handshake.go +++ b/vendor/github.com/caddyserver/certmagic/handshake.go @@ -25,7 +25,7 @@ import ( "sync" "time" - "github.com/mholt/acmez" + "github.com/mholt/acmez/v2" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -65,24 +65,27 @@ func (cfg *Config) GetCertificateWithContext(ctx context.Context, clientHello *t ctx = context.WithValue(ctx, ClientHelloInfoCtxKey, clientHello) // special case: serve up the certificate for a TLS-ALPN ACME challenge - // (https://tools.ietf.org/html/draft-ietf-acme-tls-alpn-05) - for _, proto := range clientHello.SupportedProtos { - if proto == acmez.ACMETLS1Protocol { - challengeCert, distributed, err := cfg.getTLSALPNChallengeCert(clientHello) - if err != nil { - cfg.Logger.Error("tls-alpn challenge", - zap.String("remote_addr", clientHello.Conn.RemoteAddr().String()), - zap.String("server_name", clientHello.ServerName), - zap.Error(err)) - return nil, err - } - cfg.Logger.Info("served key authentication certificate", + // (https://www.rfc-editor.org/rfc/rfc8737.html) + // "The ACME server MUST provide an ALPN extension with the single protocol + // name "acme-tls/1" and an SNI extension containing only the domain name + // being validated during the TLS handshake." + if clientHello.ServerName != "" && + len(clientHello.SupportedProtos) == 1 && + clientHello.SupportedProtos[0] == acmez.ACMETLS1Protocol { + challengeCert, distributed, err := cfg.getTLSALPNChallengeCert(clientHello) + if err != nil { + cfg.Logger.Error("tls-alpn challenge", + zap.String("remote_addr", clientHello.Conn.RemoteAddr().String()), zap.String("server_name", clientHello.ServerName), - zap.String("challenge", "tls-alpn-01"), - zap.String("remote", clientHello.Conn.RemoteAddr().String()), - zap.Bool("distributed", distributed)) - return challengeCert, nil + zap.Error(err)) + return nil, err } + cfg.Logger.Info("served key authentication certificate", + zap.String("server_name", clientHello.ServerName), + zap.String("challenge", "tls-alpn-01"), + zap.String("remote", clientHello.Conn.RemoteAddr().String()), + zap.Bool("distributed", distributed)) + return challengeCert, nil } // get the certificate and serve it up @@ -120,7 +123,7 @@ func (cfg *Config) getCertificateFromCache(hello *tls.ClientHelloInfo) (cert Cer } } - // fall back to a "default" certificate, if specified + // use a "default" certificate by name, if specified if cfg.DefaultServerName != "" { normDefault := normalizedName(cfg.DefaultServerName) cert, defaulted = cfg.selectCert(hello, normDefault) @@ -316,13 +319,6 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client }() } - // Make sure a certificate is allowed for the given name. If not, it doesn't - // make sense to try loading one from storage (issue #185), getting it from a - // certificate manager, or obtaining one from an issuer. - if err := cfg.checkIfCertShouldBeObtained(ctx, name, false); err != nil { - return Certificate{}, fmt.Errorf("certificate is not allowed for server name %s: %w", name, err) - } - // If an external Manager is configured, try to get it from them. // Only continue to use our own logic if it returns empty+nil. externalCert, err := cfg.getCertFromAnyCertManager(ctx, hello, logger) @@ -333,6 +329,12 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client return externalCert, nil } + // Make sure a certificate is allowed for the given name. If not, it doesn't make sense + // to try loading one from storage (issue #185) or obtaining one from an issuer. + if err := cfg.checkIfCertShouldBeObtained(ctx, name, false); err != nil { + return Certificate{}, fmt.Errorf("certificate is not allowed for server name %s: %w", name, err) + } + // We might be able to load or obtain a needed certificate. Load from // storage if OnDemand is enabled, or if there is the possibility that // a statically-managed cert was evicted from a full cache. @@ -547,11 +549,11 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli // // This function is safe for use by multiple concurrent goroutines. func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHelloInfo, cert Certificate) (Certificate, error) { - log := cfg.Logger.Named("on_demand") + logger := cfg.Logger.Named("on_demand") // Check OCSP staple validity if cert.ocsp != nil && !freshOCSP(cert.ocsp) { - log.Debug("OCSP response needs refreshing", + logger.Debug("OCSP response needs refreshing", zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("this_update", cert.ocsp.ThisUpdate), @@ -561,12 +563,12 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe if err != nil { // An error with OCSP stapling is not the end of the world, and in fact, is // quite common considering not all certs have issuer URLs that support it. - log.Warn("stapling OCSP", + logger.Warn("stapling OCSP", zap.String("server_name", hello.ServerName), zap.Strings("sans", cert.Names), zap.Error(err)) } else { - log.Debug("successfully stapled new OCSP response", + logger.Debug("successfully stapled new OCSP response", zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("this_update", cert.ocsp.ThisUpdate), @@ -579,10 +581,20 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe cfg.certCache.mu.Unlock() } + // Check ARI status + if cert.ari.NeedsRefresh() { + // we ignore the second return value here because we go on to check renewal status below regardless + var err error + cert, _, err = cfg.updateARI(ctx, cert, logger) + if err != nil { + logger.Error("updated ARI", zap.Error(err)) + } + } + // We attempt to replace any certificates that were revoked. // Crucially, this happens OUTSIDE a lock on the certCache. if certShouldBeForceRenewed(cert) { - log.Warn("on-demand certificate's OCSP status is REVOKED; will try to forcefully renew", + logger.Warn("on-demand certificate's OCSP status is REVOKED; will try to forcefully renew", zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("revoked_at", cert.ocsp.RevokedAt), @@ -592,14 +604,13 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe } // Check cert expiration - if currentlyInRenewalWindow(cert.Leaf.NotBefore, expiresAt(cert.Leaf), cfg.RenewalWindowRatio) { + if cfg.certNeedsRenewal(cert.Leaf, cert.ari, true) { // Check if the certificate still exists on disk. If not, we need to obtain a new one. // This can happen if the certificate was cleaned up by the storage cleaner, but still // remains in the in-memory cache. if !cfg.storageHasCertResourcesAnyIssuer(ctx, cert.Names[0]) { - log.Debug("certificate not found on disk; obtaining new certificate", + logger.Debug("certificate not found on disk; obtaining new certificate", zap.Strings("identifiers", cert.Names)) - return cfg.obtainOnDemandCertificate(ctx, hello) } // Otherwise, renew the certificate. @@ -621,7 +632,7 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe // // This function is safe for use by multiple concurrent goroutines. func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.ClientHelloInfo, currentCert Certificate) (Certificate, error) { - log := logWithRemote(cfg.Logger.Named("on_demand"), hello) + logger := logWithRemote(cfg.Logger.Named("on_demand"), hello) name := cfg.getNameFromClientHello(hello) timeLeft := time.Until(expiresAt(currentCert.Leaf)) @@ -638,7 +649,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien // renewing it, so we might as well serve what we have without blocking, UNLESS // we're forcing renewal, in which case the current certificate is not usable if timeLeft > 0 && !revoked { - log.Debug("certificate expires soon but is already being renewed; serving current certificate", + logger.Debug("certificate expires soon but is already being renewed; serving current certificate", zap.Strings("subjects", currentCert.Names), zap.Duration("remaining", timeLeft)) return currentCert, nil @@ -647,7 +658,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien // otherwise, we'll have to wait for the renewal to finish so we don't serve // a revoked or expired certificate - log.Debug("certificate has expired, but is already being renewed; waiting for renewal to complete", + logger.Debug("certificate has expired, but is already being renewed; waiting for renewal to complete", zap.Strings("subjects", currentCert.Names), zap.Time("expired", expiresAt(currentCert.Leaf)), zap.Bool("revoked", revoked)) @@ -678,7 +689,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien obtainCertWaitChansMu.Unlock() } - log = log.With( + logger = logger.With( zap.String("server_name", name), zap.Strings("subjects", currentCert.Names), zap.Time("expiration", expiresAt(currentCert.Leaf)), @@ -699,19 +710,19 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien cfg.certCache.mu.Unlock() unblockWaiters() - if log != nil { - log.Error("certificate should not be obtained", zap.Error(err)) + if logger != nil { + logger.Error("certificate should not be obtained", zap.Error(err)) } return Certificate{}, err } - log.Info("attempting certificate renewal") + logger.Info("attempting certificate renewal") // otherwise, renew with issuer, etc. var newCert Certificate if revoked { - newCert, err = cfg.forceRenew(ctx, log, currentCert) + newCert, err = cfg.forceRenew(ctx, logger, currentCert) } else { err = cfg.RenewCertAsync(ctx, name, false) if err == nil { @@ -726,7 +737,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien unblockWaiters() if err != nil { - log.Error("renewing and reloading certificate", zap.String("server_name", name), zap.Error(err)) + logger.Error("renewing and reloading certificate", zap.String("server_name", name), zap.Error(err)) } return newCert, err @@ -753,16 +764,16 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli return Certificate{}, nil } - var upstreamCert *tls.Certificate - // try all the GetCertificate methods on external managers; use first one that returns a certificate + var upstreamCert *tls.Certificate + var err error for i, certManager := range cfg.OnDemand.Managers { - var err error upstreamCert, err = certManager.GetCertificate(ctx, hello) if err != nil { - logger.Error("getting certificate from external certificate manager", + logger.Error("external certificate manager", zap.String("sni", hello.ServerName), - zap.Int("cert_manager", i), + zap.String("cert_manager", fmt.Sprintf("%T", certManager)), + zap.Int("cert_manager_idx", i), zap.Error(err)) continue } @@ -770,14 +781,16 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli break } } + if err != nil { + return Certificate{}, fmt.Errorf("external certificate manager indicated that it is unable to yield certificate: %v", err) + } if upstreamCert == nil { logger.Debug("all external certificate managers yielded no certificates and no errors", zap.String("sni", hello.ServerName)) return Certificate{}, nil } var cert Certificate - err := fillCertFromLeaf(&cert, *upstreamCert) - if err != nil { + if err = fillCertFromLeaf(&cert, *upstreamCert); err != nil { return Certificate{}, fmt.Errorf("external certificate manager: %s: filling cert from leaf: %v", hello.ServerName, err) } @@ -822,10 +835,13 @@ func (cfg *Config) getTLSALPNChallengeCert(clientHello *tls.ClientHelloInfo) (*t // getNameFromClientHello returns a normalized form of hello.ServerName. // If hello.ServerName is empty (i.e. client did not use SNI), then the // associated connection's local address is used to extract an IP address. -func (*Config) getNameFromClientHello(hello *tls.ClientHelloInfo) string { +func (cfg *Config) getNameFromClientHello(hello *tls.ClientHelloInfo) string { if name := normalizedName(hello.ServerName); name != "" { return name } + if cfg.DefaultServerName != "" { + return normalizedName(cfg.DefaultServerName) + } return localIPFromConn(hello.Conn) } diff --git a/vendor/github.com/caddyserver/certmagic/httphandler.go b/vendor/github.com/caddyserver/certmagic/httphandlers.go similarity index 61% rename from vendor/github.com/caddyserver/certmagic/httphandler.go rename to vendor/github.com/caddyserver/certmagic/httphandlers.go index fc2a880..f2dde42 100644 --- a/vendor/github.com/caddyserver/certmagic/httphandler.go +++ b/vendor/github.com/caddyserver/certmagic/httphandlers.go @@ -16,9 +16,10 @@ package certmagic import ( "net/http" + "net/url" "strings" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" ) @@ -91,7 +92,7 @@ func solveHTTPChallenge(logger *zap.Logger, w http.ResponseWriter, r *http.Reque challengeReqPath := challenge.HTTP01ResourcePath() if r.URL.Path == challengeReqPath && strings.EqualFold(hostOnly(r.Host), challenge.Identifier.Value) && // mitigate DNS rebinding attacks - r.Method == "GET" { + r.Method == http.MethodGet { w.Header().Add("Content-Type", "text/plain") w.Write([]byte(challenge.KeyAuthorization)) r.Close = true @@ -116,7 +117,94 @@ func SolveHTTPChallenge(logger *zap.Logger, w http.ResponseWriter, r *http.Reque // LooksLikeHTTPChallenge returns true if r looks like an ACME // HTTP challenge request from an ACME server. func LooksLikeHTTPChallenge(r *http.Request) bool { - return r.Method == "GET" && strings.HasPrefix(r.URL.Path, challengeBasePath) + return r.Method == http.MethodGet && + strings.HasPrefix(r.URL.Path, acmeHTTPChallengeBasePath) } -const challengeBasePath = "/.well-known/acme-challenge" +// LooksLikeZeroSSLHTTPValidation returns true if the request appears to be +// domain validation from a ZeroSSL/Sectigo CA. NOTE: This API is +// non-standard and is subject to change. +func LooksLikeZeroSSLHTTPValidation(r *http.Request) bool { + return r.Method == http.MethodGet && + strings.HasPrefix(r.URL.Path, zerosslHTTPValidationBasePath) +} + +// HTTPValidationHandler wraps the ZeroSSL HTTP validation handler such that +// it can pass verification checks from ZeroSSL's API. +// +// If a request is not a ZeroSSL HTTP validation request, h will be invoked. +func (iss *ZeroSSLIssuer) HTTPValidationHandler(h http.Handler) http.Handler { + return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { + if iss.HandleZeroSSLHTTPValidation(w, r) { + return + } + h.ServeHTTP(w, r) + }) +} + +// HandleZeroSSLHTTPValidation is to ZeroSSL API HTTP validation requests like HandleHTTPChallenge +// is to ACME HTTP challenge requests. +func (iss *ZeroSSLIssuer) HandleZeroSSLHTTPValidation(w http.ResponseWriter, r *http.Request) bool { + if iss == nil { + return false + } + if !LooksLikeZeroSSLHTTPValidation(r) { + return false + } + return iss.distributedHTTPValidationAnswer(w, r) +} + +func (iss *ZeroSSLIssuer) distributedHTTPValidationAnswer(w http.ResponseWriter, r *http.Request) bool { + if iss == nil { + return false + } + logger := iss.Logger + if logger == nil { + logger = zap.NewNop() + } + host := hostOnly(r.Host) + valInfo, distributed, err := iss.getDistributedValidationInfo(r.Context(), host) + if err != nil { + logger.Error("looking up info for HTTP validation", + zap.String("host", host), + zap.String("remote_addr", r.RemoteAddr), + zap.String("user_agent", r.Header.Get("User-Agent")), + zap.Error(err)) + return false + } + return answerHTTPValidation(logger, w, r, valInfo, distributed) +} + +func answerHTTPValidation(logger *zap.Logger, rw http.ResponseWriter, req *http.Request, valInfo acme.Challenge, distributed bool) bool { + // ensure URL matches + validationURL, err := url.Parse(valInfo.URL) + if err != nil { + logger.Error("got invalid URL from CA", + zap.String("file_validation_url", valInfo.URL), + zap.Error(err)) + rw.WriteHeader(http.StatusInternalServerError) + return true + } + if req.URL.Path != validationURL.Path { + rw.WriteHeader(http.StatusNotFound) + return true + } + + rw.Header().Add("Content-Type", "text/plain") + req.Close = true + + rw.Write([]byte(valInfo.Token)) + + logger.Info("served HTTP validation credential", + zap.String("validation_path", valInfo.URL), + zap.String("challenge", "http-01"), + zap.String("remote", req.RemoteAddr), + zap.Bool("distributed", distributed)) + + return true +} + +const ( + acmeHTTPChallengeBasePath = "/.well-known/acme-challenge" + zerosslHTTPValidationBasePath = "/.well-known/pki-validation/" +) diff --git a/vendor/github.com/caddyserver/certmagic/maintain.go b/vendor/github.com/caddyserver/certmagic/maintain.go index 9ffb731..848447b 100644 --- a/vendor/github.com/caddyserver/certmagic/maintain.go +++ b/vendor/github.com/caddyserver/certmagic/maintain.go @@ -27,7 +27,7 @@ import ( "strings" "time" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -92,7 +92,7 @@ func (certCache *Cache) maintainAssets(panicCount int) { func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { log := certCache.logger.Named("maintenance") - // configs will hold a map of certificate name to the config + // configs will hold a map of certificate hash to the config // to use when managing that certificate configs := make(map[string]*Config) @@ -102,7 +102,7 @@ func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { // words, our first iteration through the certificate cache does NOT // perform any operations--only queues them--so that more fine-grained // write locks may be obtained during the actual operations. - var renewQueue, reloadQueue, deleteQueue []Certificate + var renewQueue, reloadQueue, deleteQueue, ariQueue certList certCache.mu.RLock() for certKey, cert := range certCache.cache { @@ -135,22 +135,28 @@ func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { continue } + // ACME-specific: see if if ACME Renewal Info (ARI) window needs refreshing + if cert.ari.NeedsRefresh() { + configs[cert.hash] = cfg + ariQueue = append(ariQueue, cert) + } + // if time is up or expires soon, we need to try to renew it if cert.NeedsRenewal(cfg) { - configs[cert.Names[0]] = cfg + configs[cert.hash] = cfg // see if the certificate in storage has already been renewed, possibly by another // instance that didn't coordinate with this one; if so, just load it (this // might happen if another instance already renewed it - kinda sloppy but checking disk // first is a simple way to possibly drastically reduce rate limit problems) - storedCertExpiring, err := cfg.managedCertInStorageExpiresSoon(ctx, cert) + storedCertNeedsRenew, err := cfg.managedCertInStorageNeedsRenewal(ctx, cert) if err != nil { // hmm, weird, but not a big deal, maybe it was deleted or something log.Warn("error while checking if stored certificate is also expiring soon", zap.Strings("identifiers", cert.Names), zap.Error(err)) - } else if !storedCertExpiring { - // if the certificate is NOT expiring soon and there was no error, then we + } else if !storedCertNeedsRenew { + // if the certificate does NOT need renewal and there was no error, then we // are good to just reload the certificate from storage instead of repeating // a likely-unnecessary renewal procedure reloadQueue = append(reloadQueue, cert) @@ -161,11 +167,30 @@ func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { // NOTE: It is super-important to note that the TLS-ALPN challenge requires // a write lock on the cache in order to complete its challenge, so it is extra // vital that this renew operation does not happen inside our read lock! - renewQueue = append(renewQueue, cert) + renewQueue.insert(cert) } } certCache.mu.RUnlock() + // Update ARI, and then for any certs where the ARI window changed, + // be sure to queue them for renewal if necessary + for _, cert := range ariQueue { + cfg := configs[cert.hash] + cert, changed, err := cfg.updateARI(ctx, cert, log) + if err != nil { + log.Error("updating ARI", zap.Error(err)) + } + if changed && cert.NeedsRenewal(cfg) { + // it's theoretically possible that another instance already got the memo + // on the changed ARI and even renewed the cert already, and thus doing it + // here is wasteful, but I have never heard of this happening in reality, + // so to save some cycles for now I think we'll just queue it for renewal + // (notice how we use 'insert' to avoid duplicates, in case it was already + // scheduled for renewal anyway) + renewQueue.insert(cert) + } + } + // Reload certificates that merely need to be updated in memory for _, oldCert := range reloadQueue { timeLeft := expiresAt(oldCert.Leaf).Sub(time.Now().UTC()) @@ -173,7 +198,7 @@ func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { zap.Strings("identifiers", oldCert.Names), zap.Duration("remaining", timeLeft)) - cfg := configs[oldCert.Names[0]] + cfg := configs[oldCert.hash] // crucially, this happens OUTSIDE a lock on the certCache _, err := cfg.reloadManagedCertificate(ctx, oldCert) @@ -187,7 +212,7 @@ func (certCache *Cache) RenewManagedCertificates(ctx context.Context) error { // Renewal queue for _, oldCert := range renewQueue { - cfg := configs[oldCert.Names[0]] + cfg := configs[oldCert.hash] err := certCache.queueRenewalTask(ctx, oldCert, cfg) if err != nil { log.Error("queueing renewal task", @@ -390,6 +415,171 @@ func (certCache *Cache) updateOCSPStaples(ctx context.Context) { } } +// storageHasNewerARI returns true if the configured storage has ARI that is newer +// than that of a certificate that is already loaded, along with the value from +// storage. +func (cfg *Config) storageHasNewerARI(ctx context.Context, cert Certificate) (bool, acme.RenewalInfo, error) { + storedCertData, err := cfg.loadStoredACMECertificateMetadata(ctx, cert) + if err != nil || storedCertData.RenewalInfo == nil { + return false, acme.RenewalInfo{}, err + } + // prefer stored info if it has a window and the loaded one doesn't, + // or if the one in storage has a later RetryAfter (though I suppose + // it's not guaranteed, typically those will move forward in time) + if (!cert.ari.HasWindow() && storedCertData.RenewalInfo.HasWindow()) || + storedCertData.RenewalInfo.RetryAfter.After(*cert.ari.RetryAfter) { + return true, *storedCertData.RenewalInfo, nil + } + return false, acme.RenewalInfo{}, nil +} + +// loadStoredACMECertificateMetadata loads the stored ACME certificate data +// from the cert's sidecar JSON file. +func (cfg *Config) loadStoredACMECertificateMetadata(ctx context.Context, cert Certificate) (acme.Certificate, error) { + metaBytes, err := cfg.Storage.Load(ctx, StorageKeys.SiteMeta(cert.issuerKey, cert.Names[0])) + if err != nil { + return acme.Certificate{}, fmt.Errorf("loading cert metadata: %w", err) + } + + var certRes CertificateResource + if err = json.Unmarshal(metaBytes, &certRes); err != nil { + return acme.Certificate{}, fmt.Errorf("unmarshaling cert metadata: %w", err) + } + + var acmeCert acme.Certificate + if err = json.Unmarshal(certRes.IssuerData, &acmeCert); err != nil { + return acme.Certificate{}, fmt.Errorf("unmarshaling potential ACME issuer metadata: %v", err) + } + + return acmeCert, nil +} + +// updateARI updates the cert's ACME renewal info, first by checking storage for a newer +// one, or getting it from the CA if needed. The updated info is stored in storage and +// updated in the cache. The certificate with the updated ARI is returned. If true is +// returned, the ARI window or selected time has changed, and the caller should check if +// the cert needs to be renewed now, even if there is an error. +func (cfg *Config) updateARI(ctx context.Context, cert Certificate, logger *zap.Logger) (updatedCert Certificate, changed bool, err error) { + logger = logger.With( + zap.Strings("identifiers", cert.Names), + zap.String("cert_hash", cert.hash), + zap.String("ari_unique_id", cert.ari.UniqueIdentifier), + zap.Time("cert_expiry", cert.Leaf.NotAfter)) + + updatedCert = cert + oldARI := cert.ari + + // see if the stored value has been refreshed already by another instance + gotNewARI, newARI, err := cfg.storageHasNewerARI(ctx, cert) + + // when we're all done, log if something about the schedule is different + // ("WARN" level because ARI window changing may be a sign of external trouble + // and we want to draw their attention to a potential explanation URL) + defer func() { + changed = !newARI.SameWindow(oldARI) + + if changed { + logger.Warn("ARI window or selected renewal time changed", + zap.Time("prev_start", oldARI.SuggestedWindow.Start), + zap.Time("next_start", newARI.SuggestedWindow.Start), + zap.Time("prev_end", oldARI.SuggestedWindow.End), + zap.Time("next_end", newARI.SuggestedWindow.End), + zap.Time("prev_selected_time", oldARI.SelectedTime), + zap.Time("next_selected_time", newARI.SelectedTime), + zap.String("explanation_url", newARI.ExplanationURL)) + } + }() + + if err == nil && gotNewARI { + // great, storage has a newer one we can use + cfg.certCache.mu.Lock() + updatedCert = cfg.certCache.cache[cert.hash] + updatedCert.ari = newARI + cfg.certCache.cache[cert.hash] = updatedCert + cfg.certCache.mu.Unlock() + logger.Info("reloaded ARI with newer one in storage", + zap.Timep("next_refresh", newARI.RetryAfter), + zap.Time("renewal_time", newARI.SelectedTime)) + return + } + + if err != nil { + logger.Error("error while checking storage for updated ARI; updating ARI now", zap.Error(err)) + } + + // of the issuers configured, hopefully one of them is the ACME CA we got the cert from + for _, iss := range cfg.Issuers { + if acmeIss, ok := iss.(*ACMEIssuer); ok { + newARI, err = acmeIss.getRenewalInfo(ctx, cert) // be sure to use existing newARI variable so we can compare against old value in the defer + if err != nil { + // could be anything, but a common error might simply be the "wrong" ACME CA + // (meaning, different from the one that issued the cert, thus the only one + // that would have any ARI for it) if multiple ACME CAs are configured + logger.Error("failed updating renewal info from ACME CA", + zap.String("issuer", iss.IssuerKey()), + zap.Error(err)) + continue + } + + // when we get the latest ARI, the acme package will select a time within the window + // for us; of course, since it's random, it's likely different from the previously- + // selected time; but if the window doesn't change, there's no need to change the + // selected time (the acme package doesn't know the previous window to know better) + // ... so if the window hasn't changed we'll just put back the selected time + if newARI.SameWindow(oldARI) && !oldARI.SelectedTime.IsZero() { + newARI.SelectedTime = oldARI.SelectedTime + } + + // then store the updated ARI (even if the window didn't change, the Retry-After + // likely did) in cache and storage + + // be sure we get the cert from the cache while inside a lock to avoid logical races + cfg.certCache.mu.Lock() + updatedCert = cfg.certCache.cache[cert.hash] + updatedCert.ari = newARI + cfg.certCache.cache[cert.hash] = updatedCert + cfg.certCache.mu.Unlock() + + // update the ARI value in storage + var certData acme.Certificate + certData, err = cfg.loadStoredACMECertificateMetadata(ctx, cert) + if err != nil { + err = fmt.Errorf("got new ARI from %s, but failed loading stored certificate metadata: %v", iss.IssuerKey(), err) + return + } + certData.RenewalInfo = &newARI + var certDataBytes, certResBytes []byte + certDataBytes, err = json.Marshal(certData) + if err != nil { + err = fmt.Errorf("got new ARI from %s, but failed marshaling certificate ACME metadata: %v", iss.IssuerKey(), err) + return + } + certResBytes, err = json.MarshalIndent(CertificateResource{ + SANs: cert.Names, + IssuerData: certDataBytes, + }, "", "\t") + if err != nil { + err = fmt.Errorf("got new ARI from %s, but could not re-encode certificate metadata: %v", iss.IssuerKey(), err) + return + } + if err = cfg.Storage.Store(ctx, StorageKeys.SiteMeta(cert.issuerKey, cert.Names[0]), certResBytes); err != nil { + err = fmt.Errorf("got new ARI from %s, but could not store it with certificate metadata: %v", iss.IssuerKey(), err) + return + } + + logger.Info("updated ACME renewal information", + zap.Time("selected_time", newARI.SelectedTime), + zap.Timep("next_update", newARI.RetryAfter), + zap.String("explanation_url", newARI.ExplanationURL)) + + return + } + } + + err = fmt.Errorf("could not fully update ACME renewal info: either no ACME issuer configured for certificate, or all failed (make sure the ACME CA that issued the certificate is configured)") + return +} + // CleanStorageOptions specifies how to clean up a storage unit. type CleanStorageOptions struct { // Optional custom logger. @@ -452,7 +642,7 @@ func CleanStorage(ctx context.Context, storage Storage, opts CleanStorageOptions lastTLSClean := lastClean["tls"] if time.Since(lastTLSClean.Timestamp) < opts.Interval { nextTime := time.Now().Add(opts.Interval) - opts.Logger.Warn("storage cleaning happened too recently; skipping for now", + opts.Logger.Info("storage cleaning happened too recently; skipping for now", zap.String("instance", lastTLSClean.InstanceID), zap.Time("try_again", nextTime), zap.Duration("try_again_in", time.Until(nextTime)), @@ -725,6 +915,19 @@ func certShouldBeForceRenewed(cert Certificate) bool { cert.ocsp.Status == ocsp.Revoked } +type certList []Certificate + +// insert appends cert to the list if it is not already in the list. +// Efficiency: O(n) +func (certs *certList) insert(cert Certificate) { + for _, c := range *certs { + if c.hash == cert.hash { + return + } + } + *certs = append(*certs, cert) +} + const ( // DefaultRenewCheckInterval is how often to check certificates for expiration. // Scans are very lightweight, so this can be semi-frequent. This default should diff --git a/vendor/github.com/caddyserver/certmagic/ocsp.go b/vendor/github.com/caddyserver/certmagic/ocsp.go index 57135ee..fe6dbb8 100644 --- a/vendor/github.com/caddyserver/certmagic/ocsp.go +++ b/vendor/github.com/caddyserver/certmagic/ocsp.go @@ -168,12 +168,24 @@ func getOCSPForCert(ocspConfig OCSPConfig, bundle []byte) ([]byte, *ocsp.Respons return nil, nil, fmt.Errorf("override disables querying OCSP responder: %v", issuedCert.OCSPServer[0]) } + // configure HTTP client if necessary + httpClient := http.DefaultClient + if ocspConfig.HTTPProxy != nil { + httpClient = &http.Client{ + Transport: &http.Transport{ + Proxy: ocspConfig.HTTPProxy, + }, + Timeout: 30 * time.Second, + } + } + + // get issuer certificate if needed if len(certificates) == 1 { if len(issuedCert.IssuingCertificateURL) == 0 { return nil, nil, fmt.Errorf("no URL to issuing certificate") } - resp, err := http.Get(issuedCert.IssuingCertificateURL[0]) + resp, err := httpClient.Get(issuedCert.IssuingCertificateURL[0]) if err != nil { return nil, nil, fmt.Errorf("getting issuer certificate: %v", err) } @@ -202,7 +214,7 @@ func getOCSPForCert(ocspConfig OCSPConfig, bundle []byte) ([]byte, *ocsp.Respons } reader := bytes.NewReader(ocspReq) - req, err := http.Post(respURL, "application/ocsp-request", reader) + req, err := httpClient.Post(respURL, "application/ocsp-request", reader) if err != nil { return nil, nil, fmt.Errorf("making OCSP request: %v", err) } diff --git a/vendor/github.com/caddyserver/certmagic/solvers.go b/vendor/github.com/caddyserver/certmagic/solvers.go index 51ef096..557f17b 100644 --- a/vendor/github.com/caddyserver/certmagic/solvers.go +++ b/vendor/github.com/caddyserver/certmagic/solvers.go @@ -30,9 +30,10 @@ import ( "time" "github.com/libdns/libdns" - "github.com/mholt/acmez" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v2/acme" "github.com/miekg/dns" + "go.uber.org/zap" ) // httpSolver solves the HTTP challenge. It must be @@ -46,9 +47,9 @@ import ( // can access the keyAuth material is by loading it // from storage, which is done by distributedSolver. type httpSolver struct { - closed int32 // accessed atomically - acmeIssuer *ACMEIssuer - address string + closed int32 // accessed atomically + handler http.Handler + address string } // Present starts an HTTP server if none is already listening on s.address. @@ -88,7 +89,7 @@ func (s *httpSolver) serve(ctx context.Context, si *solverInfo) { }() defer close(si.done) httpServer := &http.Server{ - Handler: s.acmeIssuer.HTTPChallengeHandler(http.NewServeMux()), + Handler: s.handler, BaseContext: func(listener net.Listener) context.Context { return ctx }, } httpServer.SetKeepAlivesEnabled(false) @@ -250,9 +251,92 @@ func (s *tlsALPNSolver) CleanUp(_ context.Context, chal acme.Challenge) error { // DNS provider APIs and implementations of the libdns interfaces must also // support multiple same-named TXT records. type DNS01Solver struct { + DNSManager +} + +// Present creates the DNS TXT record for the given ACME challenge. +func (s *DNS01Solver) Present(ctx context.Context, challenge acme.Challenge) error { + dnsName := challenge.DNS01TXTRecordName() + if s.OverrideDomain != "" { + dnsName = s.OverrideDomain + } + keyAuth := challenge.DNS01KeyAuthorization() + + zrec, err := s.DNSManager.createRecord(ctx, dnsName, "TXT", keyAuth) + if err != nil { + return err + } + + // remember the record and zone we got so we can clean up more efficiently + s.saveDNSPresentMemory(dnsPresentMemory{ + dnsName: dnsName, + zoneRec: zrec, + }) + + return nil +} + +// Wait blocks until the TXT record created in Present() appears in +// authoritative lookups, i.e. until it has propagated, or until +// timeout, whichever is first. +func (s *DNS01Solver) Wait(ctx context.Context, challenge acme.Challenge) error { + // prepare for the checks by determining what to look for + dnsName := challenge.DNS01TXTRecordName() + if s.OverrideDomain != "" { + dnsName = s.OverrideDomain + } + keyAuth := challenge.DNS01KeyAuthorization() + + // wait for the record to propagate + memory, err := s.getDNSPresentMemory(dnsName, "TXT", keyAuth) + if err != nil { + return err + } + return s.DNSManager.wait(ctx, memory.zoneRec) +} + +// CleanUp deletes the DNS TXT record created in Present(). +// +// We ignore the context because cleanup is often/likely performed after +// a context cancellation, and properly-implemented DNS providers should +// honor cancellation, which would result in cleanup being aborted. +// Cleanup must always occur. +func (s *DNS01Solver) CleanUp(ctx context.Context, challenge acme.Challenge) error { + dnsName := challenge.DNS01TXTRecordName() + if s.OverrideDomain != "" { + dnsName = s.OverrideDomain + } + keyAuth := challenge.DNS01KeyAuthorization() + + // always forget about the record so we don't leak memory + defer s.deleteDNSPresentMemory(dnsName, keyAuth) + + // recall the record we created and zone we looked up + memory, err := s.getDNSPresentMemory(dnsName, "TXT", keyAuth) + if err != nil { + return err + } + + if err := s.DNSManager.cleanUpRecord(ctx, memory.zoneRec); err != nil { + return err + } + return nil +} + +// DNSManager is a type that makes libdns providers usable for performing +// DNS verification. See https://github.com/libdns/libdns +// +// Note that records may be manipulated concurrently by some clients (such as +// acmez, which CertMagic uses), meaning that multiple records may be created +// in a DNS zone simultaneously, and in some cases distinct records of the same +// type may have the same name. For example, solving ACME challenges for both example.com +// and *.example.com create a TXT record named _acme_challenge.example.com, +// but with different tokens as their values. This solver distinguishes between +// different records with the same type and name by looking at their values. +type DNSManager struct { // The implementation that interacts with the DNS // provider to set or delete records. (REQUIRED) - DNSProvider ACMEDNSProvider + DNSProvider DNSProvider // The TTL for the temporary challenge records. TTL time.Duration @@ -274,6 +358,9 @@ type DNS01Solver struct { // that the solver doesn't follow CNAME/NS record. OverrideDomain string + // An optional logger. + Logger *zap.Logger + // Remember DNS records while challenges are active; i.e. // records we have presented and not yet cleaned up. // This lets us clean them up quickly and efficiently. @@ -285,83 +372,81 @@ type DNS01Solver struct { // the value of their TXT records, which should contain // unique challenge tokens. // See https://github.com/caddyserver/caddy/issues/3474. - txtRecords map[string][]dnsPresentMemory - txtRecordsMu sync.Mutex + records map[string][]dnsPresentMemory + recordsMu sync.Mutex } -// Present creates the DNS TXT record for the given ACME challenge. -func (s *DNS01Solver) Present(ctx context.Context, challenge acme.Challenge) error { - dnsName := challenge.DNS01TXTRecordName() - if s.OverrideDomain != "" { - dnsName = s.OverrideDomain - } - keyAuth := challenge.DNS01KeyAuthorization() +func (m *DNSManager) createRecord(ctx context.Context, dnsName, recordType, recordValue string) (zoneRecord, error) { + logger := m.logger() - zone, err := findZoneByFQDN(dnsName, recursiveNameservers(s.Resolvers)) + zone, err := findZoneByFQDN(logger, dnsName, recursiveNameservers(m.Resolvers)) if err != nil { - return fmt.Errorf("could not determine zone for domain %q: %v", dnsName, err) + return zoneRecord{}, fmt.Errorf("could not determine zone for domain %q: %v", dnsName, err) } - rec := libdns.Record{ - Type: "TXT", + Type: recordType, Name: libdns.RelativeName(dnsName+".", zone), - Value: keyAuth, - TTL: s.TTL, + Value: recordValue, + TTL: m.TTL, } - results, err := s.DNSProvider.AppendRecords(ctx, zone, []libdns.Record{rec}) + logger.Debug("creating DNS record", + zap.String("dns_name", dnsName), + zap.String("zone", zone), + zap.String("record_name", rec.Name), + zap.String("record_type", rec.Type), + zap.String("record_value", rec.Value), + zap.Duration("record_ttl", rec.TTL)) + + results, err := m.DNSProvider.AppendRecords(ctx, zone, []libdns.Record{rec}) if err != nil { - return fmt.Errorf("adding temporary record for zone %q: %w", zone, err) + return zoneRecord{}, fmt.Errorf("adding temporary record for zone %q: %w", zone, err) } if len(results) != 1 { - return fmt.Errorf("expected one record, got %d: %v", len(results), results) + return zoneRecord{}, fmt.Errorf("expected one record, got %d: %v", len(results), results) } - // remember the record and zone we got so we can clean up more efficiently - s.saveDNSPresentMemory(dnsPresentMemory{ - dnsZone: zone, - dnsName: dnsName, - rec: results[0], - }) - - return nil + return zoneRecord{zone, results[0]}, nil } -// Wait blocks until the TXT record created in Present() appears in +// wait blocks until the TXT record created in Present() appears in // authoritative lookups, i.e. until it has propagated, or until // timeout, whichever is first. -func (s *DNS01Solver) Wait(ctx context.Context, challenge acme.Challenge) error { +func (m *DNSManager) wait(ctx context.Context, zrec zoneRecord) error { + logger := m.logger() + // if configured to, pause before doing propagation checks // (even if they are disabled, the wait might be desirable on its own) - if s.PropagationDelay > 0 { + if m.PropagationDelay > 0 { select { - case <-time.After(s.PropagationDelay): + case <-time.After(m.PropagationDelay): case <-ctx.Done(): return ctx.Err() } } // skip propagation checks if configured to do so - if s.PropagationTimeout == -1 { + if m.PropagationTimeout == -1 { return nil } - // prepare for the checks by determining what to look for - dnsName := challenge.DNS01TXTRecordName() - if s.OverrideDomain != "" { - dnsName = s.OverrideDomain - } - keyAuth := challenge.DNS01KeyAuthorization() - // timings - timeout := s.PropagationTimeout + timeout := m.PropagationTimeout if timeout == 0 { timeout = defaultDNSPropagationTimeout } const interval = 2 * time.Second // how we'll do the checks - resolvers := recursiveNameservers(s.Resolvers) + checkAuthoritativeServers := len(m.Resolvers) == 0 + resolvers := recursiveNameservers(m.Resolvers) + + recType := dns.TypeTXT + if zrec.record.Type == "CNAME" { + recType = dns.TypeCNAME + } + + absName := libdns.AbsoluteName(zrec.record.Name, zrec.zone) var err error start := time.Now() @@ -371,10 +456,17 @@ func (s *DNS01Solver) Wait(ctx context.Context, challenge acme.Challenge) error case <-ctx.Done(): return ctx.Err() } + + logger.Debug("checking DNS propagation", + zap.String("fqdn", absName), + zap.String("record_type", zrec.record.Type), + zap.String("expected_value", zrec.record.Value), + zap.Strings("resolvers", resolvers)) + var ready bool - ready, err = checkDNSPropagation(dnsName, keyAuth, resolvers) + ready, err = checkDNSPropagation(logger, absName, recType, zrec.record.Value, checkAuthoritativeServers, resolvers) if err != nil { - return fmt.Errorf("checking DNS propagation of %q: %w", dnsName, err) + return fmt.Errorf("checking DNS propagation of %q (relative=%s zone=%s resolvers=%v): %w", absName, zrec.record.Name, zrec.zone, resolvers, err) } if ready { return nil @@ -384,101 +476,110 @@ func (s *DNS01Solver) Wait(ctx context.Context, challenge acme.Challenge) error return fmt.Errorf("timed out waiting for record to fully propagate; verify DNS provider configuration is correct - last error: %v", err) } +type zoneRecord struct { + zone string + record libdns.Record +} + // CleanUp deletes the DNS TXT record created in Present(). // // We ignore the context because cleanup is often/likely performed after // a context cancellation, and properly-implemented DNS providers should // honor cancellation, which would result in cleanup being aborted. // Cleanup must always occur. -func (s *DNS01Solver) CleanUp(_ context.Context, challenge acme.Challenge) error { - dnsName := challenge.DNS01TXTRecordName() - if s.OverrideDomain != "" { - dnsName = s.OverrideDomain - } - keyAuth := challenge.DNS01KeyAuthorization() - - // always forget about the record so we don't leak memory - defer s.deleteDNSPresentMemory(dnsName, keyAuth) - - // recall the record we created and zone we looked up - memory, err := s.getDNSPresentMemory(dnsName, keyAuth) - if err != nil { - return err - } +func (m *DNSManager) cleanUpRecord(_ context.Context, zrec zoneRecord) error { + logger := m.logger() // clean up the record - use a different context though, since // one common reason cleanup is performed is because a context // was canceled, and if so, any HTTP requests by this provider // should fail if the provider is properly implemented // (see issue #200) - timeout := s.PropagationTimeout + timeout := m.PropagationTimeout if timeout <= 0 { timeout = defaultDNSPropagationTimeout } ctx, cancel := context.WithTimeout(context.Background(), timeout) defer cancel() - _, err = s.DNSProvider.DeleteRecords(ctx, memory.dnsZone, []libdns.Record{memory.rec}) + + logger.Debug("deleting DNS record", + zap.String("zone", zrec.zone), + zap.String("record_id", zrec.record.ID), + zap.String("record_name", zrec.record.Name), + zap.String("record_type", zrec.record.Type), + zap.String("record_value", zrec.record.Value)) + + _, err := m.DNSProvider.DeleteRecords(ctx, zrec.zone, []libdns.Record{zrec.record}) if err != nil { - return fmt.Errorf("deleting temporary record for name %q in zone %q: %w", memory.dnsName, memory.dnsZone, err) + return fmt.Errorf("deleting temporary record for name %q in zone %q: %w", zrec.zone, zrec.record, err) } - return nil } +func (m *DNSManager) logger() *zap.Logger { + logger := m.Logger + if logger == nil { + logger = zap.NewNop() + } + return logger.Named("dns_manager") +} + const defaultDNSPropagationTimeout = 2 * time.Minute +// dnsPresentMemory associates a created DNS record with its zone +// (since libdns Records are zone-relative and do not include zone). type dnsPresentMemory struct { - dnsZone string dnsName string - rec libdns.Record + zoneRec zoneRecord } -func (s *DNS01Solver) saveDNSPresentMemory(mem dnsPresentMemory) { - s.txtRecordsMu.Lock() - if s.txtRecords == nil { - s.txtRecords = make(map[string][]dnsPresentMemory) +func (s *DNSManager) saveDNSPresentMemory(mem dnsPresentMemory) { + s.recordsMu.Lock() + if s.records == nil { + s.records = make(map[string][]dnsPresentMemory) } - s.txtRecords[mem.dnsName] = append(s.txtRecords[mem.dnsName], mem) - s.txtRecordsMu.Unlock() + s.records[mem.dnsName] = append(s.records[mem.dnsName], mem) + s.recordsMu.Unlock() } -func (s *DNS01Solver) getDNSPresentMemory(dnsName, keyAuth string) (dnsPresentMemory, error) { - s.txtRecordsMu.Lock() - defer s.txtRecordsMu.Unlock() +func (s *DNSManager) getDNSPresentMemory(dnsName, recType, value string) (dnsPresentMemory, error) { + s.recordsMu.Lock() + defer s.recordsMu.Unlock() var memory dnsPresentMemory - for _, mem := range s.txtRecords[dnsName] { - if mem.rec.Value == keyAuth { + for _, mem := range s.records[dnsName] { + if mem.zoneRec.record.Type == recType && mem.zoneRec.record.Value == value { memory = mem break } } - if memory.rec.Name == "" { + if memory.zoneRec.record.Name == "" { return dnsPresentMemory{}, fmt.Errorf("no memory of presenting a DNS record for %q (usually OK if presenting also failed)", dnsName) } return memory, nil } -func (s *DNS01Solver) deleteDNSPresentMemory(dnsName, keyAuth string) { - s.txtRecordsMu.Lock() - defer s.txtRecordsMu.Unlock() +func (s *DNSManager) deleteDNSPresentMemory(dnsName, keyAuth string) { + s.recordsMu.Lock() + defer s.recordsMu.Unlock() - for i, mem := range s.txtRecords[dnsName] { - if mem.rec.Value == keyAuth { - s.txtRecords[dnsName] = append(s.txtRecords[dnsName][:i], s.txtRecords[dnsName][i+1:]...) + for i, mem := range s.records[dnsName] { + if mem.zoneRec.record.Value == keyAuth { + s.records[dnsName] = append(s.records[dnsName][:i], s.records[dnsName][i+1:]...) return } } } -// ACMEDNSProvider defines the set of operations required for -// ACME challenges. A DNS provider must be able to append and -// delete records in order to solve ACME challenges. Find one -// you can use at https://github.com/libdns. If your provider -// isn't implemented yet, feel free to contribute! -type ACMEDNSProvider interface { +// DNSProvider defines the set of operations required for +// ACME challenges or other sorts of domain verification. +// A DNS provider must be able to append and delete records +// in order to solve ACME challenges. Find one you can use +// at https://github.com/libdns. If your provider isn't +// implemented yet, feel free to contribute! +type DNSProvider interface { libdns.RecordAppender libdns.RecordDeleter } diff --git a/vendor/github.com/caddyserver/certmagic/storage.go b/vendor/github.com/caddyserver/certmagic/storage.go index 3d88f2e..faf7315 100644 --- a/vendor/github.com/caddyserver/certmagic/storage.go +++ b/vendor/github.com/caddyserver/certmagic/storage.go @@ -289,7 +289,7 @@ func acquireLock(ctx context.Context, storage Storage, lockKey string) error { } func releaseLock(ctx context.Context, storage Storage, lockKey string) error { - err := storage.Unlock(context.TODO(), lockKey) // TODO: in Go 1.21, use WithoutCancel (see #247) + err := storage.Unlock(context.WithoutCancel(ctx), lockKey) if err == nil { locksMu.Lock() delete(locks, lockKey) diff --git a/vendor/github.com/caddyserver/certmagic/zerosslissuer.go b/vendor/github.com/caddyserver/certmagic/zerosslissuer.go new file mode 100644 index 0000000..b9ffa7d --- /dev/null +++ b/vendor/github.com/caddyserver/certmagic/zerosslissuer.go @@ -0,0 +1,304 @@ +// Copyright 2015 Matthew Holt +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package certmagic + +import ( + "context" + "crypto/x509" + "encoding/json" + "fmt" + "net" + "net/http" + "strconv" + "strings" + "time" + + "github.com/caddyserver/zerossl" + "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v2/acme" + "go.uber.org/zap" +) + +// ZeroSSLIssuer can get certificates from ZeroSSL's API. (To use ZeroSSL's ACME +// endpoint, use the ACMEIssuer instead.) Note that use of the API is restricted +// by payment tier. +type ZeroSSLIssuer struct { + // The API key (or "access key") for using the ZeroSSL API. + // REQUIRED. + APIKey string + + // How many days the certificate should be valid for. + ValidityDays int + + // The host to bind to when opening a listener for + // verifying domain names (or IPs). + ListenHost string + + // If HTTP is forwarded from port 80, specify the + // forwarded port here. + AltHTTPPort int + + // To use CNAME validation instead of HTTP + // validation, set this field. + CNAMEValidation *DNSManager + + // Where to store verification material temporarily. + // Set this on all instances in a cluster to the same + // value to enable distributed verification. + Storage Storage + + // An optional (but highly recommended) logger. + Logger *zap.Logger +} + +// Issue obtains a certificate for the given csr. +func (iss *ZeroSSLIssuer) Issue(ctx context.Context, csr *x509.CertificateRequest) (*IssuedCertificate, error) { + client := iss.getClient() + + identifiers := namesFromCSR(csr) + if len(identifiers) == 0 { + return nil, fmt.Errorf("no identifiers on CSR") + } + + logger := iss.Logger + if logger == nil { + logger = zap.NewNop() + } + logger = logger.With(zap.Strings("identifiers", identifiers)) + + logger.Info("creating certificate") + + cert, err := client.CreateCertificate(ctx, csr, iss.ValidityDays) + if err != nil { + return nil, fmt.Errorf("creating certificate: %v", err) + } + + logger = logger.With(zap.String("cert_id", cert.ID)) + logger.Info("created certificate") + + defer func(certID string) { + if err != nil { + err := client.CancelCertificate(context.WithoutCancel(ctx), certID) + if err == nil { + logger.Info("canceled certificate") + } else { + logger.Error("unable to cancel certificate", zap.Error(err)) + } + } + }(cert.ID) + + var verificationMethod zerossl.VerificationMethod + + if iss.CNAMEValidation == nil { + verificationMethod = zerossl.HTTPVerification + logger = logger.With(zap.String("verification_method", string(verificationMethod))) + + httpVerifier := &httpSolver{ + address: net.JoinHostPort(iss.ListenHost, strconv.Itoa(iss.getHTTPPort())), + handler: iss.HTTPValidationHandler(http.NewServeMux()), + } + + var solver acmez.Solver = httpVerifier + if iss.Storage != nil { + solver = distributedSolver{ + storage: iss.Storage, + storageKeyIssuerPrefix: iss.IssuerKey(), + solver: httpVerifier, + } + } + + // since the distributed solver was originally designed for ACME, + // the API is geared around ACME challenges. ZeroSSL's HTTP validation + // is very similar to the HTTP challenge, but not quite compatible, + // so we kind of shim the ZeroSSL validation data into a Challenge + // object... it is not a perfect use of this type but it's pretty close + valInfo := cert.Validation.OtherMethods[identifiers[0]] + fakeChallenge := acme.Challenge{ + Identifier: acme.Identifier{ + Value: identifiers[0], // used for storage key + }, + URL: valInfo.FileValidationURLHTTP, + Token: strings.Join(cert.Validation.OtherMethods[identifiers[0]].FileValidationContent, "\n"), + } + if err = solver.Present(ctx, fakeChallenge); err != nil { + return nil, fmt.Errorf("presenting validation file for verification: %v", err) + } + defer solver.CleanUp(ctx, fakeChallenge) + } else { + verificationMethod = zerossl.CNAMEVerification + logger = logger.With(zap.String("verification_method", string(verificationMethod))) + + // create the CNAME record(s) + records := make(map[string]zoneRecord, len(cert.Validation.OtherMethods)) + for name, verifyInfo := range cert.Validation.OtherMethods { + zr, err := iss.CNAMEValidation.createRecord(ctx, verifyInfo.CnameValidationP1, "CNAME", verifyInfo.CnameValidationP2) + if err != nil { + return nil, fmt.Errorf("creating CNAME record: %v", err) + } + defer func(name string, zr zoneRecord) { + if err := iss.CNAMEValidation.cleanUpRecord(ctx, zr); err != nil { + logger.Warn("cleaning up temporary validation record failed", + zap.String("dns_name", name), + zap.Error(err)) + } + }(name, zr) + records[name] = zr + } + + // wait for them to propagate + for name, zr := range records { + if err := iss.CNAMEValidation.wait(ctx, zr); err != nil { + // allow it, since the CA will ultimately decide, but definitely log it + logger.Warn("failed CNAME record propagation check", zap.String("domain", name), zap.Error(err)) + } + } + } + + logger.Info("validating identifiers") + + cert, err = client.VerifyIdentifiers(ctx, cert.ID, verificationMethod, nil) + if err != nil { + return nil, fmt.Errorf("verifying identifiers: %v", err) + } + + switch cert.Status { + case "pending_validation": + logger.Info("validations succeeded; waiting for certificate to be issued") + + cert, err = iss.waitForCertToBeIssued(ctx, client, cert) + if err != nil { + return nil, fmt.Errorf("waiting for certificate to be issued: %v", err) + } + case "issued": + logger.Info("validations succeeded; downloading certificate bundle") + default: + return nil, fmt.Errorf("unexpected certificate status: %s", cert.Status) + } + + bundle, err := client.DownloadCertificate(ctx, cert.ID, false) + if err != nil { + return nil, fmt.Errorf("downloading certificate: %v", err) + } + + logger.Info("successfully downloaded issued certificate") + + return &IssuedCertificate{ + Certificate: []byte(bundle.CertificateCrt + bundle.CABundleCrt), + Metadata: cert, + }, nil +} + +func (*ZeroSSLIssuer) waitForCertToBeIssued(ctx context.Context, client zerossl.Client, cert zerossl.CertificateObject) (zerossl.CertificateObject, error) { + ticker := time.NewTicker(5 * time.Second) + defer ticker.Stop() + + for { + select { + case <-ctx.Done(): + return cert, ctx.Err() + case <-ticker.C: + var err error + cert, err = client.GetCertificate(ctx, cert.ID) + if err != nil { + return cert, err + } + if cert.Status == "issued" { + return cert, nil + } + if cert.Status != "pending_validation" { + return cert, fmt.Errorf("unexpected certificate status: %s", cert.Status) + } + } + } +} + +func (iss *ZeroSSLIssuer) getClient() zerossl.Client { + return zerossl.Client{AccessKey: iss.APIKey} +} + +func (iss *ZeroSSLIssuer) getHTTPPort() int { + useHTTPPort := HTTPChallengePort + if HTTPPort > 0 && HTTPPort != HTTPChallengePort { + useHTTPPort = HTTPPort + } + if iss.AltHTTPPort > 0 { + useHTTPPort = iss.AltHTTPPort + } + return useHTTPPort +} + +// IssuerKey returns the unique issuer key for ZeroSSL. +func (iss *ZeroSSLIssuer) IssuerKey() string { return zerosslIssuerKey } + +// Revoke revokes the given certificate. Only do this if there is a security or trust +// concern with the certificate. +func (iss *ZeroSSLIssuer) Revoke(ctx context.Context, cert CertificateResource, reason int) error { + r := zerossl.UnspecifiedReason + switch reason { + case acme.ReasonKeyCompromise: + r = zerossl.KeyCompromise + case acme.ReasonAffiliationChanged: + r = zerossl.AffiliationChanged + case acme.ReasonSuperseded: + r = zerossl.Superseded + case acme.ReasonCessationOfOperation: + r = zerossl.CessationOfOperation + default: + return fmt.Errorf("unsupported reason: %d", reason) + } + var certObj zerossl.CertificateObject + if err := json.Unmarshal(cert.IssuerData, &certObj); err != nil { + return err + } + return iss.getClient().RevokeCertificate(ctx, certObj.ID, r) +} + +func (iss *ZeroSSLIssuer) getDistributedValidationInfo(ctx context.Context, identifier string) (acme.Challenge, bool, error) { + ds := distributedSolver{ + storage: iss.Storage, + storageKeyIssuerPrefix: StorageKeys.Safe(iss.IssuerKey()), + } + tokenKey := ds.challengeTokensKey(identifier) + + valObjectBytes, err := iss.Storage.Load(ctx, tokenKey) + if err != nil { + return acme.Challenge{}, false, fmt.Errorf("opening distributed challenge token file %s: %v", tokenKey, err) + } + + if len(valObjectBytes) == 0 { + return acme.Challenge{}, false, fmt.Errorf("no information found to solve challenge for identifier: %s", identifier) + } + + // since the distributed solver's API is geared around ACME challenges, + // we crammed the validation info into a Challenge object + var chal acme.Challenge + if err = json.Unmarshal(valObjectBytes, &chal); err != nil { + return acme.Challenge{}, false, fmt.Errorf("decoding HTTP validation token file %s (corrupted?): %v", tokenKey, err) + } + + return chal, true, nil +} + +const ( + zerosslAPIBase = "https://" + zerossl.BaseURL + "/acme" + zerosslValidationPathPrefix = "/.well-known/pki-validation/" + zerosslIssuerKey = "zerossl" +) + +// Interface guards +var ( + _ Issuer = (*ZeroSSLIssuer)(nil) + _ Revoker = (*ZeroSSLIssuer)(nil) +) diff --git a/vendor/github.com/caddyserver/zerossl/.gitignore b/vendor/github.com/caddyserver/zerossl/.gitignore new file mode 100644 index 0000000..9daa723 --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/.gitignore @@ -0,0 +1,2 @@ +_gitignore +.DS_Store \ No newline at end of file diff --git a/vendor/go.uber.org/atomic/LICENSE.txt b/vendor/github.com/caddyserver/zerossl/LICENSE similarity index 87% rename from vendor/go.uber.org/atomic/LICENSE.txt rename to vendor/github.com/caddyserver/zerossl/LICENSE index 8765c9f..ef52626 100644 --- a/vendor/go.uber.org/atomic/LICENSE.txt +++ b/vendor/github.com/caddyserver/zerossl/LICENSE @@ -1,4 +1,6 @@ -Copyright (c) 2016 Uber Technologies, Inc. +MIT License + +Copyright (c) 2024 Matthew Holt Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal @@ -7,13 +9,13 @@ to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: -The above copyright notice and this permission notice shall be included in -all copies or substantial portions of the Software. +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -THE SOFTWARE. +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. \ No newline at end of file diff --git a/vendor/github.com/caddyserver/zerossl/README.md b/vendor/github.com/caddyserver/zerossl/README.md new file mode 100644 index 0000000..a50a82a --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/README.md @@ -0,0 +1,6 @@ +ZeroSSL API client [![Go Reference](https://pkg.go.dev/badge/github.com/caddyserver/zerossl.svg)](https://pkg.go.dev/github.com/caddyserver/zerossl) +================== + +This package implements the [ZeroSSL REST API](https://zerossl.com/documentation/api/) in Go. + +The REST API is distinct from the [ACME endpoint](https://zerossl.com/documentation/acme/), which is a standardized way of obtaining certificates. diff --git a/vendor/github.com/caddyserver/zerossl/client.go b/vendor/github.com/caddyserver/zerossl/client.go new file mode 100644 index 0000000..75a3de7 --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/client.go @@ -0,0 +1,170 @@ +package zerossl + +import ( + "bytes" + "context" + "encoding/json" + "fmt" + "io" + "net/http" + "net/url" + "strings" + "time" +) + +// Client acts as a ZeroSSL API client. It facilitates ZeroSSL certificate operations. +type Client struct { + // REQUIRED: Your ZeroSSL account access key. + AccessKey string `json:"access_key"` + + // Optionally adjust the base URL of the API. + // Default: https://api.zerossl.com + BaseURL string `json:"base_url,omitempty"` + + // Optionally configure a custom HTTP client. + HTTPClient *http.Client `json:"-"` +} + +func (c Client) httpGet(ctx context.Context, endpoint string, qs url.Values, target any) error { + url := c.url(endpoint, qs) + return c.httpRequest(ctx, http.MethodGet, url, nil, target) +} + +func (c Client) httpPost(ctx context.Context, endpoint string, qs url.Values, payload, target any) error { + var reqBody io.Reader + if payload != nil { + payloadJSON, err := json.Marshal(payload) + if err != nil { + return err + } + reqBody = bytes.NewReader(payloadJSON) + } + url := c.url(endpoint, qs) + return c.httpRequest(ctx, http.MethodPost, url, reqBody, target) +} + +func (c Client) httpRequest(ctx context.Context, method, reqURL string, reqBody io.Reader, target any) error { + r, err := http.NewRequestWithContext(ctx, method, reqURL, reqBody) + if err != nil { + return err + } + if reqBody != nil { + r.Header.Set("Content-Type", "application/json") + } + + resp, err := c.httpClient().Do(r) + if err != nil { + return err + } + defer resp.Body.Close() + + // because the ZeroSSL API doesn't use HTTP status codes to indicate an error, + // nor does each response body have a consistent way of detecting success/error, + // we have to implement a hack: download the entire response body and try + // decoding it as JSON in a way that errors if there's any unknown fields + // (such as "success"), because if there is an unkown field, either our model + // is outdated, or there was an error payload in the response instead of the + // expected structure, so we then try again to decode to an error struct + respBytes, err := io.ReadAll(io.LimitReader(resp.Body, 1024*1024*2)) + if err != nil { + return fmt.Errorf("failed reading response body: %v", err) + } + + // assume success first by trying to decode payload into output target + dec := json.NewDecoder(bytes.NewReader(respBytes)) + dec.DisallowUnknownFields() // important hacky hack so we can detect an error payload + originalDecodeErr := dec.Decode(&target) + if originalDecodeErr == nil { + return nil + } + + // could have gotten any kind of error, really; but assuming valid JSON, + // most likely it is an error payload + var apiError APIError + if err := json.NewDecoder(bytes.NewReader(respBytes)).Decode(&apiError); err != nil { + return fmt.Errorf("request succeeded, but decoding JSON response failed: %v (raw=%s)", err, respBytes) + } + + // successfully got an error! or did we? + if apiError.Success { + return apiError // ummm... why are we getting an error if it was successful ??? is this not really an error? + } + + // remove access_key from URL so it doesn't leak into logs + u, err := url.Parse(reqURL) + if err != nil { + reqURL = fmt.Sprintf("", err) + } + if u != nil { + q, err := url.ParseQuery(u.RawQuery) + if err == nil { + q.Set(accessKeyParam, "redacted") + u.RawQuery = q.Encode() + reqURL = u.String() + } + } + + return fmt.Errorf("%s %s: HTTP %d: %v (raw=%s decode_error=%v)", method, reqURL, resp.StatusCode, apiError, respBytes, originalDecodeErr) +} + +func (c Client) url(endpoint string, qs url.Values) string { + baseURL := c.BaseURL + if baseURL == "" { + baseURL = BaseURL + } + + // for consistency, ensure endpoint starts with / + // and base URL does NOT end with /. + if !strings.HasPrefix(endpoint, "/") { + endpoint = "/" + endpoint + } + baseURL = strings.TrimSuffix(baseURL, "/") + + if qs == nil { + qs = url.Values{} + } + qs.Set(accessKeyParam, c.AccessKey) + + return fmt.Sprintf("%s%s?%s", baseURL, endpoint, qs.Encode()) +} + +func (c Client) httpClient() *http.Client { + if c.HTTPClient != nil { + return c.HTTPClient + } + return httpClient +} + +var httpClient = &http.Client{ + Timeout: 2 * time.Minute, +} + +// anyBool is a hacky type that accepts true or 1 (or their string variants), +// or "yes" or "y", and any casing variants of the same, as a boolean true when +// unmarshaling JSON. Everything else is boolean false. +// +// This is needed due to type inconsistencies in ZeroSSL's API with "success" values. +type anyBool bool + +// UnmarshalJSON satisfies json.Unmarshaler according to +// this type's documentation. +func (ab *anyBool) UnmarshalJSON(b []byte) error { + if len(b) == 0 { + return io.EOF + } + switch strings.ToLower(string(b)) { + case `true`, `"true"`, `1`, `"1"`, `"yes"`, `"y"`: + *ab = true + } + return nil +} + +// MarshalJSON marshals ab to either true or false. +func (ab *anyBool) MarshalJSON() ([]byte, error) { + if ab != nil && *ab { + return []byte("true"), nil + } + return []byte("false"), nil +} + +const accessKeyParam = "access_key" diff --git a/vendor/github.com/caddyserver/zerossl/endpoints.go b/vendor/github.com/caddyserver/zerossl/endpoints.go new file mode 100644 index 0000000..3fabd44 --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/endpoints.go @@ -0,0 +1,270 @@ +package zerossl + +import ( + "context" + "crypto/x509" + "fmt" + "io" + "net/http" + "net/url" + "strconv" + "strings" +) + +// CreateCertificate creates a certificate. After creating a certificate, its identifiers must be verified before +// the certificate can be downloaded. The CSR must have been fully created using x509.CreateCertificateRequest +// (its Raw field must be filled out). +func (c Client) CreateCertificate(ctx context.Context, csr *x509.CertificateRequest, validityDays int) (CertificateObject, error) { + payload := struct { + CertificateDomains string `json:"certificate_domains"` + CertificateCSR string `json:"certificate_csr"` + CertificateValidityDays int `json:"certificate_validity_days,omitempty"` + StrictDomains int `json:"strict_domains,omitempty"` + ReplacementForCertificate string `json:"replacement_for_certificate,omitempty"` + }{ + CertificateDomains: strings.Join(identifiersFromCSR(csr), ","), + CertificateCSR: csr2pem(csr.Raw), + CertificateValidityDays: validityDays, + StrictDomains: 1, + } + + var result CertificateObject + if err := c.httpPost(ctx, "/certificates", nil, payload, &result); err != nil { + return CertificateObject{}, err + } + + return result, nil +} + +// VerifyIdentifiers tells ZeroSSL that you are ready to prove control over your domain/IP using the method specified. +// The credentials from CreateCertificate must be used to verify identifiers. At least one email is required if using +// email verification method. +func (c Client) VerifyIdentifiers(ctx context.Context, certificateID string, method VerificationMethod, emails []string) (CertificateObject, error) { + payload := struct { + ValidationMethod VerificationMethod `json:"validation_method"` + ValidationEmail string `json:"validation_email,omitempty"` + }{ + ValidationMethod: method, + } + if method == EmailVerification && len(emails) > 0 { + payload.ValidationEmail = strings.Join(emails, ",") + } + + endpoint := fmt.Sprintf("/certificates/%s/challenges", url.QueryEscape(certificateID)) + + var result CertificateObject + if err := c.httpPost(ctx, endpoint, nil, payload, &result); err != nil { + return CertificateObject{}, err + } + + return result, nil +} + +// DownloadCertificateFile writes the certificate bundle as a zip file to the provided output writer. +func (c Client) DownloadCertificateFile(ctx context.Context, certificateID string, includeCrossSigned bool, output io.Writer) error { + endpoint := fmt.Sprintf("/certificates/%s/download", url.QueryEscape(certificateID)) + + qs := url.Values{} + if includeCrossSigned { + qs.Set("include_cross_signed", "1") + } + + url := c.url(endpoint, qs) + r, err := http.NewRequestWithContext(ctx, http.MethodGet, url, nil) + if err != nil { + return err + } + + resp, err := c.httpClient().Do(r) + if err != nil { + return err + } + defer resp.Body.Close() + if resp.StatusCode != http.StatusOK { + return fmt.Errorf("unexpected status code: HTTP %d", resp.StatusCode) + } + + if _, err := io.Copy(output, resp.Body); err != nil { + return err + } + + return nil +} + +func (c Client) DownloadCertificate(ctx context.Context, certificateID string, includeCrossSigned bool) (CertificateBundle, error) { + endpoint := fmt.Sprintf("/certificates/%s/download/return", url.QueryEscape(certificateID)) + + qs := url.Values{} + if includeCrossSigned { + qs.Set("include_cross_signed", "1") + } + + var result CertificateBundle + if err := c.httpGet(ctx, endpoint, qs, &result); err != nil { + return CertificateBundle{}, err + } + + return result, nil +} + +func (c Client) GetCertificate(ctx context.Context, certificateID string) (CertificateObject, error) { + endpoint := fmt.Sprintf("/certificates/%s", url.QueryEscape(certificateID)) + + var result CertificateObject + if err := c.httpGet(ctx, endpoint, nil, &result); err != nil { + return CertificateObject{}, err + } + + return result, nil +} + +// ListCertificateParameters specifies how to search or list certificates on the account. +// An empty set of parameters will return no results. +type ListCertificatesParameters struct { + // Return certificates with this status. + Status string + + // Return these types of certificates. + Type string + + // The CommonName or SAN. + Search string + + // The page number. Default: 1 + Page int + + // How many per page. Default: 100 + Limit int +} + +func (c Client) ListCertificates(ctx context.Context, params ListCertificatesParameters) (CertificateList, error) { + qs := url.Values{} + if params.Status != "" { + qs.Set("certificate_status", params.Status) + } + if params.Type != "" { + qs.Set("certificate_type", params.Type) + } + if params.Search != "" { + qs.Set("search", params.Search) + } + if params.Limit != 0 { + qs.Set("limit", strconv.Itoa(params.Limit)) + } + if params.Page != 0 { + qs.Set("page", strconv.Itoa(params.Page)) + } + + var result CertificateList + if err := c.httpGet(ctx, "/certificates", qs, &result); err != nil { + return CertificateList{}, err + } + + return result, nil +} + +func (c Client) VerificationStatus(ctx context.Context, certificateID string) (ValidationStatus, error) { + endpoint := fmt.Sprintf("/certificates/%s/status", url.QueryEscape(certificateID)) + + var result ValidationStatus + if err := c.httpGet(ctx, endpoint, nil, &result); err != nil { + return ValidationStatus{}, err + } + + return result, nil +} + +func (c Client) ResendVerificationEmail(ctx context.Context, certificateID string) error { + endpoint := fmt.Sprintf("/certificates/%s/challenges/email", url.QueryEscape(certificateID)) + + var result struct { + Success anyBool `json:"success"` + } + if err := c.httpGet(ctx, endpoint, nil, &result); err != nil { + return err + } + + if !result.Success { + return fmt.Errorf("got %v without any error status", result) + } + + return nil +} + +// Only revoke a certificate if the private key is compromised, the certificate was a mistake, or +// the identifiers are no longer in use. Do not revoke a certificate when renewing it. +func (c Client) RevokeCertificate(ctx context.Context, certificateID string, reason RevocationReason) error { + endpoint := fmt.Sprintf("/certificates/%s/revoke", url.QueryEscape(certificateID)) + + qs := url.Values{"reason": []string{string(reason)}} + + var result struct { + Success anyBool `json:"success"` + } + if err := c.httpGet(ctx, endpoint, qs, &result); err != nil { + return err + } + + if !result.Success { + return fmt.Errorf("got %v without any error status", result) + } + + return nil +} + +// CancelCertificate cancels a certificate that has not been issued yet (is in draft or pending_validation state). +func (c Client) CancelCertificate(ctx context.Context, certificateID string) error { + endpoint := fmt.Sprintf("/certificates/%s/cancel", url.QueryEscape(certificateID)) + + var result struct { + Success anyBool `json:"success"` + } + if err := c.httpPost(ctx, endpoint, nil, nil, &result); err != nil { + return err + } + + if !result.Success { + return fmt.Errorf("got %v without any error status", result) + } + + return nil +} + +// ValidateCSR sends the CSR to ZeroSSL for validation. Pass in the ASN.1 DER-encoded bytes; +// this is found in x509.CertificateRequest.Raw after calling x5p9.CreateCertificateRequest. +func (c Client) ValidateCSR(ctx context.Context, csrASN1DER []byte) error { + payload := struct { + CSR string `json:"csr"` + }{ + CSR: csr2pem(csrASN1DER), + } + + var result struct { + Valid bool `json:"valid"` + Error any `json:"error"` + } + if err := c.httpPost(ctx, "/validation/csr", nil, payload, &result); err != nil { + return err + } + + if !result.Valid { + return fmt.Errorf("invalid CSR: %v", result.Error) + } + return nil +} + +func (c Client) GenerateEABCredentials(ctx context.Context) (keyID, hmacKey string, err error) { + var result struct { + APIError + EABKID string `json:"eab_kid"` + EABHMACKey string `json:"eab_hmac_key"` + } + err = c.httpPost(ctx, "/acme/eab-credentials", nil, nil, &result) + if err != nil { + return + } + if !result.Success { + err = fmt.Errorf("failed to create EAB credentials: %v", result.APIError) + } + return result.EABKID, result.EABHMACKey, err +} diff --git a/vendor/github.com/caddyserver/zerossl/models.go b/vendor/github.com/caddyserver/zerossl/models.go new file mode 100644 index 0000000..80475f0 --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/models.go @@ -0,0 +1,94 @@ +package zerossl + +import "fmt" + +type APIError struct { + Success anyBool `json:"success"` + ErrorInfo struct { + Code int `json:"code"` + Type string `json:"type"` + + // for domain verification only; each domain is grouped into its + // www and non-www variant for CNAME validation, or its URL + // for HTTP validation + Details map[string]map[string]ValidationError `json:"details"` + } `json:"error"` +} + +func (ae APIError) Error() string { + if ae.ErrorInfo.Code == 0 && ae.ErrorInfo.Type == "" && len(ae.ErrorInfo.Details) == 0 { + return "" + } + return fmt.Sprintf("API error %d: %s (details=%v)", + ae.ErrorInfo.Code, ae.ErrorInfo.Type, ae.ErrorInfo.Details) +} + +type ValidationError struct { + CNAMEValidationError + HTTPValidationError +} + +type CNAMEValidationError struct { + CNAMEFound int `json:"cname_found"` + RecordCorrect int `json:"record_correct"` + TargetHost string `json:"target_host"` + TargetRecord string `json:"target_record"` + ActualRecord string `json:"actual_record"` +} + +type HTTPValidationError struct { + FileFound int `json:"file_found"` + Error bool `json:"error"` + ErrorSlug string `json:"error_slug"` + ErrorInfo string `json:"error_info"` +} + +type CertificateObject struct { + ID string `json:"id"` // "certificate hash" + Type string `json:"type"` + CommonName string `json:"common_name"` + AdditionalDomains string `json:"additional_domains"` + Created string `json:"created"` + Expires string `json:"expires"` + Status string `json:"status"` + ValidationType *string `json:"validation_type,omitempty"` + ValidationEmails *string `json:"validation_emails,omitempty"` + ReplacementFor string `json:"replacement_for,omitempty"` + FingerprintSHA1 *string `json:"fingerprint_sha1"` + BrandValidation any `json:"brand_validation"` + Validation *struct { + EmailValidation map[string][]string `json:"email_validation,omitempty"` + OtherMethods map[string]ValidationObject `json:"other_methods,omitempty"` + } `json:"validation,omitempty"` +} + +type ValidationObject struct { + FileValidationURLHTTP string `json:"file_validation_url_http"` + FileValidationURLHTTPS string `json:"file_validation_url_https"` + FileValidationContent []string `json:"file_validation_content"` + CnameValidationP1 string `json:"cname_validation_p1"` + CnameValidationP2 string `json:"cname_validation_p2"` +} + +type CertificateBundle struct { + CertificateCrt string `json:"certificate.crt"` + CABundleCrt string `json:"ca_bundle.crt"` +} + +type CertificateList struct { + TotalCount int `json:"total_count"` + ResultCount int `json:"result_count"` + Page string `json:"page"` // don't ask me why this is a string + Limit int `json:"limit"` + ACMEUsageLevel string `json:"acmeUsageLevel"` + ACMELocked bool `json:"acmeLocked"` + Results []CertificateObject `json:"results"` +} + +type ValidationStatus struct { + ValidationCompleted int `json:"validation_completed"` + Details map[string]struct { + Method string `json:"method"` + Status string `json:"status"` + } `json:"details"` +} diff --git a/vendor/github.com/caddyserver/zerossl/zerossl.go b/vendor/github.com/caddyserver/zerossl/zerossl.go new file mode 100644 index 0000000..7585334 --- /dev/null +++ b/vendor/github.com/caddyserver/zerossl/zerossl.go @@ -0,0 +1,64 @@ +// Package zerossl implements the ZeroSSL REST API. +// See the API documentation on the ZeroSSL website: https://zerossl.com/documentation/api/ +package zerossl + +import ( + "crypto/x509" + "encoding/base64" + "fmt" +) + +// The base URL to the ZeroSSL API. +const BaseURL = "https://api.zerossl.com" + +// ListAllCertificates returns parameters that lists all the certificates on the account; +// be sure to set Page and Limit if paginating. +func ListAllCertificates() ListCertificatesParameters { + return ListCertificatesParameters{ + Status: "draft,pending_validation,issued,cancelled,revoked,expired", + } +} + +func identifiersFromCSR(csr *x509.CertificateRequest) []string { + var identifiers []string + if csr.Subject.CommonName != "" { + // deprecated for like 20 years, but oh well + identifiers = append(identifiers, csr.Subject.CommonName) + } + identifiers = append(identifiers, csr.DNSNames...) + identifiers = append(identifiers, csr.EmailAddresses...) + for _, ip := range csr.IPAddresses { + identifiers = append(identifiers, ip.String()) + } + for _, uri := range csr.URIs { + identifiers = append(identifiers, uri.String()) + } + return identifiers +} + +func csr2pem(csrASN1DER []byte) string { + return fmt.Sprintf("-----BEGIN CERTIFICATE REQUEST-----\n%s\n-----END CERTIFICATE REQUEST-----", + base64.StdEncoding.EncodeToString(csrASN1DER)) +} + +// VerificationMethod represents a way of verifying identifiers with ZeroSSL. +type VerificationMethod string + +// Verification methods. +const ( + EmailVerification VerificationMethod = "EMAIL" + CNAMEVerification VerificationMethod = "CNAME_CSR_HASH" + HTTPVerification VerificationMethod = "HTTP_CSR_HASH" + HTTPSVerification VerificationMethod = "HTTPS_CSR_HASH" +) + +// RevocationReason represents various reasons for revoking a certificate. +type RevocationReason string + +const ( + UnspecifiedReason RevocationReason = "unspecified" // default + KeyCompromise RevocationReason = "keyCompromise" // lost control of private key + AffiliationChanged RevocationReason = "affiliationChanged" // identify information changed + Superseded RevocationReason = "Superseded" // certificate replaced -- do not revoke for this reason, however + CessationOfOperation RevocationReason = "cessationOfOperation" // domains are no longer in use +) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index accd7ab..30f8d29 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c Package home: https://github.com/klauspost/cpuid [![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) -[![Build Status][3]][4] - -[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master -[4]: https://travis-ci.org/klauspost/cpuid +[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml) ## installing @@ -285,7 +282,12 @@ Exit Code 1 | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | | AMXTILE | Tile architecture | +| APX_F | Intel APX | | AVX | AVX functions | +| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | +| AVX10_128 | If set indicates that AVX10 128-bit vector support is present | +| AVX10_256 | If set indicates that AVX10 256-bit vector support is present | +| AVX10_512 | If set indicates that AVX10 512-bit vector support is present | | AVX2 | AVX2 functions | | AVX512BF16 | AVX-512 BFLOAT16 Instructions | | AVX512BITALG | AVX-512 Bit Algorithms | @@ -365,6 +367,8 @@ Exit Code 1 | IDPRED_CTRL | IPRED_DIS | | INT_WBINVD | WBINVD/WBNOINVD are interruptible. | | INVLPGB | NVLPGB and TLBSYNC instruction supported | +| KEYLOCKER | Key locker | +| KEYLOCKERW | Key locker wide | | LAHF | LAHF/SAHF in long mode | | LAM | If set, CPU supports Linear Address Masking | | LBRVIRT | LBR virtualization | @@ -380,7 +384,7 @@ Exit Code 1 | MOVDIRI | Move Doubleword as Direct Store | | MOVSB_ZL | Fast Zero-Length MOVSB | | MPX | Intel MPX (Memory Protection Extensions) | -| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | | MSRIRC | Instruction Retired Counter MSR available | | MSRLIST | Read/Write List of Model Specific Registers | | MSR_PAGEFLUSH | Page Flush MSR available | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index d015c74..805f5e7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -67,188 +67,200 @@ const ( // Keep index -1 as unknown UNKNOWN = -1 - // Add features - ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - AESNI // Advanced Encryption Standard New Instructions - AMD3DNOW // AMD 3DNOW - AMD3DNOWEXT // AMD 3DNowExt - AMXBF16 // Tile computational operations on BFLOAT16 numbers - AMXFP16 // Tile computational operations on FP16 numbers - AMXINT8 // Tile computational operations on 8-bit integers - AMXTILE // Tile architecture - AVX // AVX functions - AVX2 // AVX2 functions - AVX512BF16 // AVX-512 BFLOAT16 Instructions - AVX512BITALG // AVX-512 Bit Algorithms - AVX512BW // AVX-512 Byte and Word Instructions - AVX512CD // AVX-512 Conflict Detection Instructions - AVX512DQ // AVX-512 Doubleword and Quadword Instructions - AVX512ER // AVX-512 Exponential and Reciprocal Instructions - AVX512F // AVX-512 Foundation - AVX512FP16 // AVX-512 FP16 Instructions - AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF // AVX-512 Prefetch Instructions - AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VL // AVX-512 Vector Length Extensions - AVX512VNNI // AVX-512 Vector Neural Network Instructions - AVX512VP2INTERSECT // AVX-512 Intersect for D/Q - AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXIFMA // AVX-IFMA instructions - AVXNECONVERT // AVX-NE-CONVERT instructions - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one - AVXVNNI // AVX (VEX encoded) VNNI neural network instructions - AVXVNNIINT8 // AVX-VNNI-INT8 instructions - BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 - BMI1 // Bit Manipulation Instruction Set 1 - BMI2 // Bit Manipulation Instruction Set 2 - CETIBT // Intel CET Indirect Branch Tracking - CETSS // Intel CET Shadow Stack - CLDEMOTE // Cache Line Demote - CLMUL // Carry-less Multiplication - CLZERO // CLZERO instruction supported - CMOV // i686 CMOV - CMPCCXADD // CMPCCXADD instructions - CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB - CMPXCHG8 // CMPXCHG8 instruction - CPBOOST // Core Performance Boost - CPPC // AMD: Collaborative Processor Performance Control - CX16 // CMPXCHG16B Instruction - EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ - ENQCMD // Enqueue Command - ERMS // Enhanced REP MOVSB/STOSB - F16C // Half-precision floating-point conversion - FLUSH_L1D // Flush L1D cache - FMA3 // Intel FMA 3. Does not imply AVX. - FMA4 // Bulldozer FMA4 functions - FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide - FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide - FSRM // Fast Short Rep Mov - FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 - FXSROPT // FXSAVE/FXRSTOR optimizations - GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. - HLE // Hardware Lock Elision - HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR - HTT // Hyperthreading (enabled) - HWA // Hardware assert supported. Indicates support for MSRC001_10 - HYBRID_CPU // This part has CPUs of more than one type. - HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors - IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) - IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR - IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) - IBRS // AMD: Indirect Branch Restricted Speculation - IBRS_PREFERRED // AMD: IBRS is preferred over software solution - IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection - IBS // Instruction Based Sampling (AMD) - IBSBRNTRGT // Instruction Based Sampling Feature (AMD) - IBSFETCHSAM // Instruction Based Sampling Feature (AMD) - IBSFFV // Instruction Based Sampling Feature (AMD) - IBSOPCNT // Instruction Based Sampling Feature (AMD) - IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) - IBSOPSAM // Instruction Based Sampling Feature (AMD) - IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) - IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) - IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported - IBS_OPDATA4 // AMD: IBS op data 4 MSR supported - IBS_OPFUSE // AMD: Indicates support for IbsOpFuse - IBS_PREVENTHOST // Disallowing IBS use by the host supported - IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 - IDPRED_CTRL // IPRED_DIS - INT_WBINVD // WBINVD/WBNOINVD are interruptible. - INVLPGB // NVLPGB and TLBSYNC instruction supported - LAHF // LAHF/SAHF in long mode - LAM // If set, CPU supports Linear Address Masking - LBRVIRT // LBR virtualization - LZCNT // LZCNT instruction - MCAOVERFLOW // MCA overflow recovery support. - MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. - MCOMMIT // MCOMMIT instruction supported - MD_CLEAR // VERW clears CPU buffers - MMX // standard MMX - MMXEXT // SSE integer functions or AMD MMX ext - MOVBE // MOVBE instruction (big-endian) - MOVDIR64B // Move 64 Bytes as Direct Store - MOVDIRI // Move Doubleword as Direct Store - MOVSB_ZL // Fast Zero-Length MOVSB - MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD - MPX // Intel MPX (Memory Protection Extensions) - MSRIRC // Instruction Retired Counter MSR available - MSRLIST // Read/Write List of Model Specific Registers - MSR_PAGEFLUSH // Page Flush MSR available - NRIPS // Indicates support for NRIP save on VMEXIT - NX // NX (No-Execute) bit - OSXSAVE // XSAVE enabled by OS - PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption - POPCNT // POPCNT instruction - PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled - PREFETCHI // PREFETCHIT0/1 instructions - PSFD // Predictive Store Forward Disable - RDPRU // RDPRU instruction supported - RDRAND // RDRAND instruction is available - RDSEED // RDSEED instruction is available - RDTSCP // RDTSCP Instruction - RRSBA_CTRL // Restricted RSB Alternate - RTM // Restricted Transactional Memory - RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. - SERIALIZE // Serialize Instruction Execution - SEV // AMD Secure Encrypted Virtualization supported - SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host - SEV_ALTERNATIVE // AMD SEV Alternate Injection supported - SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests - SEV_ES // AMD SEV Encrypted State supported - SEV_RESTRICTED // AMD SEV Restricted Injection supported - SEV_SNP // AMD SEV Secure Nested Paging supported - SGX // Software Guard Extensions - SGXLC // Software Guard Extensions Launch Control - SHA // Intel SHA Extensions - SME // AMD Secure Memory Encryption supported - SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced - SPEC_CTRL_SSBD // Speculative Store Bypass Disable - SRBDS_CTRL // SRBDS mitigation MSR available - SSE // SSE functions - SSE2 // P4 SSE functions - SSE3 // Prescott SSE3 functions - SSE4 // Penryn SSE4.1 functions - SSE42 // Nehalem SSE4.2 functions - SSE4A // AMD Barcelona microarchitecture SSE4a instructions - SSSE3 // Conroe SSSE3 functions - STIBP // Single Thread Indirect Branch Predictors - STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On - STOSB_SHORT // Fast short STOSB - SUCCOR // Software uncorrectable error containment and recovery capability. - SVM // AMD Secure Virtual Machine - SVMDA // Indicates support for the SVM decode assists. - SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control - SVML // AMD SVM lock. Indicates support for SVM-Lock. - SVMNP // AMD SVM nested paging - SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter - SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold - SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. - SYSEE // SYSENTER and SYSEXIT instructions - TBM // AMD Trailing Bit Manipulation - TDX_GUEST // Intel Trust Domain Extensions Guest - TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations - TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. - TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. - TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 - TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES. AVX(512) versions requires additional checks. - VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. - VMPL // AMD VM Permission Levels supported - VMSA_REGPROT // AMD VMSA Register Protection supported - VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. - VTE // AMD Virtual Transparent Encryption supported - WAITPKG // TPAUSE, UMONITOR, UMWAIT - WBNOINVD // Write Back and Do Not Invalidate Cache - WRMSRNS // Non-Serializing Write to Model Specific Register - X87 // FPU - XGETBV1 // Supports XGETBV with ECX = 1 - XOP // Bulldozer XOP functions - XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV - XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. - XSAVEOPT // XSAVEOPT available - XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + // x86 features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + APX_F // Intel APX + AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SBPB // Indicates support for the Selective Branch Predictor Barrier + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. + SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability + SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -302,9 +314,11 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AMDMemEncryption AMDMemEncryptionSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1071,6 +1085,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) { return } +type AMDMemEncryptionSupport struct { + Available bool + CBitPossition uint32 + NumVMPL uint32 + PhysAddrReduction uint32 + NumEntryptedGuests uint32 + MinSevNoEsAsid uint32 +} + +func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) { + rval.Available = available + if !available { + return + } + + _, b, c, d := cpuidex(0x8000001f, 0) + + rval.CBitPossition = b & 0x3f + rval.PhysAddrReduction = (b >> 6) & 0x3F + rval.NumVMPL = (b >> 12) & 0xf + rval.NumEntryptedGuests = c + rval.MinSevNoEsAsid = d + + return +} + func support() flagSet { var fs flagSet mfi := maxFunctionID() @@ -1165,6 +1205,7 @@ func support() flagSet { fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<23) != 0, KEYLOCKER) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) @@ -1202,6 +1243,8 @@ func support() flagSet { fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + fs.setIf(edx1&(1<<19) != 0, AVX10) + fs.setIf(edx1&(1<<21) != 0, APX_F) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -1252,6 +1295,19 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + // Add keylocker features. + if fs.inSet(KEYLOCKER) && mfi >= 0x19 { + _, ebx, _, _ := cpuidex(0x19, 0) + fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4) + } + + // Add AVX10 features. + if fs.inSet(AVX10) && mfi >= 0x24 { + _, ebx, _, _ := cpuidex(0x24, 0) + fs.setIf(ebx&(1<<16) != 0, AVX10_128) + fs.setIf(ebx&(1<<17) != 0, AVX10_256) + fs.setIf(ebx&(1<<18) != 0, AVX10_512) + } } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1394,6 +1450,29 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if maxExtendedFunction() >= 0x80000021 && vend == AMD { + a, _, _, _ := cpuid(0x80000021) + fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) + fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) + fs.setIf((a>>29)&1 == 1, SRSO_NO) + fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) + fs.setIf((a>>27)&1 == 1, SBPB) + } + + if mfi >= 0x20 { + // Microsoft has decided to purposefully hide the information + // of the guest TEE when VMs are being created using Hyper-V. + // + // This leads us to check for the Hyper-V cpuid features + // (0x4000000C), and then for the `ebx` value set. + // + // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part + // we're mostly interested about,according to: + // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174 + _, ebx, _, _ := cpuid(0x4000000C) + fs.setIf(ebx == 0xbe3, TDX_GUEST) + } + if mfi >= 0x21 { // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). _, ebx, ecx, edx := cpuid(0x21) @@ -1404,6 +1483,14 @@ func support() flagSet { return fs } +func (c *CPUInfo) supportAVX10() uint8 { + if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) { + _, ebx, _, _ := cpuidex(0x24, 0) + return uint8(ebx) + } + return 0 +} + func valAsString(values ...uint32) []byte { r := make([]byte, 4*len(values)) for i, v := range values { diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c946824..799b400 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -27,10 +27,12 @@ func addInfo(c *CPUInfo, safe bool) { c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV)) c.ThreadsPerCore = threadsPerCore() c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 024c706..57a085a 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -16,210 +16,222 @@ func _() { _ = x[AMXFP16-6] _ = x[AMXINT8-7] _ = x[AMXTILE-8] - _ = x[AVX-9] - _ = x[AVX2-10] - _ = x[AVX512BF16-11] - _ = x[AVX512BITALG-12] - _ = x[AVX512BW-13] - _ = x[AVX512CD-14] - _ = x[AVX512DQ-15] - _ = x[AVX512ER-16] - _ = x[AVX512F-17] - _ = x[AVX512FP16-18] - _ = x[AVX512IFMA-19] - _ = x[AVX512PF-20] - _ = x[AVX512VBMI-21] - _ = x[AVX512VBMI2-22] - _ = x[AVX512VL-23] - _ = x[AVX512VNNI-24] - _ = x[AVX512VP2INTERSECT-25] - _ = x[AVX512VPOPCNTDQ-26] - _ = x[AVXIFMA-27] - _ = x[AVXNECONVERT-28] - _ = x[AVXSLOW-29] - _ = x[AVXVNNI-30] - _ = x[AVXVNNIINT8-31] - _ = x[BHI_CTRL-32] - _ = x[BMI1-33] - _ = x[BMI2-34] - _ = x[CETIBT-35] - _ = x[CETSS-36] - _ = x[CLDEMOTE-37] - _ = x[CLMUL-38] - _ = x[CLZERO-39] - _ = x[CMOV-40] - _ = x[CMPCCXADD-41] - _ = x[CMPSB_SCADBS_SHORT-42] - _ = x[CMPXCHG8-43] - _ = x[CPBOOST-44] - _ = x[CPPC-45] - _ = x[CX16-46] - _ = x[EFER_LMSLE_UNS-47] - _ = x[ENQCMD-48] - _ = x[ERMS-49] - _ = x[F16C-50] - _ = x[FLUSH_L1D-51] - _ = x[FMA3-52] - _ = x[FMA4-53] - _ = x[FP128-54] - _ = x[FP256-55] - _ = x[FSRM-56] - _ = x[FXSR-57] - _ = x[FXSROPT-58] - _ = x[GFNI-59] - _ = x[HLE-60] - _ = x[HRESET-61] - _ = x[HTT-62] - _ = x[HWA-63] - _ = x[HYBRID_CPU-64] - _ = x[HYPERVISOR-65] - _ = x[IA32_ARCH_CAP-66] - _ = x[IA32_CORE_CAP-67] - _ = x[IBPB-68] - _ = x[IBRS-69] - _ = x[IBRS_PREFERRED-70] - _ = x[IBRS_PROVIDES_SMP-71] - _ = x[IBS-72] - _ = x[IBSBRNTRGT-73] - _ = x[IBSFETCHSAM-74] - _ = x[IBSFFV-75] - _ = x[IBSOPCNT-76] - _ = x[IBSOPCNTEXT-77] - _ = x[IBSOPSAM-78] - _ = x[IBSRDWROPCNT-79] - _ = x[IBSRIPINVALIDCHK-80] - _ = x[IBS_FETCH_CTLX-81] - _ = x[IBS_OPDATA4-82] - _ = x[IBS_OPFUSE-83] - _ = x[IBS_PREVENTHOST-84] - _ = x[IBS_ZEN4-85] - _ = x[IDPRED_CTRL-86] - _ = x[INT_WBINVD-87] - _ = x[INVLPGB-88] - _ = x[LAHF-89] - _ = x[LAM-90] - _ = x[LBRVIRT-91] - _ = x[LZCNT-92] - _ = x[MCAOVERFLOW-93] - _ = x[MCDT_NO-94] - _ = x[MCOMMIT-95] - _ = x[MD_CLEAR-96] - _ = x[MMX-97] - _ = x[MMXEXT-98] - _ = x[MOVBE-99] - _ = x[MOVDIR64B-100] - _ = x[MOVDIRI-101] - _ = x[MOVSB_ZL-102] - _ = x[MOVU-103] - _ = x[MPX-104] - _ = x[MSRIRC-105] - _ = x[MSRLIST-106] - _ = x[MSR_PAGEFLUSH-107] - _ = x[NRIPS-108] - _ = x[NX-109] - _ = x[OSXSAVE-110] - _ = x[PCONFIG-111] - _ = x[POPCNT-112] - _ = x[PPIN-113] - _ = x[PREFETCHI-114] - _ = x[PSFD-115] - _ = x[RDPRU-116] - _ = x[RDRAND-117] - _ = x[RDSEED-118] - _ = x[RDTSCP-119] - _ = x[RRSBA_CTRL-120] - _ = x[RTM-121] - _ = x[RTM_ALWAYS_ABORT-122] - _ = x[SERIALIZE-123] - _ = x[SEV-124] - _ = x[SEV_64BIT-125] - _ = x[SEV_ALTERNATIVE-126] - _ = x[SEV_DEBUGSWAP-127] - _ = x[SEV_ES-128] - _ = x[SEV_RESTRICTED-129] - _ = x[SEV_SNP-130] - _ = x[SGX-131] - _ = x[SGXLC-132] - _ = x[SHA-133] - _ = x[SME-134] - _ = x[SME_COHERENT-135] - _ = x[SPEC_CTRL_SSBD-136] - _ = x[SRBDS_CTRL-137] - _ = x[SSE-138] - _ = x[SSE2-139] - _ = x[SSE3-140] - _ = x[SSE4-141] - _ = x[SSE42-142] - _ = x[SSE4A-143] - _ = x[SSSE3-144] - _ = x[STIBP-145] - _ = x[STIBP_ALWAYSON-146] - _ = x[STOSB_SHORT-147] - _ = x[SUCCOR-148] - _ = x[SVM-149] - _ = x[SVMDA-150] - _ = x[SVMFBASID-151] - _ = x[SVML-152] - _ = x[SVMNP-153] - _ = x[SVMPF-154] - _ = x[SVMPFT-155] - _ = x[SYSCALL-156] - _ = x[SYSEE-157] - _ = x[TBM-158] - _ = x[TDX_GUEST-159] - _ = x[TLB_FLUSH_NESTED-160] - _ = x[TME-161] - _ = x[TOPEXT-162] - _ = x[TSCRATEMSR-163] - _ = x[TSXLDTRK-164] - _ = x[VAES-165] - _ = x[VMCBCLEAN-166] - _ = x[VMPL-167] - _ = x[VMSA_REGPROT-168] - _ = x[VMX-169] - _ = x[VPCLMULQDQ-170] - _ = x[VTE-171] - _ = x[WAITPKG-172] - _ = x[WBNOINVD-173] - _ = x[WRMSRNS-174] - _ = x[X87-175] - _ = x[XGETBV1-176] - _ = x[XOP-177] - _ = x[XSAVE-178] - _ = x[XSAVEC-179] - _ = x[XSAVEOPT-180] - _ = x[XSAVES-181] - _ = x[AESARM-182] - _ = x[ARMCPUID-183] - _ = x[ASIMD-184] - _ = x[ASIMDDP-185] - _ = x[ASIMDHP-186] - _ = x[ASIMDRDM-187] - _ = x[ATOMICS-188] - _ = x[CRC32-189] - _ = x[DCPOP-190] - _ = x[EVTSTRM-191] - _ = x[FCMA-192] - _ = x[FP-193] - _ = x[FPHP-194] - _ = x[GPA-195] - _ = x[JSCVT-196] - _ = x[LRCPC-197] - _ = x[PMULL-198] - _ = x[SHA1-199] - _ = x[SHA2-200] - _ = x[SHA3-201] - _ = x[SHA512-202] - _ = x[SM3-203] - _ = x[SM4-204] - _ = x[SVE-205] - _ = x[lastID-206] + _ = x[APX_F-9] + _ = x[AVX-10] + _ = x[AVX10-11] + _ = x[AVX10_128-12] + _ = x[AVX10_256-13] + _ = x[AVX10_512-14] + _ = x[AVX2-15] + _ = x[AVX512BF16-16] + _ = x[AVX512BITALG-17] + _ = x[AVX512BW-18] + _ = x[AVX512CD-19] + _ = x[AVX512DQ-20] + _ = x[AVX512ER-21] + _ = x[AVX512F-22] + _ = x[AVX512FP16-23] + _ = x[AVX512IFMA-24] + _ = x[AVX512PF-25] + _ = x[AVX512VBMI-26] + _ = x[AVX512VBMI2-27] + _ = x[AVX512VL-28] + _ = x[AVX512VNNI-29] + _ = x[AVX512VP2INTERSECT-30] + _ = x[AVX512VPOPCNTDQ-31] + _ = x[AVXIFMA-32] + _ = x[AVXNECONVERT-33] + _ = x[AVXSLOW-34] + _ = x[AVXVNNI-35] + _ = x[AVXVNNIINT8-36] + _ = x[BHI_CTRL-37] + _ = x[BMI1-38] + _ = x[BMI2-39] + _ = x[CETIBT-40] + _ = x[CETSS-41] + _ = x[CLDEMOTE-42] + _ = x[CLMUL-43] + _ = x[CLZERO-44] + _ = x[CMOV-45] + _ = x[CMPCCXADD-46] + _ = x[CMPSB_SCADBS_SHORT-47] + _ = x[CMPXCHG8-48] + _ = x[CPBOOST-49] + _ = x[CPPC-50] + _ = x[CX16-51] + _ = x[EFER_LMSLE_UNS-52] + _ = x[ENQCMD-53] + _ = x[ERMS-54] + _ = x[F16C-55] + _ = x[FLUSH_L1D-56] + _ = x[FMA3-57] + _ = x[FMA4-58] + _ = x[FP128-59] + _ = x[FP256-60] + _ = x[FSRM-61] + _ = x[FXSR-62] + _ = x[FXSROPT-63] + _ = x[GFNI-64] + _ = x[HLE-65] + _ = x[HRESET-66] + _ = x[HTT-67] + _ = x[HWA-68] + _ = x[HYBRID_CPU-69] + _ = x[HYPERVISOR-70] + _ = x[IA32_ARCH_CAP-71] + _ = x[IA32_CORE_CAP-72] + _ = x[IBPB-73] + _ = x[IBPB_BRTYPE-74] + _ = x[IBRS-75] + _ = x[IBRS_PREFERRED-76] + _ = x[IBRS_PROVIDES_SMP-77] + _ = x[IBS-78] + _ = x[IBSBRNTRGT-79] + _ = x[IBSFETCHSAM-80] + _ = x[IBSFFV-81] + _ = x[IBSOPCNT-82] + _ = x[IBSOPCNTEXT-83] + _ = x[IBSOPSAM-84] + _ = x[IBSRDWROPCNT-85] + _ = x[IBSRIPINVALIDCHK-86] + _ = x[IBS_FETCH_CTLX-87] + _ = x[IBS_OPDATA4-88] + _ = x[IBS_OPFUSE-89] + _ = x[IBS_PREVENTHOST-90] + _ = x[IBS_ZEN4-91] + _ = x[IDPRED_CTRL-92] + _ = x[INT_WBINVD-93] + _ = x[INVLPGB-94] + _ = x[KEYLOCKER-95] + _ = x[KEYLOCKERW-96] + _ = x[LAHF-97] + _ = x[LAM-98] + _ = x[LBRVIRT-99] + _ = x[LZCNT-100] + _ = x[MCAOVERFLOW-101] + _ = x[MCDT_NO-102] + _ = x[MCOMMIT-103] + _ = x[MD_CLEAR-104] + _ = x[MMX-105] + _ = x[MMXEXT-106] + _ = x[MOVBE-107] + _ = x[MOVDIR64B-108] + _ = x[MOVDIRI-109] + _ = x[MOVSB_ZL-110] + _ = x[MOVU-111] + _ = x[MPX-112] + _ = x[MSRIRC-113] + _ = x[MSRLIST-114] + _ = x[MSR_PAGEFLUSH-115] + _ = x[NRIPS-116] + _ = x[NX-117] + _ = x[OSXSAVE-118] + _ = x[PCONFIG-119] + _ = x[POPCNT-120] + _ = x[PPIN-121] + _ = x[PREFETCHI-122] + _ = x[PSFD-123] + _ = x[RDPRU-124] + _ = x[RDRAND-125] + _ = x[RDSEED-126] + _ = x[RDTSCP-127] + _ = x[RRSBA_CTRL-128] + _ = x[RTM-129] + _ = x[RTM_ALWAYS_ABORT-130] + _ = x[SBPB-131] + _ = x[SERIALIZE-132] + _ = x[SEV-133] + _ = x[SEV_64BIT-134] + _ = x[SEV_ALTERNATIVE-135] + _ = x[SEV_DEBUGSWAP-136] + _ = x[SEV_ES-137] + _ = x[SEV_RESTRICTED-138] + _ = x[SEV_SNP-139] + _ = x[SGX-140] + _ = x[SGXLC-141] + _ = x[SHA-142] + _ = x[SME-143] + _ = x[SME_COHERENT-144] + _ = x[SPEC_CTRL_SSBD-145] + _ = x[SRBDS_CTRL-146] + _ = x[SRSO_MSR_FIX-147] + _ = x[SRSO_NO-148] + _ = x[SRSO_USER_KERNEL_NO-149] + _ = x[SSE-150] + _ = x[SSE2-151] + _ = x[SSE3-152] + _ = x[SSE4-153] + _ = x[SSE42-154] + _ = x[SSE4A-155] + _ = x[SSSE3-156] + _ = x[STIBP-157] + _ = x[STIBP_ALWAYSON-158] + _ = x[STOSB_SHORT-159] + _ = x[SUCCOR-160] + _ = x[SVM-161] + _ = x[SVMDA-162] + _ = x[SVMFBASID-163] + _ = x[SVML-164] + _ = x[SVMNP-165] + _ = x[SVMPF-166] + _ = x[SVMPFT-167] + _ = x[SYSCALL-168] + _ = x[SYSEE-169] + _ = x[TBM-170] + _ = x[TDX_GUEST-171] + _ = x[TLB_FLUSH_NESTED-172] + _ = x[TME-173] + _ = x[TOPEXT-174] + _ = x[TSCRATEMSR-175] + _ = x[TSXLDTRK-176] + _ = x[VAES-177] + _ = x[VMCBCLEAN-178] + _ = x[VMPL-179] + _ = x[VMSA_REGPROT-180] + _ = x[VMX-181] + _ = x[VPCLMULQDQ-182] + _ = x[VTE-183] + _ = x[WAITPKG-184] + _ = x[WBNOINVD-185] + _ = x[WRMSRNS-186] + _ = x[X87-187] + _ = x[XGETBV1-188] + _ = x[XOP-189] + _ = x[XSAVE-190] + _ = x[XSAVEC-191] + _ = x[XSAVEOPT-192] + _ = x[XSAVES-193] + _ = x[AESARM-194] + _ = x[ARMCPUID-195] + _ = x[ASIMD-196] + _ = x[ASIMDDP-197] + _ = x[ASIMDHP-198] + _ = x[ASIMDRDM-199] + _ = x[ATOMICS-200] + _ = x[CRC32-201] + _ = x[DCPOP-202] + _ = x[EVTSTRM-203] + _ = x[FCMA-204] + _ = x[FP-205] + _ = x[FPHP-206] + _ = x[GPA-207] + _ = x[JSCVT-208] + _ = x[LRCPC-209] + _ = x[PMULL-210] + _ = x[SHA1-211] + _ = x[SHA2-212] + _ = x[SHA3-213] + _ = x[SHA512-214] + _ = x[SM3-215] + _ = x[SM4-216] + _ = x[SVE-217] + _ = x[lastID-218] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/libdns/libdns/README.md b/vendor/github.com/libdns/libdns/README.md index 661a072..b5f77b4 100644 --- a/vendor/github.com/libdns/libdns/README.md +++ b/vendor/github.com/libdns/libdns/README.md @@ -41,14 +41,18 @@ recs, err := provider.GetRecords(ctx, zone) // create records (AppendRecords is similar) newRecs, err := provider.SetRecords(ctx, zone, []libdns.Record{ - Type: "A", - Name: "sub", - Value: "1.2.3.4", + { + Type: "A", + Name: "sub", + Value: "1.2.3.4", + }, }) // delete records (this example uses provider-assigned ID) deletedRecs, err := provider.DeleteRecords(ctx, zone, []libdns.Record{ - ID: "foobar", + { + ID: "foobar", + }, }) // no matter which provider you use, the code stays the same! @@ -56,11 +60,11 @@ deletedRecs, err := provider.DeleteRecords(ctx, zone, []libdns.Record{ ``` -## Implementing new providers +## Implementing new provider packages -Providers are 100% written and maintained by the community! We all maintain just the packages for providers we use. +Provider packages are 100% written and maintained by the community! Collectively, we all maintain the packages for providers we individually use. -**[Instructions for adding new providers](https://github.com/libdns/libdns/wiki/Implementing-providers)** are on this repo's wiki. Please feel free to contribute. +**[Instructions for adding new libdns packages](https://github.com/libdns/libdns/wiki/Implementing-a-libdns-package)** are on this repo's wiki. Please feel free to contribute yours! ## Similar projects diff --git a/vendor/github.com/libdns/libdns/libdns.go b/vendor/github.com/libdns/libdns/libdns.go index 9a2bbcb..867575f 100644 --- a/vendor/github.com/libdns/libdns/libdns.go +++ b/vendor/github.com/libdns/libdns/libdns.go @@ -10,15 +10,18 @@ // that input records conform to this standard, while also ensuring that // output records do; adjustments to record names may need to be made before // or after provider API calls, for example, to maintain consistency with -// all other libdns provider implementations. Helper functions are available -// in this package to convert between relative and absolute names. +// all other libdns packages. Helper functions are available in this package +// to convert between relative and absolute names. // // Although zone names are a required input, libdns does not coerce any // particular representation of DNS zones; only records. Since zone name and // records are separate inputs in libdns interfaces, it is up to the caller // to pair a zone's name with its records in a way that works for them. // -// All interface implementations must be safe for concurrent/parallel use. +// All interface implementations must be safe for concurrent/parallel use, +// meaning 1) no data races, and 2) simultaneous method calls must result +// in either both their expected outcomes or an error. +// // For example, if AppendRecords() is called at the same time and two API // requests are made to the provider at the same time, the result of both // requests must be visible after they both complete; if the provider does @@ -32,6 +35,8 @@ package libdns import ( "context" + "fmt" + "strconv" "strings" "time" ) @@ -89,7 +94,23 @@ type RecordDeleter interface { DeleteRecords(ctx context.Context, zone string, recs []Record) ([]Record, error) } +// ZoneLister can list available DNS zones. +type ZoneLister interface { + // ListZones returns the list of available DNS zones for use by + // other libdns methods. + // + // Implementations must honor context cancellation and be safe for + // concurrent use. + ListZones(ctx context.Context) ([]Zone, error) +} + // Record is a generalized representation of a DNS record. +// +// The values of this struct should be free of zone-file-specific syntax, +// except if this struct's fields do not sufficiently represent all the +// fields of a certain record type; in that case, the remaining data for +// which there are not specific fields should be stored in the Value as +// it appears in the zone file. type Record struct { // provider-specific metadata ID string @@ -101,7 +122,76 @@ type Record struct { TTL time.Duration // type-dependent record fields - Priority int // used by MX, SRV, and URI records + Priority uint // HTTPS, MX, SRV, and URI records + Weight uint // SRV and URI records +} + +// Zone is a generalized representation of a DNS zone. +type Zone struct { + Name string +} + +// ToSRV parses the record into a SRV struct with fully-parsed, literal values. +// +// EXPERIMENTAL; subject to change or removal. +func (r Record) ToSRV() (SRV, error) { + if r.Type != "SRV" { + return SRV{}, fmt.Errorf("record type not SRV: %s", r.Type) + } + + fields := strings.Fields(r.Value) + if len(fields) != 2 { + return SRV{}, fmt.Errorf("malformed SRV value; expected: ' '") + } + + port, err := strconv.Atoi(fields[0]) + if err != nil { + return SRV{}, fmt.Errorf("invalid port %s: %v", fields[0], err) + } + if port < 0 { + return SRV{}, fmt.Errorf("port cannot be < 0: %d", port) + } + + parts := strings.SplitN(r.Name, ".", 3) + if len(parts) < 3 { + return SRV{}, fmt.Errorf("name %v does not contain enough fields; expected format: '_service._proto.name'", r.Name) + } + + return SRV{ + Service: strings.TrimPrefix(parts[0], "_"), + Proto: strings.TrimPrefix(parts[1], "_"), + Name: parts[2], + Priority: r.Priority, + Weight: r.Weight, + Port: uint(port), + Target: fields[1], + }, nil +} + +// SRV contains all the parsed data of an SRV record. +// +// EXPERIMENTAL; subject to change or removal. +type SRV struct { + Service string // no leading "_" + Proto string // no leading "_" + Name string + Priority uint + Weight uint + Port uint + Target string +} + +// ToRecord converts the parsed SRV data to a Record struct. +// +// EXPERIMENTAL; subject to change or removal. +func (s SRV) ToRecord() Record { + return Record{ + Type: "SRV", + Name: fmt.Sprintf("_%s._%s.%s", s.Service, s.Proto, s.Name), + Priority: s.Priority, + Weight: s.Weight, + Value: fmt.Sprintf("%d %s", s.Port, s.Target), + } } // RelativeName makes fqdn relative to zone. For example, for a FQDN of @@ -109,7 +199,13 @@ type Record struct { // // If fqdn cannot be expressed relative to zone, the input fqdn is returned. func RelativeName(fqdn, zone string) string { - return strings.TrimSuffix(strings.TrimSuffix(fqdn, zone), ".") + // liberally ignore trailing dots on both fqdn and zone, because + // the relative name won't have a trailing dot anyway; I assume + // this won't be problematic...? + // (initially implemented because Cloudflare returns "fully- + // qualified" domains in their records without a trailing dot, + // but the input zone typically has a trailing dot) + return strings.TrimSuffix(strings.TrimSuffix(strings.TrimSuffix(fqdn, "."), strings.TrimSuffix(zone, ".")), ".") } // AbsoluteName makes name into a fully-qualified domain name (FQDN) by diff --git a/vendor/github.com/mholt/acmez/acme/ari.go b/vendor/github.com/mholt/acmez/acme/ari.go deleted file mode 100644 index 3cf31ce..0000000 --- a/vendor/github.com/mholt/acmez/acme/ari.go +++ /dev/null @@ -1,205 +0,0 @@ -// Copyright 2020 Matthew Holt -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package acme - -import ( - "context" - "crypto" - "crypto/x509" - "crypto/x509/pkix" - "encoding/asn1" - "encoding/base64" - "fmt" - "io" - "math/big" - "net/http" - "time" - - "go.uber.org/zap" -) - -// RenewalInfo "is a new resource type introduced to ACME protocol. -// This new resource both allows clients to query the server for -// suggestions on when they should renew certificates, and allows -// clients to inform the server when they have completed renewal -// (or otherwise replaced the certificate to their satisfaction)." -// -// ACME Renewal Information (ARI): -// https://datatracker.ietf.org/doc/draft-ietf-acme-ari/ -// -// This is a DRAFT specification and the API is subject to change. -type RenewalInfo struct { - SuggestedWindow struct { - Start time.Time `json:"start"` - End time.Time `json:"end"` - } `json:"suggestedWindow"` - ExplanationURL string `json:"explanationURL"` - - // This field is not part of the specified structure, but is - // important for proper conformance to the specification, - // so the Retry-After response header will be read and this - // field will be populated for ACME client consideration. - // Polling again for renewal info should not occur before - // this time. - RetryAfter time.Time `json:"-"` -} - -// GetRenewalInfo returns the ACME Renewal Information (ARI) for the certificate represented by the -// "base64url-encoded [RFC4648] bytes of a DER-encoded CertID ASN.1 sequence [RFC6960]" without padding -// (call `CertIDSequence()` to get this value). It tacks on the Retry-After value if present. -func (c *Client) GetRenewalInfo(ctx context.Context, b64CertIDSeq string) (RenewalInfo, error) { - if err := c.provision(ctx); err != nil { - return RenewalInfo{}, err - } - - endpoint := c.dir.RenewalInfo + b64CertIDSeq - - var ari RenewalInfo - resp, err := c.httpReq(ctx, http.MethodGet, endpoint, nil, &ari) - if err != nil { - return RenewalInfo{}, err - } - - ra, err := retryAfterTime(resp) - if err != nil && c.Logger != nil { - c.Logger.Error("setting Retry-After value", zap.Error(err)) - } - ari.RetryAfter = ra - - return ari, nil -} - -// UpdateRenewalInfo notifies the ACME server that the certificate represented by b64CertIDSeq -// has been replaced. The b64CertIDSeq string can be obtained by calling `CertIDSequence()`. -func (c *Client) UpdateRenewalInfo(ctx context.Context, account Account, b64CertIDSeq string) error { - if err := c.provision(ctx); err != nil { - return err - } - - payload := struct { - CertID string `json:"certID"` - Replaced bool `json:"replaced"` - }{ - CertID: b64CertIDSeq, - Replaced: true, - } - - resp, err := c.httpPostJWS(ctx, account.PrivateKey, account.Location, c.dir.RenewalInfo, payload, nil) - if err != nil { - return err - } - if resp.StatusCode != http.StatusOK { - return fmt.Errorf("updating renewal status: HTTP %d", resp.StatusCode) - } - - return nil -} - -// CertIDSequence returns the "base64url-encoded [RFC4648] bytes of a DER-encoded CertID ASN.1 sequence [RFC6960]" -// without padding for the given certificate chain. It is used primarily for requests to OCSP and ARI. -// -// The certificate chain must contain at least two elements: an end-entity certificate first, followed by an issuer -// certificate second. Of the end-entity certificate, only the SerialNumber field is required; and of the issuer -// certificate, only the RawSubjectPublicKeyInfo and RawSubject fields are required. If the issuer certificate is -// not provided, then it will be downloaded if the end-entity certificate contains the IssuingCertificateURL. -// -// As the return value may be used often during a certificate's lifetime, and in bulk with potentially tens of -// thousands of other certificates, it may be preferable to store or cache this value so that ASN.1 documents do -// not need to be repeatedly decoded and re-encoded. -func CertIDSequence(_ context.Context, certChain []*x509.Certificate, hash crypto.Hash, client *http.Client) (string, error) { - endEntityCert := certChain[0] - - // if no chain was provided, we'll need to download the issuer cert - if len(certChain) == 1 { - if len(endEntityCert.IssuingCertificateURL) == 0 { - return "", fmt.Errorf("no URL to issuing certificate") - } - - if client == nil { - client = http.DefaultClient - } - resp, err := client.Get(endEntityCert.IssuingCertificateURL[0]) - if err != nil { - return "", fmt.Errorf("getting issuer certificate: %v", err) - } - defer resp.Body.Close() - - issuerBytes, err := io.ReadAll(io.LimitReader(resp.Body, 1024*1024)) - if err != nil { - return "", fmt.Errorf("reading issuer certificate: %v", err) - } - - issuerCert, err := x509.ParseCertificate(issuerBytes) - if err != nil { - return "", fmt.Errorf("parsing issuer certificate: %v", err) - } - - certChain = append(certChain, issuerCert) - } - - issuerCert := certChain[1] - - hashAlg, ok := hashOIDs[hash] - if !ok { - return "", x509.ErrUnsupportedAlgorithm - } - if !hash.Available() { - return "", x509.ErrUnsupportedAlgorithm - } - h := hash.New() - - var publicKeyInfo struct { - Algorithm pkix.AlgorithmIdentifier - PublicKey asn1.BitString - } - if _, err := asn1.Unmarshal(issuerCert.RawSubjectPublicKeyInfo, &publicKeyInfo); err != nil { - return "", err - } - - h.Write(publicKeyInfo.PublicKey.RightAlign()) - issuerKeyHash := h.Sum(nil) - - h.Reset() - h.Write(issuerCert.RawSubject) - issuerNameHash := h.Sum(nil) - - val, err := asn1.Marshal(certID{ - HashAlgorithm: pkix.AlgorithmIdentifier{ - Algorithm: hashAlg, - }, - NameHash: issuerNameHash, - IssuerKeyHash: issuerKeyHash, - SerialNumber: endEntityCert.SerialNumber, - }) - if err != nil { - return "", err - } - - return base64.URLEncoding.WithPadding(base64.NoPadding).EncodeToString(val), nil -} - -type certID struct { - HashAlgorithm pkix.AlgorithmIdentifier - NameHash []byte - IssuerKeyHash []byte - SerialNumber *big.Int -} - -var hashOIDs = map[crypto.Hash]asn1.ObjectIdentifier{ - crypto.SHA1: asn1.ObjectIdentifier([]int{1, 3, 14, 3, 2, 26}), - crypto.SHA256: asn1.ObjectIdentifier([]int{2, 16, 840, 1, 101, 3, 4, 2, 1}), - crypto.SHA384: asn1.ObjectIdentifier([]int{2, 16, 840, 1, 101, 3, 4, 2, 2}), - crypto.SHA512: asn1.ObjectIdentifier([]int{2, 16, 840, 1, 101, 3, 4, 2, 3}), -} diff --git a/vendor/github.com/mholt/acmez/csr.go b/vendor/github.com/mholt/acmez/csr.go deleted file mode 100644 index c469b07..0000000 --- a/vendor/github.com/mholt/acmez/csr.go +++ /dev/null @@ -1,149 +0,0 @@ -// Copyright 2020 Matthew Holt -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package acmez - -import ( - "crypto/x509" - "encoding/asn1" - "errors" - - "github.com/mholt/acmez/acme" - "golang.org/x/crypto/cryptobyte" - cryptobyte_asn1 "golang.org/x/crypto/cryptobyte/asn1" -) - -var ( - oidExtensionSubjectAltName = []int{2, 5, 29, 17} - oidPermanentIdentifier = []int{1, 3, 6, 1, 5, 5, 7, 8, 3} - oidHardwareModuleName = []int{1, 3, 6, 1, 5, 5, 7, 8, 4} -) - -// RFC 5280 - https://datatracker.ietf.org/doc/html/rfc5280#section-4.2.1.6 -// -// OtherName ::= SEQUENCE { -// type-id OBJECT IDENTIFIER, -// value [0] EXPLICIT ANY DEFINED BY type-id } -type otherName struct { - TypeID asn1.ObjectIdentifier - Value asn1.RawValue -} - -// permanentIdentifier is defined in RFC 4043 as an optional feature that can be -// used by a CA to indicate that two or more certificates relate to the same -// entity. -// -// The OID defined for this SAN is "1.3.6.1.5.5.7.8.3". -// -// See https://www.rfc-editor.org/rfc/rfc4043 -// -// PermanentIdentifier ::= SEQUENCE { -// identifierValue UTF8String OPTIONAL, -// assigner OBJECT IDENTIFIER OPTIONAL -// } -type permanentIdentifier struct { - IdentifierValue string `asn1:"utf8,optional"` - Assigner asn1.ObjectIdentifier `asn1:"optional"` -} - -// hardwareModuleName is defined in RFC 4108 as an optional feature that can be -// used to identify a hardware module. -// -// The OID defined for this SAN is "1.3.6.1.5.5.7.8.4". -// -// See https://www.rfc-editor.org/rfc/rfc4108#section-5 -// -// HardwareModuleName ::= SEQUENCE { -// hwType OBJECT IDENTIFIER, -// hwSerialNum OCTET STRING -// } -type hardwareModuleName struct { - Type asn1.ObjectIdentifier - SerialNumber []byte `asn1:"tag:4"` -} - -func forEachSAN(der cryptobyte.String, callback func(tag int, data []byte) error) error { - if !der.ReadASN1(&der, cryptobyte_asn1.SEQUENCE) { - return errors.New("invalid subject alternative name extension") - } - for !der.Empty() { - var san cryptobyte.String - var tag cryptobyte_asn1.Tag - if !der.ReadAnyASN1Element(&san, &tag) { - return errors.New("invalid subject alternative name extension") - } - if err := callback(int(tag^0x80), san); err != nil { - return err - } - } - - return nil -} - -// createIdentifiersUsingCSR extracts the list of ACME identifiers from the -// given Certificate Signing Request. -func createIdentifiersUsingCSR(csr *x509.CertificateRequest) ([]acme.Identifier, error) { - var ids []acme.Identifier - for _, name := range csr.DNSNames { - ids = append(ids, acme.Identifier{ - Type: "dns", // RFC 8555 Β§9.7.7 - Value: name, - }) - } - for _, ip := range csr.IPAddresses { - ids = append(ids, acme.Identifier{ - Type: "ip", // RFC 8738 - Value: ip.String(), - }) - } - - // Extract permanent identifiers and hardware module values. - // This block will ignore errors. - for _, ext := range csr.Extensions { - if ext.Id.Equal(oidExtensionSubjectAltName) { - err := forEachSAN(ext.Value, func(tag int, data []byte) error { - var on otherName - if rest, err := asn1.UnmarshalWithParams(data, &on, "tag:0"); err != nil || len(rest) > 0 { - return nil - } - - switch { - case on.TypeID.Equal(oidPermanentIdentifier): - var pi permanentIdentifier - if _, err := asn1.Unmarshal(on.Value.Bytes, &pi); err == nil { - ids = append(ids, acme.Identifier{ - Type: "permanent-identifier", // draft-acme-device-attest-00 Β§3 - Value: pi.IdentifierValue, - }) - } - case on.TypeID.Equal(oidHardwareModuleName): - var hmn hardwareModuleName - if _, err := asn1.Unmarshal(on.Value.Bytes, &hmn); err == nil { - ids = append(ids, acme.Identifier{ - Type: "hardware-module", // draft-acme-device-attest-00 Β§4 - Value: string(hmn.SerialNumber), - }) - } - } - return nil - }) - if err != nil { - return nil, err - } - break - } - } - - return ids, nil -} diff --git a/vendor/github.com/mholt/acmez/.gitignore b/vendor/github.com/mholt/acmez/v2/.gitignore similarity index 100% rename from vendor/github.com/mholt/acmez/.gitignore rename to vendor/github.com/mholt/acmez/v2/.gitignore diff --git a/vendor/github.com/mholt/acmez/LICENSE b/vendor/github.com/mholt/acmez/v2/LICENSE similarity index 100% rename from vendor/github.com/mholt/acmez/LICENSE rename to vendor/github.com/mholt/acmez/v2/LICENSE diff --git a/vendor/github.com/mholt/acmez/README.md b/vendor/github.com/mholt/acmez/v2/README.md similarity index 76% rename from vendor/github.com/mholt/acmez/README.md rename to vendor/github.com/mholt/acmez/v2/README.md index 0d88b28..38006c8 100644 --- a/vendor/github.com/mholt/acmez/README.md +++ b/vendor/github.com/mholt/acmez/v2/README.md @@ -1,11 +1,11 @@ acmez - ACME client library for Go ================================== -[![godoc](https://pkg.go.dev/badge/github.com/mholt/acmez)](https://pkg.go.dev/github.com/mholt/acmez) +[![godoc](https://pkg.go.dev/badge/github.com/mholt/acmez/v2)](https://pkg.go.dev/github.com/mholt/acmez/v2) -ACMEz ("ack-measy" or "acme-zee", whichever you prefer) is a fully-compliant [RFC 8555](https://tools.ietf.org/html/rfc8555) (ACME) implementation in pure Go. It is lightweight, has an elegant Go API, and its retry logic is highly robust against external errors. ACMEz is suitable for large-scale enterprise deployments. +ACMEz ("ack-measy" or "acme-zee", whichever you prefer) is a fully-compliant [RFC 8555](https://tools.ietf.org/html/rfc8555) (ACME) implementation in pure Go. It is lightweight, has an elegant Go API, and its retry logic is highly robust against external errors. ACMEz is suitable for large-scale enterprise deployments. It also supports common IETF-standardized ACME extensions. -**NOTE:** This module is for _getting_ certificates, not _managing_ certificates. Most users probably want certificate _management_ (keeping certificates renewed) rather than to interface directly with ACME. Developers who want to use certificates in their long-running Go programs should use [CertMagic](https://github.com/caddyserver/certmagic) instead; or, if their program is not written in Go, [Caddy](https://caddyserver.com/) can be used to manage certificates (even without running an HTTP or TLS server). +**NOTE:** This module is for _getting_ certificates, not _managing_ certificates. Most users probably want certificate _management_ (keeping certificates renewed) rather than to interface directly with ACME. Developers who want to use certificates in their long-running Go programs should use [CertMagic](https://github.com/caddyserver/certmagic) instead; or, if their program is not written in Go, [Caddy](https://caddyserver.com/) can be used to manage certificates (even without running an HTTP or TLS server if needed). This module has two primary packages: @@ -26,12 +26,21 @@ In other words, the `acmez` package is **porcelain** while the `acme` package is - Context cancellation (suitable for high-frequency config changes or reloads) - Highly flexible and customizable - External Account Binding (EAB) support -- Tested with multiple ACME CAs (more than just Let's Encrypt) -- Supports niche aspects of RFC 8555 (such as alt cert chains and account key rollover) +- Tested with numerous ACME CAs (more than just Let's Encrypt) +- Implements niche aspects of RFC 8555 (such as alt cert chains and account key rollover) - Efficient solving of large SAN lists (e.g. for slow DNS record propagation) - Utility functions for solving challenges - - [Device attestation challenges](https://datatracker.ietf.org/doc/draft-acme-device-attest/) - - RFC 8737 (tls-alpn-01 challenge) + - Device attestation challenges ([draft-acme-device-attest-02](https://datatracker.ietf.org/doc/draft-acme-device-attest/)) + - [RFC 8737](https://www.rfc-editor.org/rfc/rfc8737.html) (tls-alpn-01 challenge) + - [RFC 8823](https://www.rfc-editor.org/rfc/rfc8823.html) (email-reply-00 challenge; S/MIME) +- ACME Renewal Information (ARI) support ([draft-ietf-acme-ari-03](https://datatracker.ietf.org/doc/draft-ietf-acme-ari/)) + + +## Install + +``` +go get github.com/mholt/acmez/v2 +``` ## Examples @@ -41,14 +50,16 @@ See the [`examples` folder](https://github.com/mholt/acmez/tree/master/examples) ## Challenge solvers -The `acmez` package is "bring-your-own-solver." It provides helper utilities for http-01, dns-01, and tls-alpn-01 challenges, but does not actually solve them for you. You must write or use an implementation of [`acmez.Solver`](https://pkg.go.dev/github.com/mholt/acmez#Solver) in order to get certificates. How this is done depends on your environment/situation. +The `acmez` package is "bring-your-own-solver." It provides helper utilities for http-01, dns-01, and tls-alpn-01 challenges, but does not actually solve them for you. You must write or use an implementation of [`acmez.Solver`](https://pkg.go.dev/github.com/mholt/acmez/v2#Solver) in order to get certificates. How this is done depends on your environment/situation. However, you can find [a general-purpose dns-01 solver in CertMagic](https://pkg.go.dev/github.com/caddyserver/certmagic#DNS01Solver), which uses [libdns](https://github.com/libdns) packages to integrate with numerous DNS providers. You can use it like this: ```go // minimal example using Cloudflare solver := &certmagic.DNS01Solver{ - DNSProvider: &cloudflare.Provider{APIToken: "topsecret"}, + DNSManager: certmagic.DNSManager{ + DNSProvider: &cloudflare.Provider{APIToken: "topsecret"}, + }, } client := acmez.Client{ ChallengeSolvers: map[string]acmez.Solver{ @@ -58,7 +69,7 @@ client := acmez.Client{ } ``` -If you're implementing a tls-alpn-01 solver, the `acmez` package can help. It has the constant [`ACMETLS1Protocol`](https://pkg.go.dev/github.com/mholt/acmez#pkg-constants) which you can use to identify challenge handshakes by inspecting the ClientHello's ALPN extension. Simply complete the handshake using a certificate from the [`acmez.TLSALPN01ChallengeCert()`](https://pkg.go.dev/github.com/mholt/acmez#TLSALPN01ChallengeCert) function to solve the challenge. +If you're implementing a tls-alpn-01 solver, the `acmez` package can help. It has the constant [`ACMETLS1Protocol`](https://pkg.go.dev/github.com/mholt/acmez/v2#pkg-constants) which you can use to identify challenge handshakes by inspecting the ClientHello's ALPN extension. Simply complete the handshake using a certificate from the [`acmez.TLSALPN01ChallengeCert()`](https://pkg.go.dev/github.com/mholt/acmez/v2#TLSALPN01ChallengeCert) function to solve the challenge. @@ -74,6 +85,9 @@ A few years later, Caddy's novel auto-HTTPS logic was extracted into a library c Soon thereafter, the lego project shifted maintainership and the goals and vision of the project diverged from those of Caddy's use case of managing tens of thousands of certificates per instance. Eventually, [the original Caddy author announced work on a new ACME client library in Go](https://github.com/caddyserver/certmagic/issues/71) that satisfied Caddy's harsh requirements for large-scale enterprise deployments, lean builds, and simple API. This work exceeded expectations and finally came to fruition in 2020 as ACMEz. It is much more lightweight with zero core dependencies, has a simple and elegant code base, and is thoroughly documented and easy to build upon. +> [!NOTE] +> This is not an official repository of the [Caddy Web Server](https://github.com/caddyserver) organization. + --- (c) 2020 Matthew Holt diff --git a/vendor/github.com/mholt/acmez/THIRD-PARTY b/vendor/github.com/mholt/acmez/v2/THIRD-PARTY similarity index 100% rename from vendor/github.com/mholt/acmez/THIRD-PARTY rename to vendor/github.com/mholt/acmez/v2/THIRD-PARTY diff --git a/vendor/github.com/mholt/acmez/acme/account.go b/vendor/github.com/mholt/acmez/v2/acme/account.go similarity index 96% rename from vendor/github.com/mholt/acmez/acme/account.go rename to vendor/github.com/mholt/acmez/v2/acme/account.go index b103eb2..b7a72e0 100644 --- a/vendor/github.com/mholt/acmez/acme/account.go +++ b/vendor/github.com/mholt/acmez/v2/acme/account.go @@ -25,12 +25,19 @@ import ( // Account represents a set of metadata associated with an account // as defined by the ACME spec Β§7.1.2: // https://tools.ietf.org/html/rfc8555#section-7.1.2 +// +// Users of this Go package should generally set Contact, +// TermsOfServiceAgreed, ExternalAccountBinding if relevant, +// and PrivateKey fields when creating a new account. Other +// fields are populated by the ACME server. type Account struct { // status (required, string): The status of this account. Possible // values are "valid", "deactivated", and "revoked". The value // "deactivated" should be used to indicate client-initiated // deactivation whereas "revoked" should be used to indicate server- // initiated deactivation. See Section 7.1.6. + // + // The client need NOT set this field when creating a new account. Status string `json:"status"` // contact (optional, array of string): An array of URLs that the @@ -70,6 +77,8 @@ type Account struct { // The private key to the account. Because it is secret, it is // not serialized as JSON and must be stored separately (usually // a PEM-encoded file). + // + // This is a required field when creating a new account. PrivateKey crypto.Signer `json:"-"` } diff --git a/vendor/github.com/mholt/acmez/v2/acme/ari.go b/vendor/github.com/mholt/acmez/v2/acme/ari.go new file mode 100644 index 0000000..ae802ce --- /dev/null +++ b/vendor/github.com/mholt/acmez/v2/acme/ari.go @@ -0,0 +1,215 @@ +// Copyright 2020 Matthew Holt +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package acme + +import ( + "context" + "crypto/x509" + "encoding/asn1" + "encoding/base64" + "fmt" + "math/rand" + "net/http" + "time" + + "go.uber.org/zap" +) + +// ErrUnsupported is used to indicate lack of support by an ACME server. +var ErrUnsupported = fmt.Errorf("unsupported by ACME server") + +// RenewalInfo "is a new resource type introduced to ACME protocol. +// This new resource allows clients to query the server for suggestions +// on when they should renew certificates." +// +// ACME Renewal Information (ARI): +// https://www.ietf.org/archive/id/draft-ietf-acme-ari-03.html Β§4.2 +// +// This is a DRAFT specification and the API is subject to change. +type RenewalInfo struct { + // suggestedWindow (object, required): A JSON object with two keys, + // "start" and "end", whose values are timestamps, encoded in the + // format specified in [RFC3339], which bound the window of time + // in which the CA recommends renewing the certificate. + SuggestedWindow struct { + Start time.Time `json:"start"` + End time.Time `json:"end"` + } `json:"suggestedWindow"` + + // explanationURL (string, optional): A URL pointing to a page which may + // explain why the suggested renewal window is what it is. For example, + // it may be a page explaining the CA's dynamic load-balancing strategy, + // or a page documenting which certificates are affected by a mass + // revocation event. Conforming clients SHOULD provide this URL to their + // operator, if present. + ExplanationURL string `json:"explanationURL,omitempty"` + + // The following fields are not part of the RenewalInfo object in + // the ARI spec, but are important for proper conformance to the + // spec, and are practically useful for implementators: + + // "The unique identifer is constructed by concatenating the + // base64url-encoding Section 5 of [RFC4648] of the bytes of the + // keyIdentifier field of certificate's Authority Key Identifier + // (AKI) Section 4.2.1.1 of [RFC5280] extension, a literal period, + // and the base64url-encoding of the bytes of the DER encoding of + // the certificate's Serial Number (without the tag and length bytes). + // All trailing "=" characters MUST be stripped from both parts of + // the unique identifier." + // + // We generate this once and store it so the certificate does not + // need to be stored in its decoded form or decoded multiple times. + UniqueIdentifier string `json:"_uniqueIdentifier,omitempty"` + + // The next poll time based on the Retry-After response header for + // the benefit of the caller for scheduling renewals. If specified, + // GetRenewalInfo should not be called again before this time. + // + // "The server SHOULD include a Retry-After header indicating the polling + // interval that the ACME server recommends. Conforming clients SHOULD + // query the renewalInfo URL again after the Retry-After period has passed, + // as the server may provide a different suggestedWindow." + RetryAfter *time.Time `json:"_retryAfter,omitempty"` + + // The client should "select a uniform random time within the suggested + // window." We select this time when getting the renewal info from the + // server, though this behavior is ambiguous: + // https://github.com/aarongable/draft-acme-ari/issues/70 + SelectedTime time.Time `json:"_selectedTime"` +} + +// NeedsRefresh returns true if the renewal info needs updating. +// It returns false otherwise, or if the renewal info is empty +// (window is missing), assuming that there is no ARI available. +func (ari RenewalInfo) NeedsRefresh() bool { + if !ari.HasWindow() { + return false + } + if ari.RetryAfter == nil { + // TODO: this seems like an unlikely condition, but we could be smart in its absence, like based on the window... play it safe for now though and just always be updating I guess + return true + } + return time.Now().After(*ari.RetryAfter) +} + +// HasWindow returns true if this ARI has a window. If not, +// it's likely because ARI is not supported or available. +func (ari RenewalInfo) HasWindow() bool { + return !ari.SuggestedWindow.Start.IsZero() && !ari.SuggestedWindow.End.IsZero() +} + +// SameWindow returns true if this ARI has the same window as the ARI passed in. +// Note that suggested windows can move in either direction, expand, or contract, +// so this method compares both start and end values for exact equality. +func (ari RenewalInfo) SameWindow(other RenewalInfo) bool { + return ari.SuggestedWindow.Start.Equal(other.SuggestedWindow.Start) && + ari.SuggestedWindow.End.Equal(other.SuggestedWindow.End) +} + +// GetRenewalInfo returns the ACME Renewal Information (ARI) for the certificate. +// It fills in the Retry-After value, if present, onto the returned struct so +// the caller can poll appropriately. If the ACME server does not support ARI, +// an error wrapping ErrUnsupported will be returned. +func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) (RenewalInfo, error) { + if err := c.provision(ctx); err != nil { + return RenewalInfo{}, err + } + if c.dir.RenewalInfo == "" { + return RenewalInfo{}, fmt.Errorf("%w: directory does not indicate ARI support (missing renewalInfo)", ErrUnsupported) + } + + if c.Logger != nil { + c.Logger.Debug("getting renewal info", zap.Strings("names", leafCert.DNSNames)) + } + + certID, err := ARIUniqueIdentifier(leafCert) + if err != nil { + return RenewalInfo{}, err + } + + var ari RenewalInfo + resp, err := c.httpReq(ctx, http.MethodGet, c.ariEndpoint(certID), nil, &ari) + if err != nil { + return RenewalInfo{}, err + } + ari.UniqueIdentifier = certID + + // "The server SHOULD include a Retry-After header indicating the polling + // interval that the ACME server recommends." draft-ietf-acme-ari-03 Β§4.2 + raTime, err := retryAfterTime(resp) + if err != nil && c.Logger != nil { + c.Logger.Error("invalid Retry-After value", zap.Error(err)) + } + if !raTime.IsZero() { + ari.RetryAfter = &raTime + } + + // "Conforming clients MUST attempt renewal at a time of their choosing + // based on the suggested renewal window. ... Select a uniform random + // time within the suggested window." Β§4.2 + // TODO: It's unclear whether this time should be selected once + // or every time the client wakes to check ARI (see step 5 of the + // recommended algorithm); I've inquired here: + // https://github.com/aarongable/draft-acme-ari/issues/70 + // We add 1 to the start time since we are dealing in seconds for + // simplicity, but the server may provide sub-second timestamps. + start, end := ari.SuggestedWindow.Start.Unix()+1, ari.SuggestedWindow.End.Unix() + ari.SelectedTime = time.Unix(rand.Int63n(end-start)+start, 0).UTC() + + if c.Logger != nil { + c.Logger.Info("got renewal info", + zap.Strings("names", leafCert.DNSNames), + zap.Time("window_start", ari.SuggestedWindow.Start), + zap.Time("window_end", ari.SuggestedWindow.End), + zap.Time("selected_time", ari.SelectedTime), + zap.Timep("recheck_after", ari.RetryAfter), + zap.String("explanation_url", ari.ExplanationURL), + ) + } + + return ari, nil +} + +// ariEndpoint returns the ARI endpoint URI for certificate with the +// given ARI certificate ID, according to the configured CA's directory. +func (c *Client) ariEndpoint(ariCertID string) string { + if c.dir.RenewalInfo == "" || ariCertID == "" { + return "" + } + return c.dir.RenewalInfo + "/" + ariCertID +} + +// ARIUniqueIdentifier returns the unique identifier for the certificate +// as used by ACME Renewal Information. +// EXPERIMENTAL: ARI is a draft RFC spec: draft-ietf-acme-ari-03 +func ARIUniqueIdentifier(leafCert *x509.Certificate) (string, error) { + if leafCert.SerialNumber == nil { + return "", fmt.Errorf("no serial number") + } + // TODO: Let's Encrypt's reference implementation switched from using + // SerialNumber.Bytes() to this method, which seems less efficient, + // but yields the same results !? I asked about it here: + // https://github.com/letsencrypt/website/issues/1670 + serialDER, err := asn1.Marshal(leafCert.SerialNumber) + if err != nil { + return "", err + } + if len(serialDER) < 3 { + return "", fmt.Errorf("serial number DER too short: %d (%x)", len(serialDER), serialDER) + } + // skip tag and length; extract only integer bytes + return base64.RawURLEncoding.EncodeToString(leafCert.AuthorityKeyId) + "." + + base64.RawURLEncoding.EncodeToString(serialDER[2:]), nil // skip tag and length, just use integer part +} diff --git a/vendor/github.com/mholt/acmez/acme/authorization.go b/vendor/github.com/mholt/acmez/v2/acme/authorization.go similarity index 100% rename from vendor/github.com/mholt/acmez/acme/authorization.go rename to vendor/github.com/mholt/acmez/v2/acme/authorization.go diff --git a/vendor/github.com/mholt/acmez/acme/certificate.go b/vendor/github.com/mholt/acmez/v2/acme/certificate.go similarity index 85% rename from vendor/github.com/mholt/acmez/acme/certificate.go rename to vendor/github.com/mholt/acmez/v2/acme/certificate.go index 827e9a9..29c624a 100644 --- a/vendor/github.com/mholt/acmez/acme/certificate.go +++ b/vendor/github.com/mholt/acmez/v2/acme/certificate.go @@ -20,8 +20,11 @@ import ( "crypto" "crypto/x509" "encoding/base64" + "encoding/pem" "fmt" "net/http" + + "go.uber.org/zap" ) // Certificate represents a certificate chain, which we usually refer @@ -47,6 +50,10 @@ type Certificate struct { // ACME spec, but it can be useful to save this along with // the certificate for restoring a lost ACME client config. CA string `json:"ca,omitempty"` + + // When to renew the certificate, and related info, as + // prescribed by ARI. + RenewalInfo *RenewalInfo `json:"renewal_info,omitempty"` } // GetCertificateChain downloads all available certificate chains originating from @@ -79,17 +86,39 @@ func (c *Client) GetCertificateChain(ctx context.Context, account Account, certU } contentType := parseMediaType(resp) + // extract the chain depending on Content-Type + var chainPEM []byte switch contentType { case "application/pem-certificate-chain": - chains = append(chains, Certificate{ - URL: certURL, - ChainPEM: buf.Bytes(), - CA: c.Directory, - }) + chainPEM = buf.Bytes() default: return resp, fmt.Errorf("unrecognized Content-Type from server: %s", contentType) } + certChain := Certificate{ + URL: certURL, + ChainPEM: chainPEM, + CA: c.Directory, + } + + // attach renewal information, if applicable (draft-ietf-acme-ari-03) + if c.dir.RenewalInfo != "" { + certDERBlock, _ := pem.Decode(chainPEM) + if certDERBlock != nil && certDERBlock.Type == "CERTIFICATE" { + leafCert, err := x509.ParseCertificate(certDERBlock.Bytes) + if err != nil { + return resp, fmt.Errorf("invalid first PEM block of chain: %v", err) + } + ari, err := c.GetRenewalInfo(ctx, leafCert) + if err != nil && c.Logger != nil { + c.Logger.Error("failed getting renewal information", zap.Error(err)) + } + certChain.RenewalInfo = &ari + } + } + + chains = append(chains, certChain) + // "For formats that can only express a single certificate, the server SHOULD // provide one or more "Link: rel="up"" header fields pointing to an // issuer or issuers so that ACME clients can build a certificate chain diff --git a/vendor/github.com/mholt/acmez/acme/challenge.go b/vendor/github.com/mholt/acmez/v2/acme/challenge.go similarity index 80% rename from vendor/github.com/mholt/acmez/acme/challenge.go rename to vendor/github.com/mholt/acmez/v2/acme/challenge.go index 05b3955..19c9f51 100644 --- a/vendor/github.com/mholt/acmez/acme/challenge.go +++ b/vendor/github.com/mholt/acmez/v2/acme/challenge.go @@ -18,6 +18,8 @@ import ( "context" "crypto/sha256" "encoding/base64" + "fmt" + "strings" ) // Challenge holds information about an ACME challenge. @@ -79,6 +81,10 @@ type Challenge struct { // information to solve the DNS-01 challenge. Identifier Identifier `json:"identifier,omitempty"` + // From header of email must match with the "from" field of challenge object + // as described in RFC8823 Β§3.1 - 2, added on 3-6.3.1 + From string `json:"from,omitempty"` + // Payload contains a JSON-marshallable value that will be sent to the CA // when responding to challenges. If not set, an empty JSON body "{}" will // be included in the POST request. This field is applicable when responding @@ -120,6 +126,29 @@ func (c Challenge) DNS01KeyAuthorization() string { return base64.RawURLEncoding.EncodeToString(h[:]) } +// MailReply00KeyAuthorization encodes a key authorization value +// to be sent back to the reply-to address of the ACME challenge email. +// The subject of that mail contains token-part1, which must be combined +// with token-part2, which was received as part of the JSON challenge as +// described in RFC8823 Β§3.1. +func (c Challenge) MailReply00KeyAuthorization(mailSubject string) (string, error) { + // if subject given has "ACME:" header, strip it before calculating the key authorization + mailSubject = strings.TrimPrefix(mailSubject, "ACME: ") + tokenPart1, err := base64.RawURLEncoding.DecodeString(mailSubject) + if err != nil { + return "", fmt.Errorf("failed decoding token-part1: %w", err) + } + tokenPart2, err := base64.RawURLEncoding.DecodeString(c.Token) + if err != nil { + return "", fmt.Errorf("failed decoding token-part2: %w", err) + } + fullToken := append(tokenPart1, tokenPart2...) + encodedFullToken := base64.RawURLEncoding.EncodeToString(fullToken) + mailKeyAuth := strings.Replace(c.KeyAuthorization, c.Token, encodedFullToken, 1) + h := sha256.Sum256([]byte(mailKeyAuth)) + return base64.RawURLEncoding.EncodeToString(h[:]), nil +} + // InitiateChallenge "indicates to the server that it is ready for the challenge // validation by sending an empty JSON body ('{}') carried in a POST request to // the challenge URL (not the authorization URL)." Β§7.5.1 @@ -140,4 +169,5 @@ const ( ChallengeTypeDNS01 = "dns-01" // RFC 8555 Β§8.4 ChallengeTypeTLSALPN01 = "tls-alpn-01" // RFC 8737 Β§3 ChallengeTypeDeviceAttest01 = "device-attest-01" // draft-acme-device-attest-00 Β§5 + ChallengeTypeEmailReply00 = "email-reply-00" // RFC 8823 Β§5.2 ) diff --git a/vendor/github.com/mholt/acmez/acme/client.go b/vendor/github.com/mholt/acmez/v2/acme/client.go similarity index 100% rename from vendor/github.com/mholt/acmez/acme/client.go rename to vendor/github.com/mholt/acmez/v2/acme/client.go diff --git a/vendor/github.com/mholt/acmez/acme/http.go b/vendor/github.com/mholt/acmez/v2/acme/http.go similarity index 98% rename from vendor/github.com/mholt/acmez/acme/http.go rename to vendor/github.com/mholt/acmez/v2/acme/http.go index 02f0374..3d12175 100644 --- a/vendor/github.com/mholt/acmez/acme/http.go +++ b/vendor/github.com/mholt/acmez/v2/acme/http.go @@ -207,6 +207,11 @@ func (c *Client) httpReq(ctx context.Context, method, endpoint string, joseJSONP err = problem continue } + if problem.Status == 0 { + // for some reason, some servers omit the status, for example: + // https://caddy.community/t/acme-account-is-not-regenerated-when-acme-server-gets-reinstalled/22627 + problem.Status = resp.StatusCode + } return resp, problem } return resp, fmt.Errorf("HTTP %d: %s", resp.StatusCode, buf.String()) diff --git a/vendor/github.com/mholt/acmez/acme/jws.go b/vendor/github.com/mholt/acmez/v2/acme/jws.go similarity index 93% rename from vendor/github.com/mholt/acmez/acme/jws.go rename to vendor/github.com/mholt/acmez/v2/acme/jws.go index c992acc..955cee5 100644 --- a/vendor/github.com/mholt/acmez/acme/jws.go +++ b/vendor/github.com/mholt/acmez/v2/acme/jws.go @@ -46,16 +46,10 @@ type keyID string // See jwsEncodeJSON for details. const noKeyID = keyID("") -// // noPayload indicates jwsEncodeJSON will encode zero-length octet string -// // in a JWS request. This is called POST-as-GET in RFC 8555 and is used to make -// // authenticated GET requests via POSTing with an empty payload. -// // See https://tools.ietf.org/html/rfc8555#section-6.3 for more details. -// const noPayload = "" - // jwsEncodeEAB creates a JWS payload for External Account Binding according to RFC 8555 Β§7.3.4. func jwsEncodeEAB(accountKey crypto.PublicKey, hmacKey []byte, kid keyID, url string) ([]byte, error) { // Β§7.3.4: "The 'alg' field MUST indicate a MAC-based algorithm" - alg, sha := "HS256", crypto.SHA256 + const alg = "HS256" // Β§7.3.4: "The 'nonce' field MUST NOT be present" phead, err := jwsHead(alg, "", url, kid, nil) @@ -75,7 +69,7 @@ func jwsEncodeEAB(accountKey crypto.PublicKey, hmacKey []byte, kid keyID, url st h.Write(payloadToSign) sig := h.Sum(nil) - return jwsFinal(sha, sig, phead, payload) + return jwsFinal(sig, phead, payload) } // jwsEncodeJSON signs claimset using provided key and a nonce. @@ -119,7 +113,7 @@ func jwsEncodeJSON(claimset any, key crypto.Signer, kid keyID, nonce, url string return nil, err } - return jwsFinal(sha, sig, phead, payload) + return jwsFinal(sig, phead, payload) } // jwkEncode encodes public part of an RSA or ECDSA key into a JWK. @@ -186,7 +180,7 @@ func jwsHead(alg, nonce, url string, kid keyID, key crypto.Signer) (string, erro } // jwsFinal constructs the final JWS object. -func jwsFinal(sha crypto.Hash, sig []byte, phead, payload string) ([]byte, error) { +func jwsFinal(sig []byte, phead, payload string) ([]byte, error) { enc := struct { Protected string `json:"protected"` Payload string `json:"payload"` diff --git a/vendor/github.com/mholt/acmez/acme/order.go b/vendor/github.com/mholt/acmez/v2/acme/order.go similarity index 91% rename from vendor/github.com/mholt/acmez/acme/order.go rename to vendor/github.com/mholt/acmez/v2/acme/order.go index 245a39b..e51ee33 100644 --- a/vendor/github.com/mholt/acmez/acme/order.go +++ b/vendor/github.com/mholt/acmez/v2/acme/order.go @@ -20,6 +20,8 @@ import ( "errors" "fmt" "time" + + "go.uber.org/zap" ) // Order is an object that "represents a client's request for a certificate @@ -32,7 +34,7 @@ type Order struct { // status (required, string): The status of this order. Possible // values are "pending", "ready", "processing", "valid", and // "invalid". See Section 7.1.6. - Status string `json:"status"` + Status string `json:"status,omitempty"` // expires (optional, string): The timestamp after which the server // will consider this order invalid, encoded in the format specified @@ -44,6 +46,16 @@ type Order struct { // objects that the order pertains to. Identifiers []Identifier `json:"identifiers"` + // replaces (string, optional): A string uniquely identifying a + // previously-issued certificate which this order is intended to replace. + // This unique identifier is constructed in the same way as the path + // component for GET requests described above. Clients SHOULD include + // this field in New Order requests if there is a clear predecessor + // certificate, as is the case for most certificate renewals. + // + // EXPERIMENTAL: Draft ACME extension ARI: draft-ietf-acme-ari-03 + Replaces string `json:"replaces,omitempty"` + // notBefore (optional, string): The requested value of the notBefore // field in the certificate, in the date format defined in [RFC3339]. NotBefore *time.Time `json:"notBefore,omitempty"` @@ -87,6 +99,14 @@ type Order struct { Location string `json:"-"` } +func (o Order) identifierValues() []string { + var list []string + for _, id := range o.Identifiers { + list = append(list, id.Value) + } + return list +} + // Identifier is used in order and authorization (authz) objects. type Identifier struct { // type (required, string): The type of identifier. This document @@ -106,6 +126,11 @@ func (c *Client) NewOrder(ctx context.Context, account Account, order Order) (Or if err := c.provision(ctx); err != nil { return order, err } + if c.Logger != nil { + c.Logger.Debug("creating order", + zap.String("account", account.Location), + zap.Strings("identifiers", order.identifierValues())) + } resp, err := c.httpPostJWS(ctx, account.PrivateKey, account.Location, c.dir.NewOrder, order, &order) if err != nil { return order, err diff --git a/vendor/github.com/mholt/acmez/acme/problem.go b/vendor/github.com/mholt/acmez/v2/acme/problem.go similarity index 100% rename from vendor/github.com/mholt/acmez/acme/problem.go rename to vendor/github.com/mholt/acmez/v2/acme/problem.go diff --git a/vendor/github.com/mholt/acmez/client.go b/vendor/github.com/mholt/acmez/v2/client.go similarity index 79% rename from vendor/github.com/mholt/acmez/client.go rename to vendor/github.com/mholt/acmez/v2/client.go index c35f3c0..8a4a817 100644 --- a/vendor/github.com/mholt/acmez/client.go +++ b/vendor/github.com/mholt/acmez/v2/client.go @@ -33,21 +33,16 @@ package acmez import ( "context" "crypto" - "crypto/rand" "crypto/x509" "errors" "fmt" weakrand "math/rand" - "net" - "net/url" "sort" - "strings" "sync" "time" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" "go.uber.org/zap" - "golang.org/x/net/idna" ) // Client is a high-level API for ACME operations. It wraps @@ -61,39 +56,61 @@ type Client struct { ChallengeSolvers map[string]Solver } -// CSRSource is an interface that provides users of this -// package the ability to provide a CSR as part of the -// ACME flow. This allows the final CSR to be provided -// just before the Order is finalized. -type CSRSource interface { - CSR(context.Context) (*x509.CertificateRequest, error) +// ObtainCertificateForSANs is a light wrapper over ObtainCertificate that generates a simple CSR +// for the identifiers given in the list of SANs using the given private key; then it obtains a +// certificate right away. If you require customizing the parameters of the order, use ObtainCertificate +// instead. +func (c *Client) ObtainCertificateForSANs(ctx context.Context, account acme.Account, certPrivateKey crypto.Signer, sans []string) ([]acme.Certificate, error) { + csr, err := NewCSR(certPrivateKey, sans) + if err != nil { + return nil, fmt.Errorf("generating CSR: %v", err) + } + params, err := OrderParametersFromCSR(account, csr) + if err != nil { + return nil, fmt.Errorf("forming order parameters: %v", err) + } + return c.ObtainCertificate(ctx, params) } -// ObtainCertificateUsingCSRSource obtains all resulting certificate chains using the given -// ACME Identifiers and the CSRSource. The CSRSource can be used to create and sign a final -// CSR to be submitted to the ACME server just before finalization. The CSR must be completely -// and properly filled out, because the provided ACME Identifiers will be validated against -// the Identifiers that can be extracted from the CSR. This package currently supports the -// DNS, IP address, Permanent Identifier and Hardware Module Name identifiers. The Subject -// CommonName is NOT considered. -// -// The CSR's Raw field containing the DER encoded signed certificate request must also be -// set. This usually involves creating a template CSR, then calling x509.CreateCertificateRequest, -// then x509.ParseCertificateRequest on the output. +// ObtainCertificate obtains all certificate chains from the ACME server resulting from the +// given order parameters. The private key passed in must be the one that was (or will +// be) used to sign the CSR. The order parameters must be fully populated with an account, +// a list of subject identifiers, and a CSR source; and the list of subject identifiers +// must exactly match those in the CSR. // -// The method implements every single part of the ACME flow described in RFC 8555 Β§7.1 with the -// exception of "Create account" because this method signature does not have a way to return -// the updated account object. The account's status MUST be "valid" in order to succeed. -func (c *Client) ObtainCertificateUsingCSRSource(ctx context.Context, account acme.Account, identifiers []acme.Identifier, source CSRSource) ([]acme.Certificate, error) { - if account.Status != acme.StatusValid { - return nil, fmt.Errorf("account status is not valid: %s", account.Status) - } - if source == nil { +// The method implements every single part of the ACME flow described in RFC 8555 Β§7.1 with +// the exception of "Create account" because account management is outside the scope of +// certificate issuance. The account's status MUST be "valid" in order to succeed. +func (c *Client) ObtainCertificate(ctx context.Context, params OrderParameters) ([]acme.Certificate, error) { + if params.Account.Status != acme.StatusValid { + return nil, fmt.Errorf("account status is not valid: %s", params.Account.Status) + } + if params.CSR == nil { return nil, errors.New("missing CSR source") } + if len(params.Identifiers) == 0 { + return nil, errors.New("order does not list any identifiers") + } + // create the ACME order + order := acme.Order{Identifiers: params.Identifiers} + if !params.NotBefore.IsZero() { + order.NotBefore = ¶ms.NotBefore + } + if !params.NotAfter.IsZero() { + order.NotAfter = ¶ms.NotAfter + } + if params.Replaces != nil { + certID, err := acme.ARIUniqueIdentifier(params.Replaces) + if err != nil { + return nil, fmt.Errorf("invalid Replaces cert value: %v", err) + } + order.Replaces = certID + } + + // prepare to retry the transaction multiple times if necessary + // until it succeeds var err error - order := acme.Order{Identifiers: identifiers} // remember which challenge types failed for which identifiers // so we can retry with other challenge types @@ -110,13 +127,13 @@ func (c *Client) ObtainCertificateUsingCSRSource(ctx context.Context, account ac } // create order for a new certificate - order, err = c.Client.NewOrder(ctx, account, order) + order, err = c.Client.NewOrder(ctx, params.Account, order) if err != nil { return nil, fmt.Errorf("creating new order: %w", err) } // solve one challenge for each authz on the order - err = c.solveChallenges(ctx, account, order, failedChallengeTypes) + err = c.solveChallenges(ctx, params.Account, order, failedChallengeTypes) // yay, we win! if err == nil { @@ -156,8 +173,8 @@ func (c *Client) ObtainCertificateUsingCSRSource(ctx context.Context, account ac c.Logger.Info("validations succeeded; finalizing order", zap.String("order", order.Location)) } - // get the CSR from its source - csr, err := source.CSR(ctx) + // get the CSR + csr, err := params.CSR.CSR(ctx, params.Identifiers) if err != nil { return nil, fmt.Errorf("getting CSR from source: %w", err) } @@ -165,19 +182,19 @@ func (c *Client) ObtainCertificateUsingCSRSource(ctx context.Context, account ac return nil, errors.New("source did not provide CSR") } - // validate the order identifiers + // ensure the order identifiers match the CSR if err := validateOrderIdentifiers(&order, csr); err != nil { return nil, fmt.Errorf("validating order identifiers: %w", err) } // finalize the order, which requests the CA to issue us a certificate - order, err = c.Client.FinalizeOrder(ctx, account, order, csr.Raw) + order, err = c.Client.FinalizeOrder(ctx, params.Account, order, csr.Raw) if err != nil { return nil, fmt.Errorf("finalizing order %s: %w", order.Location, err) } // finally, download the certificate - certChains, err := c.Client.GetCertificateChain(ctx, account, order.Certificate) + certChains, err := c.Client.GetCertificateChain(ctx, params.Account, order.Certificate) if err != nil { return nil, fmt.Errorf("downloading certificate chain from %s: %w (order=%s)", order.Certificate, err, order.Location) @@ -226,95 +243,6 @@ func validateOrderIdentifiers(order *acme.Order, csr *x509.CertificateRequest) e return nil } -// csrSource implements the CSRSource interface and is used internally -// to pass a CSR to ObtainCertificateUsingCSRSource from the existing -// ObtainCertificateUsingCSR method. -type csrSource struct { - csr *x509.CertificateRequest -} - -func (i *csrSource) CSR(_ context.Context) (*x509.CertificateRequest, error) { - return i.csr, nil -} - -var _ CSRSource = (*csrSource)(nil) - -// ObtainCertificateUsingCSR obtains all resulting certificate chains using the given CSR, which -// must be completely and properly filled out (particularly its DNSNames and Raw fields - this -// usually involves creating a template CSR, then calling x509.CreateCertificateRequest, then -// x509.ParseCertificateRequest on the output). The Subject CommonName is NOT considered. -// -// It implements every single part of the ACME flow described in RFC 8555 Β§7.1 with the exception -// of "Create account" because this method signature does not have a way to return the updated -// account object. The account's status MUST be "valid" in order to succeed. -// -// As far as SANs go, this method currently only supports DNSNames, IPAddresses, Permanent -// Identifiers and Hardware Module Names on the CSR. -func (c *Client) ObtainCertificateUsingCSR(ctx context.Context, account acme.Account, csr *x509.CertificateRequest) ([]acme.Certificate, error) { - if csr == nil { - return nil, errors.New("missing CSR") - } - - ids, err := createIdentifiersUsingCSR(csr) - if err != nil { - return nil, err - } - if len(ids) == 0 { - return nil, errors.New("no identifiers found") - } - - csrSource := &csrSource{ - csr: csr, - } - - return c.ObtainCertificateUsingCSRSource(ctx, account, ids, csrSource) -} - -// ObtainCertificate is the same as ObtainCertificateUsingCSR, except it is a slight wrapper -// that generates the CSR for you. Doing so requires the private key you will be using for -// the certificate (different from the account private key). It obtains a certificate for -// the given SANs (domain names) using the provided account. -func (c *Client) ObtainCertificate(ctx context.Context, account acme.Account, certPrivateKey crypto.Signer, sans []string) ([]acme.Certificate, error) { - if len(sans) == 0 { - return nil, fmt.Errorf("no DNS names provided: %v", sans) - } - if certPrivateKey == nil { - return nil, fmt.Errorf("missing certificate private key") - } - - csrTemplate := new(x509.CertificateRequest) - for _, name := range sans { - if ip := net.ParseIP(name); ip != nil { - csrTemplate.IPAddresses = append(csrTemplate.IPAddresses, ip) - } else if strings.Contains(name, "@") { - csrTemplate.EmailAddresses = append(csrTemplate.EmailAddresses, name) - } else if u, err := url.Parse(name); err == nil && strings.Contains(name, "/") { - csrTemplate.URIs = append(csrTemplate.URIs, u) - } else { - // "The domain name MUST be encoded in the form in which it would appear - // in a certificate. That is, it MUST be encoded according to the rules - // in Section 7 of [RFC5280]." Β§7.1.4 - normalizedName, err := idna.ToASCII(name) - if err != nil { - return nil, fmt.Errorf("converting identifier '%s' to ASCII: %v", name, err) - } - csrTemplate.DNSNames = append(csrTemplate.DNSNames, normalizedName) - } - } - - // to properly fill out the CSR, we need to create it, then parse it - csrDER, err := x509.CreateCertificateRequest(rand.Reader, csrTemplate, certPrivateKey) - if err != nil { - return nil, fmt.Errorf("generating CSR: %v", err) - } - csr, err := x509.ParseCertificateRequest(csrDER) - if err != nil { - return nil, fmt.Errorf("parsing generated CSR: %v", err) - } - - return c.ObtainCertificateUsingCSR(ctx, account, csr) -} - // getAuthzObjects constructs stateful authorization objects for each authz on the order. // It includes all authorizations regardless of their status so that they can be // deactivated at the end if necessary. Be sure to check authz status before operating @@ -333,7 +261,7 @@ func (c *Client) getAuthzObjects(ctx context.Context, account acme.Account, orde } // add all offered challenge types to our memory if they - // arent't there already; we use this for statistics to + // aren't there already; we use this for statistics to // choose the most successful challenge type over time; // if initial fill, randomize challenge order preferredChallengesMu.Lock() diff --git a/vendor/github.com/mholt/acmez/v2/csr.go b/vendor/github.com/mholt/acmez/v2/csr.go new file mode 100644 index 0000000..fe545c5 --- /dev/null +++ b/vendor/github.com/mholt/acmez/v2/csr.go @@ -0,0 +1,316 @@ +// Copyright 2020 Matthew Holt +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package acmez + +import ( + "context" + "crypto" + "crypto/rand" + "crypto/x509" + "encoding/asn1" + "errors" + "fmt" + "net" + "net/url" + "strings" + "time" + + "github.com/mholt/acmez/v2/acme" + "golang.org/x/crypto/cryptobyte" + cryptobyte_asn1 "golang.org/x/crypto/cryptobyte/asn1" + "golang.org/x/net/idna" +) + +// NewCSR creates and signs a Certificate Signing Request (CSR) for the given subject +// identifiers (SANs) with the private key. +// +// If you need extensions or other customizations, this function is too opinionated. +// Instead, create a new(x509.CertificateRequest), then fill out the relevant fields +// (SANs, extensions, etc.), send it into x509.CreateCertificateRequest(), then pass +// that result into x509.ParseCertificateRequest() to get the final, parsed CSR. We +// chose this API to offer the most common convenience functions, but also to give +// users advanced flexibility when needed, all while reducing allocations from +// encoding & decoding each CSR and minimizing having to pass the private key around. +// +// Supported SAN types are IPs, email addresses, URIs, and DNS names. +// +// EXPERIMENTAL: This API is subject to change or removal without a major version bump. +func NewCSR(privateKey crypto.Signer, sans []string) (*x509.CertificateRequest, error) { + if len(sans) == 0 { + return nil, fmt.Errorf("no SANs provided: %v", sans) + } + + csrTemplate := new(x509.CertificateRequest) + for _, name := range sans { + if ip := net.ParseIP(name); ip != nil { + csrTemplate.IPAddresses = append(csrTemplate.IPAddresses, ip) + } else if strings.Contains(name, "@") { + csrTemplate.EmailAddresses = append(csrTemplate.EmailAddresses, name) + } else if u, err := url.Parse(name); err == nil && strings.Contains(name, "/") { + csrTemplate.URIs = append(csrTemplate.URIs, u) + } else { + // "The domain name MUST be encoded in the form in which it would appear + // in a certificate. That is, it MUST be encoded according to the rules + // in Section 7 of [RFC5280]." Β§7.1.4 + normalizedName, err := idna.ToASCII(name) + if err != nil { + return nil, fmt.Errorf("converting identifier '%s' to ASCII: %v", name, err) + } + csrTemplate.DNSNames = append(csrTemplate.DNSNames, normalizedName) + } + } + + // to properly fill out the CSR, we need to create it, then parse it + csrDER, err := x509.CreateCertificateRequest(rand.Reader, csrTemplate, privateKey) + if err != nil { + return nil, fmt.Errorf("generating CSR: %v", err) + } + csr, err := x509.ParseCertificateRequest(csrDER) + if err != nil { + return nil, fmt.Errorf("parsing generated CSR: %v", err) + } + + return csr, nil +} + +// OrderParameters contains high-level input parameters for ACME transactions, +// the state of which are represented by Order objects. This type is used as a +// convenient high-level way to convey alk the configuration needed to obtain a +// certificate (except the private key, which is provided separately to prevent +// inadvertent exposure of secret material) through ACME in one consolidated value. +// +// Account, Identifiers, and CSR fields are REQUIRED. +type OrderParameters struct { + // The ACME account with which to perform certificate operations. + // It should already be registered with the server and have a + // "valid" status. + Account acme.Account + + // The list of identifiers for which to issue the certificate. + // Identifiers may become Subject Alternate Names (SANs) in the + // certificate. This slice must be consistent with the SANs + // listed in the CSR. The OrderFromCSR() function can be + // called to ensure consistency in most cases. + // + // Supported identifier types are currently: dns, ip, + // permanent-identifier, and hardware-module. + Identifiers []acme.Identifier + + // CSR is a type that can provide the Certificate Signing + // Request, which is needed when finalizing the ACME order. + // It is invoked after challenges have completed and before + // finalization. + CSR CSRSource + + // Optionally customize the lifetime of the certificate by + // specifying the NotBefore and/or NotAfter dates for the + // certificate. Not all CAs support this. Check your CA's + // ACME service documentation. + NotBefore, NotAfter time.Time + + // Set this to the old certificate if a certificate is being renewed. + // + // DRAFT: EXPERIMENTAL ARI DRAFT SPEC. Subject to change/removal. + Replaces *x509.Certificate +} + +// OrderParametersFromCSR makes a valid OrderParameters from the given CSR. +// If necessary, the returned parameters may be further customized before using. +// +// EXPERIMENTAL: This API is subject to change or removal without a major version bump. +func OrderParametersFromCSR(account acme.Account, csr *x509.CertificateRequest) (OrderParameters, error) { + ids, err := createIdentifiersUsingCSR(csr) + if err != nil { + return OrderParameters{}, err + } + if len(ids) == 0 { + return OrderParameters{}, errors.New("no subjects found in CSR") + } + return OrderParameters{ + Account: account, + Identifiers: ids, + CSR: StaticCSR(csr), + }, nil +} + +// CSRSource is an interface that provides users of this +// package the ability to provide a CSR as part of the +// ACME flow. This allows the final CSR to be provided +// just before the Order is finalized, which is useful +// for certain challenge types (e.g. device-attest-01, +// where the key used for signing the CSR doesn't exist +// until the challenge has been validated). +// +// EXPERIMENTAL: Subject to change (though unlikely, and nothing major). +type CSRSource interface { + // CSR returns a Certificate Signing Request that will be + // given to the ACME server. This function is called after + // an ACME challenge completion and before order finalization. + // + // The returned CSR must have the Raw field populated with the + // DER-encoded certificate request signed by the private key. + // Typically this involves creating a template CSR, then calling + // x509.CreateCertificateRequest(), then x509.ParseCertificateRequest() + // on the output. That should return a valid CSR. The NewCSR() + // function in this package does this for you, but if you need more + // control you should make it yourself. + // + // The Subject CommonName field is NOT considered. + CSR(context.Context, []acme.Identifier) (*x509.CertificateRequest, error) +} + +// StaticCSR returns a CSRSource that simply returns the input CSR. +func StaticCSR(csr *x509.CertificateRequest) CSRSource { return staticCSR{csr} } + +// staticCSR is a CSRSource that returns an existing CSR. +type staticCSR struct{ *x509.CertificateRequest } + +// CSR returns the associated CSR. +func (cs staticCSR) CSR(_ context.Context, _ []acme.Identifier) (*x509.CertificateRequest, error) { + return cs.CertificateRequest, nil +} + +// Interface guard +var _ CSRSource = (*staticCSR)(nil) + +var ( + oidExtensionSubjectAltName = []int{2, 5, 29, 17} + oidPermanentIdentifier = []int{1, 3, 6, 1, 5, 5, 7, 8, 3} + oidHardwareModuleName = []int{1, 3, 6, 1, 5, 5, 7, 8, 4} +) + +// RFC 5280 - https://datatracker.ietf.org/doc/html/rfc5280#section-4.2.1.6 +// +// OtherName ::= SEQUENCE { +// type-id OBJECT IDENTIFIER, +// value [0] EXPLICIT ANY DEFINED BY type-id } +type otherName struct { + TypeID asn1.ObjectIdentifier + Value asn1.RawValue +} + +// permanentIdentifier is defined in RFC 4043 as an optional feature that can be +// used by a CA to indicate that two or more certificates relate to the same +// entity. +// +// The OID defined for this SAN is "1.3.6.1.5.5.7.8.3". +// +// See https://www.rfc-editor.org/rfc/rfc4043 +// +// PermanentIdentifier ::= SEQUENCE { +// identifierValue UTF8String OPTIONAL, +// assigner OBJECT IDENTIFIER OPTIONAL +// } +type permanentIdentifier struct { + IdentifierValue string `asn1:"utf8,optional"` + Assigner asn1.ObjectIdentifier `asn1:"optional"` +} + +// hardwareModuleName is defined in RFC 4108 as an optional feature that can be +// used to identify a hardware module. +// +// The OID defined for this SAN is "1.3.6.1.5.5.7.8.4". +// +// See https://www.rfc-editor.org/rfc/rfc4108#section-5 +// +// HardwareModuleName ::= SEQUENCE { +// hwType OBJECT IDENTIFIER, +// hwSerialNum OCTET STRING +// } +type hardwareModuleName struct { + Type asn1.ObjectIdentifier + SerialNumber []byte `asn1:"tag:4"` +} + +func forEachSAN(der cryptobyte.String, callback func(tag int, data []byte) error) error { + if !der.ReadASN1(&der, cryptobyte_asn1.SEQUENCE) { + return errors.New("invalid subject alternative name extension") + } + for !der.Empty() { + var san cryptobyte.String + var tag cryptobyte_asn1.Tag + if !der.ReadAnyASN1Element(&san, &tag) { + return errors.New("invalid subject alternative name extension") + } + if err := callback(int(tag^0x80), san); err != nil { + return err + } + } + + return nil +} + +// createIdentifiersUsingCSR extracts the list of ACME identifiers from the +// given Certificate Signing Request. +func createIdentifiersUsingCSR(csr *x509.CertificateRequest) ([]acme.Identifier, error) { + var ids []acme.Identifier + for _, name := range csr.DNSNames { + ids = append(ids, acme.Identifier{ + Type: "dns", // RFC 8555 Β§9.7.7 + Value: name, + }) + } + for _, ip := range csr.IPAddresses { + ids = append(ids, acme.Identifier{ + Type: "ip", // RFC 8738 + Value: ip.String(), + }) + } + for _, email := range csr.EmailAddresses { + ids = append(ids, acme.Identifier{ + Type: "email", // RFC 8823 + Value: email, + }) + } + + // Extract permanent identifiers and hardware module values. + // This block will ignore errors. + for _, ext := range csr.Extensions { + if ext.Id.Equal(oidExtensionSubjectAltName) { + err := forEachSAN(ext.Value, func(tag int, data []byte) error { + var on otherName + if rest, err := asn1.UnmarshalWithParams(data, &on, "tag:0"); err != nil || len(rest) > 0 { + return nil + } + + switch { + case on.TypeID.Equal(oidPermanentIdentifier): + var pi permanentIdentifier + if _, err := asn1.Unmarshal(on.Value.Bytes, &pi); err == nil { + ids = append(ids, acme.Identifier{ + Type: "permanent-identifier", // draft-acme-device-attest-00 Β§3 + Value: pi.IdentifierValue, + }) + } + case on.TypeID.Equal(oidHardwareModuleName): + var hmn hardwareModuleName + if _, err := asn1.Unmarshal(on.Value.Bytes, &hmn); err == nil { + ids = append(ids, acme.Identifier{ + Type: "hardware-module", // draft-acme-device-attest-00 Β§4 + Value: string(hmn.SerialNumber), + }) + } + } + return nil + }) + if err != nil { + return nil, err + } + break + } + } + + return ids, nil +} diff --git a/vendor/github.com/mholt/acmez/v2/mailreply00.go b/vendor/github.com/mholt/acmez/v2/mailreply00.go new file mode 100644 index 0000000..0fae0fd --- /dev/null +++ b/vendor/github.com/mholt/acmez/v2/mailreply00.go @@ -0,0 +1,48 @@ +// Copyright 2023 Matthew Holt +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package acmez + +import ( + "fmt" + "strings" + + "github.com/mholt/acmez/v2/acme" +) + +// MailReplyChallengeResponse builds an email response body including headers to reply to the +// email-reply-00 challenge email. This function only builds the email body; sending the +// message has to be performed by the caller of this function. The mailSubject and +// messageId come from the challenge mail, and if there is no reply-to header in the +// challenge email, the replyTo parameter should be empty. +func MailReplyChallengeResponse(c acme.Challenge, mailSubject string, messageId string, replyTo string) (string, error) { + if replyTo == "" { + replyTo = c.From + } + tokenPart1 := strings.TrimPrefix(mailSubject, "ACME: ") + keyAuth, err := c.MailReply00KeyAuthorization(tokenPart1) + if err != nil { + return "", fmt.Errorf("failed creating key authorization: %w", err) + } + msg := fmt.Sprintf("To: %s\r\n"+ + "From: %s\r\n"+ + "In-Reply-To: %s\r\n"+ + "Subject: RE: ACME: %s\r\n"+ + "Content-Type: text/plain\r\n"+ + "\r\n"+ + "-----BEGIN ACME RESPONSE-----\r\n"+ + "%s\r\n"+ + "-----END ACME RESPONSE-----\r\n", replyTo, c.Identifier.Value, messageId, tokenPart1, keyAuth) + return msg, nil +} diff --git a/vendor/github.com/mholt/acmez/solver.go b/vendor/github.com/mholt/acmez/v2/solver.go similarity index 94% rename from vendor/github.com/mholt/acmez/solver.go rename to vendor/github.com/mholt/acmez/v2/solver.go index 095c9a6..90f82e0 100644 --- a/vendor/github.com/mholt/acmez/solver.go +++ b/vendor/github.com/mholt/acmez/v2/solver.go @@ -17,7 +17,7 @@ package acmez import ( "context" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" ) // Solver is a type that can solve ACME challenges. All @@ -38,6 +38,9 @@ type Solver interface { // the DNS record propagates. The API request should be // done in Present(), and waiting for propagation should // be done in Wait(). + // Another example is the email-reply-00 challenge, because + // it can take a while for an ACME server to send a challenge + // email and for it to arrive at the email client. Present(context.Context, acme.Challenge) error // CleanUp is called after a challenge is finished, whether diff --git a/vendor/github.com/mholt/acmez/tlsalpn01.go b/vendor/github.com/mholt/acmez/v2/tlsalpn01.go similarity index 98% rename from vendor/github.com/mholt/acmez/tlsalpn01.go rename to vendor/github.com/mholt/acmez/v2/tlsalpn01.go index a6b920b..a228e54 100644 --- a/vendor/github.com/mholt/acmez/tlsalpn01.go +++ b/vendor/github.com/mholt/acmez/v2/tlsalpn01.go @@ -27,7 +27,7 @@ import ( "math/big" "time" - "github.com/mholt/acmez/acme" + "github.com/mholt/acmez/v2/acme" ) // TLSALPN01ChallengeCert creates a certificate that can be used for diff --git a/vendor/github.com/miekg/dns/README.md b/vendor/github.com/miekg/dns/README.md index 06bea9f..58275db 100644 --- a/vendor/github.com/miekg/dns/README.md +++ b/vendor/github.com/miekg/dns/README.md @@ -81,6 +81,10 @@ A not-so-up-to-date-list-that-may-be-actually-current: * https://addr.tools/ * https://dnscheck.tools/ * https://github.com/egbakou/domainverifier +* https://github.com/semihalev/sdns +* https://github.com/wintbiit/NineDNS +* https://linuxcontainers.org/incus/ +* https://ifconfig.es Send pull request if you want to be listed here. @@ -124,6 +128,7 @@ Example programs can be found in the `github.com/miekg/exdns` repository. *all of them* * 103{4,5} - DNS standard +* 1183 - ISDN, X25 and other deprecated records * 1348 - NSAP record (removed the record) * 1982 - Serial Arithmetic * 1876 - LOC record diff --git a/vendor/github.com/miekg/dns/acceptfunc.go b/vendor/github.com/miekg/dns/acceptfunc.go index ab2812e..1a59a85 100644 --- a/vendor/github.com/miekg/dns/acceptfunc.go +++ b/vendor/github.com/miekg/dns/acceptfunc.go @@ -10,8 +10,6 @@ type MsgAcceptFunc func(dh Header) MsgAcceptAction // // * opcode isn't OpcodeQuery or OpcodeNotify // -// * Zero bit isn't zero -// // * does not have exactly 1 question in the question section // // * has more than 1 RR in the Answer section diff --git a/vendor/github.com/miekg/dns/defaults.go b/vendor/github.com/miekg/dns/defaults.go index c1558b7..68e766c 100644 --- a/vendor/github.com/miekg/dns/defaults.go +++ b/vendor/github.com/miekg/dns/defaults.go @@ -22,8 +22,7 @@ func (dns *Msg) SetReply(request *Msg) *Msg { } dns.Rcode = RcodeSuccess if len(request.Question) > 0 { - dns.Question = make([]Question, 1) - dns.Question[0] = request.Question[0] + dns.Question = []Question{request.Question[0]} } return dns } @@ -199,10 +198,12 @@ func IsDomainName(s string) (labels int, ok bool) { off int begin int wasDot bool + escape bool ) for i := 0; i < len(s); i++ { switch s[i] { case '\\': + escape = !escape if off+1 > lenmsg { return labels, false } @@ -218,6 +219,7 @@ func IsDomainName(s string) (labels int, ok bool) { wasDot = false case '.': + escape = false if i == 0 && len(s) > 1 { // leading dots are not legal except for the root zone return labels, false @@ -244,10 +246,13 @@ func IsDomainName(s string) (labels int, ok bool) { labels++ begin = i + 1 default: + escape = false wasDot = false } } - + if escape { + return labels, false + } return labels, true } @@ -292,26 +297,19 @@ func IsFqdn(s string) bool { return (len(s)-i)%2 != 0 } -// IsRRset checks if a set of RRs is a valid RRset as defined by RFC 2181. -// This means the RRs need to have the same type, name, and class. Returns true -// if the RR set is valid, otherwise false. +// IsRRset reports whether a set of RRs is a valid RRset as defined by RFC 2181. +// This means the RRs need to have the same type, name, and class. func IsRRset(rrset []RR) bool { if len(rrset) == 0 { return false } - if len(rrset) == 1 { - return true - } - rrHeader := rrset[0].Header() - rrType := rrHeader.Rrtype - rrClass := rrHeader.Class - rrName := rrHeader.Name + baseH := rrset[0].Header() for _, rr := range rrset[1:] { - curRRHeader := rr.Header() - if curRRHeader.Rrtype != rrType || curRRHeader.Class != rrClass || curRRHeader.Name != rrName { + curH := rr.Header() + if curH.Rrtype != baseH.Rrtype || curH.Class != baseH.Class || curH.Name != baseH.Name { // Mismatch between the records, so this is not a valid rrset for - //signing/verifying + // signing/verifying return false } } @@ -329,9 +327,15 @@ func Fqdn(s string) string { } // CanonicalName returns the domain name in canonical form. A name in canonical -// form is lowercase and fully qualified. See Section 6.2 in RFC 4034. +// form is lowercase and fully qualified. Only US-ASCII letters are affected. See +// Section 6.2 in RFC 4034. func CanonicalName(s string) string { - return strings.ToLower(Fqdn(s)) + return strings.Map(func(r rune) rune { + if r >= 'A' && r <= 'Z' { + r += 'a' - 'A' + } + return r + }, Fqdn(s)) } // Copied from the official Go code. diff --git a/vendor/github.com/miekg/dns/dnssec_keyscan.go b/vendor/github.com/miekg/dns/dnssec_keyscan.go index f796581..9c9972d 100644 --- a/vendor/github.com/miekg/dns/dnssec_keyscan.go +++ b/vendor/github.com/miekg/dns/dnssec_keyscan.go @@ -37,7 +37,8 @@ func (k *DNSKEY) ReadPrivateKey(q io.Reader, file string) (crypto.PrivateKey, er return nil, ErrPrivKey } // TODO(mg): check if the pubkey matches the private key - algo, err := strconv.ParseUint(strings.SplitN(m["algorithm"], " ", 2)[0], 10, 8) + algoStr, _, _ := strings.Cut(m["algorithm"], " ") + algo, err := strconv.ParseUint(algoStr, 10, 8) if err != nil { return nil, ErrPrivKey } @@ -159,7 +160,7 @@ func parseKey(r io.Reader, file string) (map[string]string, error) { k = l.token case zValue: if k == "" { - return nil, &ParseError{file, "no private key seen", l} + return nil, &ParseError{file: file, err: "no private key seen", lex: l} } m[strings.ToLower(k)] = l.token diff --git a/vendor/github.com/miekg/dns/edns.go b/vendor/github.com/miekg/dns/edns.go index b5bdac8..1b58e8f 100644 --- a/vendor/github.com/miekg/dns/edns.go +++ b/vendor/github.com/miekg/dns/edns.go @@ -185,7 +185,7 @@ func (rr *OPT) Do() bool { // SetDo sets the DO (DNSSEC OK) bit. // If we pass an argument, set the DO bit to that value. -// It is possible to pass 2 or more arguments. Any arguments after the 1st is silently ignored. +// It is possible to pass 2 or more arguments, but they will be ignored. func (rr *OPT) SetDo(do ...bool) { if len(do) == 1 { if do[0] { @@ -508,6 +508,7 @@ func (e *EDNS0_LLQ) String() string { " " + strconv.FormatUint(uint64(e.LeaseLife), 10) return s } + func (e *EDNS0_LLQ) copy() EDNS0 { return &EDNS0_LLQ{e.Code, e.Version, e.Opcode, e.Error, e.Id, e.LeaseLife} } diff --git a/vendor/github.com/miekg/dns/generate.go b/vendor/github.com/miekg/dns/generate.go index ac8df34..a81d2bc 100644 --- a/vendor/github.com/miekg/dns/generate.go +++ b/vendor/github.com/miekg/dns/generate.go @@ -35,17 +35,17 @@ func (zp *ZoneParser) generate(l lex) (RR, bool) { token = token[:i] } - sx := strings.SplitN(token, "-", 2) - if len(sx) != 2 { + startStr, endStr, ok := strings.Cut(token, "-") + if !ok { return zp.setParseError("bad start-stop in $GENERATE range", l) } - start, err := strconv.ParseInt(sx[0], 10, 64) + start, err := strconv.ParseInt(startStr, 10, 64) if err != nil { return zp.setParseError("bad start in $GENERATE range", l) } - end, err := strconv.ParseInt(sx[1], 10, 64) + end, err := strconv.ParseInt(endStr, 10, 64) if err != nil { return zp.setParseError("bad stop in $GENERATE range", l) } @@ -54,7 +54,7 @@ func (zp *ZoneParser) generate(l lex) (RR, bool) { } // _BLANK - l, ok := zp.c.Next() + l, ok = zp.c.Next() if !ok || l.value != zBlank { return zp.setParseError("garbage after $GENERATE range", l) } @@ -116,7 +116,7 @@ func (r *generateReader) parseError(msg string, end int) *ParseError { l.token = r.s[r.si-1 : end] l.column += r.si // l.column starts one zBLANK before r.s - return &ParseError{r.file, msg, l} + return &ParseError{file: r.file, err: msg, lex: l} } func (r *generateReader) Read(p []byte) (int, error) { @@ -211,15 +211,16 @@ func (r *generateReader) ReadByte() (byte, error) { func modToPrintf(s string) (string, int64, string) { // Modifier is { offset [ ,width [ ,base ] ] } - provide default // values for optional width and type, if necessary. - var offStr, widthStr, base string - switch xs := strings.Split(s, ","); len(xs) { - case 1: - offStr, widthStr, base = xs[0], "0", "d" - case 2: - offStr, widthStr, base = xs[0], xs[1], "d" - case 3: - offStr, widthStr, base = xs[0], xs[1], xs[2] - default: + offStr, s, ok0 := strings.Cut(s, ",") + widthStr, s, ok1 := strings.Cut(s, ",") + base, _, ok2 := strings.Cut(s, ",") + if !ok0 { + widthStr = "0" + } + if !ok1 { + base = "d" + } + if ok2 { return "", 0, "bad modifier in $GENERATE" } @@ -234,8 +235,8 @@ func modToPrintf(s string) (string, int64, string) { return "", 0, "bad offset in $GENERATE" } - width, err := strconv.ParseInt(widthStr, 10, 64) - if err != nil || width < 0 || width > 255 { + width, err := strconv.ParseUint(widthStr, 10, 8) + if err != nil { return "", 0, "bad width in $GENERATE" } diff --git a/vendor/github.com/miekg/dns/listen_no_reuseport.go b/vendor/github.com/miekg/dns/listen_no_reuseport.go index 6ed50f8..8cebb2f 100644 --- a/vendor/github.com/miekg/dns/listen_no_reuseport.go +++ b/vendor/github.com/miekg/dns/listen_no_reuseport.go @@ -7,16 +7,18 @@ import "net" const supportsReusePort = false -func listenTCP(network, addr string, reuseport bool) (net.Listener, error) { - if reuseport { +func listenTCP(network, addr string, reuseport, reuseaddr bool) (net.Listener, error) { + if reuseport || reuseaddr { // TODO(tmthrgd): return an error? } return net.Listen(network, addr) } -func listenUDP(network, addr string, reuseport bool) (net.PacketConn, error) { - if reuseport { +const supportsReuseAddr = false + +func listenUDP(network, addr string, reuseport, reuseaddr bool) (net.PacketConn, error) { + if reuseport || reuseaddr { // TODO(tmthrgd): return an error? } diff --git a/vendor/github.com/miekg/dns/listen_reuseport.go b/vendor/github.com/miekg/dns/listen_reuseport.go index 89bac90..41326f2 100644 --- a/vendor/github.com/miekg/dns/listen_reuseport.go +++ b/vendor/github.com/miekg/dns/listen_reuseport.go @@ -25,19 +25,41 @@ func reuseportControl(network, address string, c syscall.RawConn) error { return opErr } -func listenTCP(network, addr string, reuseport bool) (net.Listener, error) { +const supportsReuseAddr = true + +func reuseaddrControl(network, address string, c syscall.RawConn) error { + var opErr error + err := c.Control(func(fd uintptr) { + opErr = unix.SetsockoptInt(int(fd), unix.SOL_SOCKET, unix.SO_REUSEADDR, 1) + }) + if err != nil { + return err + } + + return opErr +} + +func listenTCP(network, addr string, reuseport, reuseaddr bool) (net.Listener, error) { var lc net.ListenConfig - if reuseport { + switch { + case reuseaddr && reuseport: + case reuseport: lc.Control = reuseportControl + case reuseaddr: + lc.Control = reuseaddrControl } return lc.Listen(context.Background(), network, addr) } -func listenUDP(network, addr string, reuseport bool) (net.PacketConn, error) { +func listenUDP(network, addr string, reuseport, reuseaddr bool) (net.PacketConn, error) { var lc net.ListenConfig - if reuseport { + switch { + case reuseaddr && reuseport: + case reuseport: lc.Control = reuseportControl + case reuseaddr: + lc.Control = reuseaddrControl } return lc.ListenPacket(context.Background(), network, addr) diff --git a/vendor/github.com/miekg/dns/msg.go b/vendor/github.com/miekg/dns/msg.go index d5049a4..5fa7f9e 100644 --- a/vendor/github.com/miekg/dns/msg.go +++ b/vendor/github.com/miekg/dns/msg.go @@ -501,30 +501,28 @@ func packTxtString(s string, msg []byte, offset int) (int, error) { return offset, nil } -func packOctetString(s string, msg []byte, offset int, tmp []byte) (int, error) { - if offset >= len(msg) || len(s) > len(tmp) { +func packOctetString(s string, msg []byte, offset int) (int, error) { + if offset >= len(msg) || len(s) > 256*4+1 { return offset, ErrBuf } - bs := tmp[:len(s)] - copy(bs, s) - for i := 0; i < len(bs); i++ { + for i := 0; i < len(s); i++ { if len(msg) <= offset { return offset, ErrBuf } - if bs[i] == '\\' { + if s[i] == '\\' { i++ - if i == len(bs) { + if i == len(s) { break } // check for \DDD - if isDDD(bs[i:]) { - msg[offset] = dddToByte(bs[i:]) + if isDDD(s[i:]) { + msg[offset] = dddToByte(s[i:]) i += 2 } else { - msg[offset] = bs[i] + msg[offset] = s[i] } } else { - msg[offset] = bs[i] + msg[offset] = s[i] } offset++ } @@ -716,7 +714,7 @@ func (h *MsgHdr) String() string { return s } -// Pack packs a Msg: it is converted to to wire format. +// Pack packs a Msg: it is converted to wire format. // If the dns.Compress is true the message will be in compressed wire format. func (dns *Msg) Pack() (msg []byte, err error) { return dns.PackBuffer(nil) @@ -896,23 +894,38 @@ func (dns *Msg) String() string { return " MsgHdr" } s := dns.MsgHdr.String() + " " - s += "QUERY: " + strconv.Itoa(len(dns.Question)) + ", " - s += "ANSWER: " + strconv.Itoa(len(dns.Answer)) + ", " - s += "AUTHORITY: " + strconv.Itoa(len(dns.Ns)) + ", " - s += "ADDITIONAL: " + strconv.Itoa(len(dns.Extra)) + "\n" + if dns.MsgHdr.Opcode == OpcodeUpdate { + s += "ZONE: " + strconv.Itoa(len(dns.Question)) + ", " + s += "PREREQ: " + strconv.Itoa(len(dns.Answer)) + ", " + s += "UPDATE: " + strconv.Itoa(len(dns.Ns)) + ", " + s += "ADDITIONAL: " + strconv.Itoa(len(dns.Extra)) + "\n" + } else { + s += "QUERY: " + strconv.Itoa(len(dns.Question)) + ", " + s += "ANSWER: " + strconv.Itoa(len(dns.Answer)) + ", " + s += "AUTHORITY: " + strconv.Itoa(len(dns.Ns)) + ", " + s += "ADDITIONAL: " + strconv.Itoa(len(dns.Extra)) + "\n" + } opt := dns.IsEdns0() if opt != nil { // OPT PSEUDOSECTION s += opt.String() + "\n" } if len(dns.Question) > 0 { - s += "\n;; QUESTION SECTION:\n" + if dns.MsgHdr.Opcode == OpcodeUpdate { + s += "\n;; ZONE SECTION:\n" + } else { + s += "\n;; QUESTION SECTION:\n" + } for _, r := range dns.Question { s += r.String() + "\n" } } if len(dns.Answer) > 0 { - s += "\n;; ANSWER SECTION:\n" + if dns.MsgHdr.Opcode == OpcodeUpdate { + s += "\n;; PREREQUISITE SECTION:\n" + } else { + s += "\n;; ANSWER SECTION:\n" + } for _, r := range dns.Answer { if r != nil { s += r.String() + "\n" @@ -920,7 +933,11 @@ func (dns *Msg) String() string { } } if len(dns.Ns) > 0 { - s += "\n;; AUTHORITY SECTION:\n" + if dns.MsgHdr.Opcode == OpcodeUpdate { + s += "\n;; UPDATE SECTION:\n" + } else { + s += "\n;; AUTHORITY SECTION:\n" + } for _, r := range dns.Ns { if r != nil { s += r.String() + "\n" diff --git a/vendor/github.com/miekg/dns/msg_helpers.go b/vendor/github.com/miekg/dns/msg_helpers.go index 8582fc0..acec21f 100644 --- a/vendor/github.com/miekg/dns/msg_helpers.go +++ b/vendor/github.com/miekg/dns/msg_helpers.go @@ -20,9 +20,7 @@ func unpackDataA(msg []byte, off int) (net.IP, int, error) { if off+net.IPv4len > len(msg) { return nil, len(msg), &Error{err: "overflow unpacking a"} } - a := append(make(net.IP, 0, net.IPv4len), msg[off:off+net.IPv4len]...) - off += net.IPv4len - return a, off, nil + return cloneSlice(msg[off : off+net.IPv4len]), off + net.IPv4len, nil } func packDataA(a net.IP, msg []byte, off int) (int, error) { @@ -47,9 +45,7 @@ func unpackDataAAAA(msg []byte, off int) (net.IP, int, error) { if off+net.IPv6len > len(msg) { return nil, len(msg), &Error{err: "overflow unpacking aaaa"} } - aaaa := append(make(net.IP, 0, net.IPv6len), msg[off:off+net.IPv6len]...) - off += net.IPv6len - return aaaa, off, nil + return cloneSlice(msg[off : off+net.IPv6len]), off + net.IPv6len, nil } func packDataAAAA(aaaa net.IP, msg []byte, off int) (int, error) { @@ -410,29 +406,24 @@ func packStringTxt(s []string, msg []byte, off int) (int, error) { func unpackDataOpt(msg []byte, off int) ([]EDNS0, int, error) { var edns []EDNS0 -Option: - var code uint16 - if off+4 > len(msg) { - return nil, len(msg), &Error{err: "overflow unpacking opt"} - } - code = binary.BigEndian.Uint16(msg[off:]) - off += 2 - optlen := binary.BigEndian.Uint16(msg[off:]) - off += 2 - if off+int(optlen) > len(msg) { - return nil, len(msg), &Error{err: "overflow unpacking opt"} - } - e := makeDataOpt(code) - if err := e.unpack(msg[off : off+int(optlen)]); err != nil { - return nil, len(msg), err - } - edns = append(edns, e) - off += int(optlen) - - if off < len(msg) { - goto Option + for off < len(msg) { + if off+4 > len(msg) { + return nil, len(msg), &Error{err: "overflow unpacking opt"} + } + code := binary.BigEndian.Uint16(msg[off:]) + off += 2 + optlen := binary.BigEndian.Uint16(msg[off:]) + off += 2 + if off+int(optlen) > len(msg) { + return nil, len(msg), &Error{err: "overflow unpacking opt"} + } + opt := makeDataOpt(code) + if err := opt.unpack(msg[off : off+int(optlen)]); err != nil { + return nil, len(msg), err + } + edns = append(edns, opt) + off += int(optlen) } - return edns, off, nil } @@ -461,8 +452,7 @@ func unpackStringOctet(msg []byte, off int) (string, int, error) { } func packStringOctet(s string, msg []byte, off int) (int, error) { - txtTmp := make([]byte, 256*4+1) - off, err := packOctetString(s, msg, off, txtTmp) + off, err := packOctetString(s, msg, off) if err != nil { return len(msg), err } diff --git a/vendor/github.com/miekg/dns/privaterr.go b/vendor/github.com/miekg/dns/privaterr.go index d256b65..350ea5a 100644 --- a/vendor/github.com/miekg/dns/privaterr.go +++ b/vendor/github.com/miekg/dns/privaterr.go @@ -84,7 +84,7 @@ Fetch: err := r.Data.Parse(text) if err != nil { - return &ParseError{"", err.Error(), l} + return &ParseError{wrappedErr: err, lex: l} } return nil diff --git a/vendor/github.com/miekg/dns/scan.go b/vendor/github.com/miekg/dns/scan.go index 3083c3e..e26e802 100644 --- a/vendor/github.com/miekg/dns/scan.go +++ b/vendor/github.com/miekg/dns/scan.go @@ -4,7 +4,9 @@ import ( "bufio" "fmt" "io" + "io/fs" "os" + "path" "path/filepath" "strconv" "strings" @@ -64,20 +66,26 @@ const ( // ParseError is a parsing error. It contains the parse error and the location in the io.Reader // where the error occurred. type ParseError struct { - file string - err string - lex lex + file string + err string + wrappedErr error + lex lex } func (e *ParseError) Error() (s string) { if e.file != "" { s = e.file + ": " } + if e.err == "" && e.wrappedErr != nil { + e.err = e.wrappedErr.Error() + } s += "dns: " + e.err + ": " + strconv.QuoteToASCII(e.lex.token) + " at line: " + strconv.Itoa(e.lex.line) + ":" + strconv.Itoa(e.lex.column) return } +func (e *ParseError) Unwrap() error { return e.wrappedErr } + type lex struct { token string // text of the token err bool // when true, token text has lexer error @@ -93,12 +101,13 @@ type ttlState struct { isByDirective bool // isByDirective indicates whether ttl was set by a $TTL directive } -// NewRR reads the RR contained in the string s. Only the first RR is returned. +// NewRR reads a string s and returns the first RR. // If s contains no records, NewRR will return nil with no error. // -// The class defaults to IN and TTL defaults to 3600. The full zone file syntax -// like $TTL, $ORIGIN, etc. is supported. All fields of the returned RR are -// set, except RR.Header().Rdlength which is set to 0. +// The class defaults to IN, TTL defaults to 3600, and +// origin for resolving relative domain names defaults to the DNS root (.). +// Full zone file syntax is supported, including directives like $TTL and $ORIGIN. +// All fields of the returned RR are set from the read data, except RR.Header().Rdlength which is set to 0. func NewRR(s string) (RR, error) { if len(s) > 0 && s[len(s)-1] != '\n' { // We need a closing newline return ReadRR(strings.NewReader(s+"\n"), "") @@ -168,8 +177,9 @@ type ZoneParser struct { // sub is used to parse $INCLUDE files and $GENERATE directives. // Next, by calling subNext, forwards the resulting RRs from this // sub parser to the calling code. - sub *ZoneParser - osFile *os.File + sub *ZoneParser + r io.Reader + fsys fs.FS includeDepth uint8 @@ -188,7 +198,7 @@ func NewZoneParser(r io.Reader, origin, file string) *ZoneParser { if origin != "" { origin = Fqdn(origin) if _, ok := IsDomainName(origin); !ok { - pe = &ParseError{file, "bad initial origin name", lex{}} + pe = &ParseError{file: file, err: "bad initial origin name"} } } @@ -220,6 +230,24 @@ func (zp *ZoneParser) SetIncludeAllowed(v bool) { zp.includeAllowed = v } +// SetIncludeFS provides an [fs.FS] to use when looking for the target of +// $INCLUDE directives. ($INCLUDE must still be enabled separately by calling +// [ZoneParser.SetIncludeAllowed].) If fsys is nil, [os.Open] will be used. +// +// When fsys is an on-disk FS, the ability of $INCLUDE to reach files from +// outside its root directory depends upon the FS implementation. For +// instance, [os.DirFS] will refuse to open paths like "../../etc/passwd", +// however it will still follow links which may point anywhere on the system. +// +// FS paths are slash-separated on all systems, even Windows. $INCLUDE paths +// containing other characters such as backslash and colon may be accepted as +// valid, but those characters will never be interpreted by an FS +// implementation as path element separators. See [fs.ValidPath] for more +// details. +func (zp *ZoneParser) SetIncludeFS(fsys fs.FS) { + zp.fsys = fsys +} + // Err returns the first non-EOF error that was encountered by the // ZoneParser. func (zp *ZoneParser) Err() error { @@ -237,7 +265,7 @@ func (zp *ZoneParser) Err() error { } func (zp *ZoneParser) setParseError(err string, l lex) (RR, bool) { - zp.parseErr = &ParseError{zp.file, err, l} + zp.parseErr = &ParseError{file: zp.file, err: err, lex: l} return nil, false } @@ -260,9 +288,11 @@ func (zp *ZoneParser) subNext() (RR, bool) { return rr, true } - if zp.sub.osFile != nil { - zp.sub.osFile.Close() - zp.sub.osFile = nil + if zp.sub.r != nil { + if c, ok := zp.sub.r.(io.Closer); ok { + c.Close() + } + zp.sub.r = nil } if zp.sub.Err() != nil { @@ -402,24 +432,44 @@ func (zp *ZoneParser) Next() (RR, bool) { // Start with the new file includePath := l.token - if !filepath.IsAbs(includePath) { - includePath = filepath.Join(filepath.Dir(zp.file), includePath) - } + var r1 io.Reader + var e1 error + if zp.fsys != nil { + // fs.FS always uses / as separator, even on Windows, so use + // path instead of filepath here: + if !path.IsAbs(includePath) { + includePath = path.Join(path.Dir(zp.file), includePath) + } + + // os.DirFS, and probably others, expect all paths to be + // relative, so clean the path and remove leading / if + // present: + includePath = strings.TrimLeft(path.Clean(includePath), "/") - r1, e1 := os.Open(includePath) + r1, e1 = zp.fsys.Open(includePath) + } else { + if !filepath.IsAbs(includePath) { + includePath = filepath.Join(filepath.Dir(zp.file), includePath) + } + r1, e1 = os.Open(includePath) + } if e1 != nil { var as string - if !filepath.IsAbs(l.token) { + if includePath != l.token { as = fmt.Sprintf(" as `%s'", includePath) } - - msg := fmt.Sprintf("failed to open `%s'%s: %v", l.token, as, e1) - return zp.setParseError(msg, l) + zp.parseErr = &ParseError{ + file: zp.file, + wrappedErr: fmt.Errorf("failed to open `%s'%s: %w", l.token, as, e1), + lex: l, + } + return nil, false } zp.sub = NewZoneParser(r1, neworigin, includePath) - zp.sub.defttl, zp.sub.includeDepth, zp.sub.osFile = zp.defttl, zp.includeDepth+1, r1 + zp.sub.defttl, zp.sub.includeDepth, zp.sub.r = zp.defttl, zp.includeDepth+1, r1 zp.sub.SetIncludeAllowed(true) + zp.sub.SetIncludeFS(zp.fsys) return zp.subNext() case zExpectDirTTLBl: if l.value != zBlank { @@ -605,8 +655,6 @@ func (zp *ZoneParser) Next() (RR, bool) { if !isPrivate && zp.c.Peek().token == "" { // This is a dynamic update rr. - // TODO(tmthrgd): Previously slurpRemainder was only called - // for certain RR types, which may have been important. if err := slurpRemainder(zp.c); err != nil { return zp.setParseError(err.err, err.lex) } @@ -1216,42 +1264,34 @@ func stringToCm(token string) (e, m uint8, ok bool) { if token[len(token)-1] == 'M' || token[len(token)-1] == 'm' { token = token[0 : len(token)-1] } - s := strings.SplitN(token, ".", 2) - var meters, cmeters, val int - var err error - switch len(s) { - case 2: - if cmeters, err = strconv.Atoi(s[1]); err != nil { - return - } + + var ( + meters, cmeters, val int + err error + ) + mStr, cmStr, hasCM := strings.Cut(token, ".") + if hasCM { // There's no point in having more than 2 digits in this part, and would rather make the implementation complicated ('123' should be treated as '12'). // So we simply reject it. // We also make sure the first character is a digit to reject '+-' signs. - if len(s[1]) > 2 || s[1][0] < '0' || s[1][0] > '9' { + cmeters, err = strconv.Atoi(cmStr) + if err != nil || len(cmStr) > 2 || cmStr[0] < '0' || cmStr[0] > '9' { return } - if len(s[1]) == 1 { + if len(cmStr) == 1 { // 'nn.1' must be treated as 'nn-meters and 10cm, not 1cm. cmeters *= 10 } - if s[0] == "" { - // This will allow omitting the 'meter' part, like .01 (meaning 0.01m = 1cm). - break - } - fallthrough - case 1: - if meters, err = strconv.Atoi(s[0]); err != nil { - return - } + } + // This slightly ugly condition will allow omitting the 'meter' part, like .01 (meaning 0.01m = 1cm). + if !hasCM || mStr != "" { + meters, err = strconv.Atoi(mStr) // RFC1876 states the max value is 90000000.00. The latter two conditions enforce it. - if s[0][0] < '0' || s[0][0] > '9' || meters > 90000000 || (meters == 90000000 && cmeters != 0) { + if err != nil || mStr[0] < '0' || mStr[0] > '9' || meters > 90000000 || (meters == 90000000 && cmeters != 0) { return } - case 0: - // huh? - return 0, 0, false } - ok = true + if meters > 0 { e = 2 val = meters @@ -1263,8 +1303,7 @@ func stringToCm(token string) (e, m uint8, ok bool) { e++ val /= 10 } - m = uint8(val) - return + return e, uint8(val), true } func toAbsoluteName(name, origin string) (absolute string, ok bool) { @@ -1337,12 +1376,12 @@ func slurpRemainder(c *zlexer) *ParseError { case zBlank: l, _ = c.Next() if l.value != zNewline && l.value != zEOF { - return &ParseError{"", "garbage after rdata", l} + return &ParseError{err: "garbage after rdata", lex: l} } case zNewline: case zEOF: default: - return &ParseError{"", "garbage after rdata", l} + return &ParseError{err: "garbage after rdata", lex: l} } return nil } @@ -1351,16 +1390,16 @@ func slurpRemainder(c *zlexer) *ParseError { // Used for NID and L64 record. func stringToNodeID(l lex) (uint64, *ParseError) { if len(l.token) < 19 { - return 0, &ParseError{l.token, "bad NID/L64 NodeID/Locator64", l} + return 0, &ParseError{file: l.token, err: "bad NID/L64 NodeID/Locator64", lex: l} } // There must be three colons at fixes positions, if not its a parse error if l.token[4] != ':' && l.token[9] != ':' && l.token[14] != ':' { - return 0, &ParseError{l.token, "bad NID/L64 NodeID/Locator64", l} + return 0, &ParseError{file: l.token, err: "bad NID/L64 NodeID/Locator64", lex: l} } s := l.token[0:4] + l.token[5:9] + l.token[10:14] + l.token[15:19] u, err := strconv.ParseUint(s, 16, 64) if err != nil { - return 0, &ParseError{l.token, "bad NID/L64 NodeID/Locator64", l} + return 0, &ParseError{file: l.token, err: "bad NID/L64 NodeID/Locator64", lex: l} } return u, nil } diff --git a/vendor/github.com/miekg/dns/scan_rr.go b/vendor/github.com/miekg/dns/scan_rr.go index d08c8e6..7d1ade7 100644 --- a/vendor/github.com/miekg/dns/scan_rr.go +++ b/vendor/github.com/miekg/dns/scan_rr.go @@ -1,9 +1,9 @@ package dns import ( - "bytes" "encoding/base64" "errors" + "fmt" "net" "strconv" "strings" @@ -12,23 +12,23 @@ import ( // A remainder of the rdata with embedded spaces, return the parsed string (sans the spaces) // or an error func endingToString(c *zlexer, errstr string) (string, *ParseError) { - var buffer bytes.Buffer + var s strings.Builder l, _ := c.Next() // zString for l.value != zNewline && l.value != zEOF { if l.err { - return buffer.String(), &ParseError{"", errstr, l} + return s.String(), &ParseError{err: errstr, lex: l} } switch l.value { case zString: - buffer.WriteString(l.token) + s.WriteString(l.token) case zBlank: // Ok default: - return "", &ParseError{"", errstr, l} + return "", &ParseError{err: errstr, lex: l} } l, _ = c.Next() } - return buffer.String(), nil + return s.String(), nil } // A remainder of the rdata with embedded spaces, split on unquoted whitespace @@ -37,7 +37,7 @@ func endingToTxtSlice(c *zlexer, errstr string) ([]string, *ParseError) { // Get the remaining data until we see a zNewline l, _ := c.Next() if l.err { - return nil, &ParseError{"", errstr, l} + return nil, &ParseError{err: errstr, lex: l} } // Build the slice @@ -46,34 +46,30 @@ func endingToTxtSlice(c *zlexer, errstr string) ([]string, *ParseError) { empty := false for l.value != zNewline && l.value != zEOF { if l.err { - return nil, &ParseError{"", errstr, l} + return nil, &ParseError{err: errstr, lex: l} } switch l.value { case zString: empty = false - if len(l.token) > 255 { - // split up tokens that are larger than 255 into 255-chunks - sx := []string{} - p, i := 0, 255 - for { - if i <= len(l.token) { - sx = append(sx, l.token[p:i]) - } else { - sx = append(sx, l.token[p:]) - break - - } - p, i = p+255, i+255 + // split up tokens that are larger than 255 into 255-chunks + sx := []string{} + p := 0 + for { + i := escapedStringOffset(l.token[p:], 255) + if i != -1 && p+i != len(l.token) { + sx = append(sx, l.token[p:p+i]) + } else { + sx = append(sx, l.token[p:]) + break + } - s = append(s, sx...) - break + p += i } - - s = append(s, l.token) + s = append(s, sx...) case zBlank: if quote { // zBlank can only be seen in between txt parts. - return nil, &ParseError{"", errstr, l} + return nil, &ParseError{err: errstr, lex: l} } case zQuote: if empty && quote { @@ -82,13 +78,13 @@ func endingToTxtSlice(c *zlexer, errstr string) ([]string, *ParseError) { quote = !quote empty = true default: - return nil, &ParseError{"", errstr, l} + return nil, &ParseError{err: errstr, lex: l} } l, _ = c.Next() } if quote { - return nil, &ParseError{"", errstr, l} + return nil, &ParseError{err: errstr, lex: l} } return s, nil @@ -103,7 +99,7 @@ func (rr *A) parse(c *zlexer, o string) *ParseError { // IPv4. isIPv4 := !strings.Contains(l.token, ":") if rr.A == nil || !isIPv4 || l.err { - return &ParseError{"", "bad A A", l} + return &ParseError{err: "bad A A", lex: l} } return slurpRemainder(c) } @@ -115,7 +111,7 @@ func (rr *AAAA) parse(c *zlexer, o string) *ParseError { // addresses cannot include ":". isIPv6 := strings.Contains(l.token, ":") if rr.AAAA == nil || !isIPv6 || l.err { - return &ParseError{"", "bad AAAA AAAA", l} + return &ParseError{err: "bad AAAA AAAA", lex: l} } return slurpRemainder(c) } @@ -124,7 +120,7 @@ func (rr *NS) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad NS Ns", l} + return &ParseError{err: "bad NS Ns", lex: l} } rr.Ns = name return slurpRemainder(c) @@ -134,7 +130,7 @@ func (rr *PTR) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad PTR Ptr", l} + return &ParseError{err: "bad PTR Ptr", lex: l} } rr.Ptr = name return slurpRemainder(c) @@ -144,7 +140,7 @@ func (rr *NSAPPTR) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad NSAP-PTR Ptr", l} + return &ParseError{err: "bad NSAP-PTR Ptr", lex: l} } rr.Ptr = name return slurpRemainder(c) @@ -154,7 +150,7 @@ func (rr *RP) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() mbox, mboxOk := toAbsoluteName(l.token, o) if l.err || !mboxOk { - return &ParseError{"", "bad RP Mbox", l} + return &ParseError{err: "bad RP Mbox", lex: l} } rr.Mbox = mbox @@ -164,7 +160,7 @@ func (rr *RP) parse(c *zlexer, o string) *ParseError { txt, txtOk := toAbsoluteName(l.token, o) if l.err || !txtOk { - return &ParseError{"", "bad RP Txt", l} + return &ParseError{err: "bad RP Txt", lex: l} } rr.Txt = txt @@ -175,7 +171,7 @@ func (rr *MR) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MR Mr", l} + return &ParseError{err: "bad MR Mr", lex: l} } rr.Mr = name return slurpRemainder(c) @@ -185,7 +181,7 @@ func (rr *MB) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MB Mb", l} + return &ParseError{err: "bad MB Mb", lex: l} } rr.Mb = name return slurpRemainder(c) @@ -195,7 +191,7 @@ func (rr *MG) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MG Mg", l} + return &ParseError{err: "bad MG Mg", lex: l} } rr.Mg = name return slurpRemainder(c) @@ -220,6 +216,29 @@ func (rr *HINFO) parse(c *zlexer, o string) *ParseError { rr.Cpu = chunks[0] rr.Os = strings.Join(chunks[1:], " ") + return nil +} + +// according to RFC 1183 the parsing is identical to HINFO, so just use that code. +func (rr *ISDN) parse(c *zlexer, o string) *ParseError { + chunks, e := endingToTxtSlice(c, "bad ISDN Fields") + if e != nil { + return e + } + + if ln := len(chunks); ln == 0 { + return nil + } else if ln == 1 { + // Can we split it? + if out := strings.Fields(chunks[0]); len(out) > 1 { + chunks = out + } else { + chunks = append(chunks, "") + } + } + + rr.Address = chunks[0] + rr.SubAddress = strings.Join(chunks[1:], " ") return nil } @@ -228,7 +247,7 @@ func (rr *MINFO) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() rmail, rmailOk := toAbsoluteName(l.token, o) if l.err || !rmailOk { - return &ParseError{"", "bad MINFO Rmail", l} + return &ParseError{err: "bad MINFO Rmail", lex: l} } rr.Rmail = rmail @@ -238,7 +257,7 @@ func (rr *MINFO) parse(c *zlexer, o string) *ParseError { email, emailOk := toAbsoluteName(l.token, o) if l.err || !emailOk { - return &ParseError{"", "bad MINFO Email", l} + return &ParseError{err: "bad MINFO Email", lex: l} } rr.Email = email @@ -249,7 +268,7 @@ func (rr *MF) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MF Mf", l} + return &ParseError{err: "bad MF Mf", lex: l} } rr.Mf = name return slurpRemainder(c) @@ -259,7 +278,7 @@ func (rr *MD) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MD Md", l} + return &ParseError{err: "bad MD Md", lex: l} } rr.Md = name return slurpRemainder(c) @@ -269,7 +288,7 @@ func (rr *MX) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad MX Pref", l} + return &ParseError{err: "bad MX Pref", lex: l} } rr.Preference = uint16(i) @@ -279,7 +298,7 @@ func (rr *MX) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad MX Mx", l} + return &ParseError{err: "bad MX Mx", lex: l} } rr.Mx = name @@ -290,7 +309,7 @@ func (rr *RT) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil { - return &ParseError{"", "bad RT Preference", l} + return &ParseError{err: "bad RT Preference", lex: l} } rr.Preference = uint16(i) @@ -300,7 +319,7 @@ func (rr *RT) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad RT Host", l} + return &ParseError{err: "bad RT Host", lex: l} } rr.Host = name @@ -311,7 +330,7 @@ func (rr *AFSDB) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad AFSDB Subtype", l} + return &ParseError{err: "bad AFSDB Subtype", lex: l} } rr.Subtype = uint16(i) @@ -321,7 +340,7 @@ func (rr *AFSDB) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad AFSDB Hostname", l} + return &ParseError{err: "bad AFSDB Hostname", lex: l} } rr.Hostname = name return slurpRemainder(c) @@ -330,7 +349,7 @@ func (rr *AFSDB) parse(c *zlexer, o string) *ParseError { func (rr *X25) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() if l.err { - return &ParseError{"", "bad X25 PSDNAddress", l} + return &ParseError{err: "bad X25 PSDNAddress", lex: l} } rr.PSDNAddress = l.token return slurpRemainder(c) @@ -340,7 +359,7 @@ func (rr *KX) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad KX Pref", l} + return &ParseError{err: "bad KX Pref", lex: l} } rr.Preference = uint16(i) @@ -350,7 +369,7 @@ func (rr *KX) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad KX Exchanger", l} + return &ParseError{err: "bad KX Exchanger", lex: l} } rr.Exchanger = name return slurpRemainder(c) @@ -360,7 +379,7 @@ func (rr *CNAME) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad CNAME Target", l} + return &ParseError{err: "bad CNAME Target", lex: l} } rr.Target = name return slurpRemainder(c) @@ -370,7 +389,7 @@ func (rr *DNAME) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad DNAME Target", l} + return &ParseError{err: "bad DNAME Target", lex: l} } rr.Target = name return slurpRemainder(c) @@ -380,7 +399,7 @@ func (rr *SOA) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() ns, nsOk := toAbsoluteName(l.token, o) if l.err || !nsOk { - return &ParseError{"", "bad SOA Ns", l} + return &ParseError{err: "bad SOA Ns", lex: l} } rr.Ns = ns @@ -390,7 +409,7 @@ func (rr *SOA) parse(c *zlexer, o string) *ParseError { mbox, mboxOk := toAbsoluteName(l.token, o) if l.err || !mboxOk { - return &ParseError{"", "bad SOA Mbox", l} + return &ParseError{err: "bad SOA Mbox", lex: l} } rr.Mbox = mbox @@ -403,16 +422,16 @@ func (rr *SOA) parse(c *zlexer, o string) *ParseError { for i := 0; i < 5; i++ { l, _ = c.Next() if l.err { - return &ParseError{"", "bad SOA zone parameter", l} + return &ParseError{err: "bad SOA zone parameter", lex: l} } if j, err := strconv.ParseUint(l.token, 10, 32); err != nil { if i == 0 { // Serial must be a number - return &ParseError{"", "bad SOA zone parameter", l} + return &ParseError{err: "bad SOA zone parameter", lex: l} } // We allow other fields to be unitful duration strings if v, ok = stringToTTL(l.token); !ok { - return &ParseError{"", "bad SOA zone parameter", l} + return &ParseError{err: "bad SOA zone parameter", lex: l} } } else { @@ -442,7 +461,7 @@ func (rr *SRV) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad SRV Priority", l} + return &ParseError{err: "bad SRV Priority", lex: l} } rr.Priority = uint16(i) @@ -450,7 +469,7 @@ func (rr *SRV) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() // zString i, e1 := strconv.ParseUint(l.token, 10, 16) if e1 != nil || l.err { - return &ParseError{"", "bad SRV Weight", l} + return &ParseError{err: "bad SRV Weight", lex: l} } rr.Weight = uint16(i) @@ -458,7 +477,7 @@ func (rr *SRV) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() // zString i, e2 := strconv.ParseUint(l.token, 10, 16) if e2 != nil || l.err { - return &ParseError{"", "bad SRV Port", l} + return &ParseError{err: "bad SRV Port", lex: l} } rr.Port = uint16(i) @@ -468,7 +487,7 @@ func (rr *SRV) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad SRV Target", l} + return &ParseError{err: "bad SRV Target", lex: l} } rr.Target = name return slurpRemainder(c) @@ -478,7 +497,7 @@ func (rr *NAPTR) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad NAPTR Order", l} + return &ParseError{err: "bad NAPTR Order", lex: l} } rr.Order = uint16(i) @@ -486,7 +505,7 @@ func (rr *NAPTR) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() // zString i, e1 := strconv.ParseUint(l.token, 10, 16) if e1 != nil || l.err { - return &ParseError{"", "bad NAPTR Preference", l} + return &ParseError{err: "bad NAPTR Preference", lex: l} } rr.Preference = uint16(i) @@ -494,57 +513,57 @@ func (rr *NAPTR) parse(c *zlexer, o string) *ParseError { c.Next() // zBlank l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Flags", l} + return &ParseError{err: "bad NAPTR Flags", lex: l} } l, _ = c.Next() // Either String or Quote if l.value == zString { rr.Flags = l.token l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Flags", l} + return &ParseError{err: "bad NAPTR Flags", lex: l} } } else if l.value == zQuote { rr.Flags = "" } else { - return &ParseError{"", "bad NAPTR Flags", l} + return &ParseError{err: "bad NAPTR Flags", lex: l} } // Service c.Next() // zBlank l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Service", l} + return &ParseError{err: "bad NAPTR Service", lex: l} } l, _ = c.Next() // Either String or Quote if l.value == zString { rr.Service = l.token l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Service", l} + return &ParseError{err: "bad NAPTR Service", lex: l} } } else if l.value == zQuote { rr.Service = "" } else { - return &ParseError{"", "bad NAPTR Service", l} + return &ParseError{err: "bad NAPTR Service", lex: l} } // Regexp c.Next() // zBlank l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Regexp", l} + return &ParseError{err: "bad NAPTR Regexp", lex: l} } l, _ = c.Next() // Either String or Quote if l.value == zString { rr.Regexp = l.token l, _ = c.Next() // _QUOTE if l.value != zQuote { - return &ParseError{"", "bad NAPTR Regexp", l} + return &ParseError{err: "bad NAPTR Regexp", lex: l} } } else if l.value == zQuote { rr.Regexp = "" } else { - return &ParseError{"", "bad NAPTR Regexp", l} + return &ParseError{err: "bad NAPTR Regexp", lex: l} } // After quote no space?? @@ -554,7 +573,7 @@ func (rr *NAPTR) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad NAPTR Replacement", l} + return &ParseError{err: "bad NAPTR Replacement", lex: l} } rr.Replacement = name return slurpRemainder(c) @@ -564,7 +583,7 @@ func (rr *TALINK) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() previousName, previousNameOk := toAbsoluteName(l.token, o) if l.err || !previousNameOk { - return &ParseError{"", "bad TALINK PreviousName", l} + return &ParseError{err: "bad TALINK PreviousName", lex: l} } rr.PreviousName = previousName @@ -574,7 +593,7 @@ func (rr *TALINK) parse(c *zlexer, o string) *ParseError { nextName, nextNameOk := toAbsoluteName(l.token, o) if l.err || !nextNameOk { - return &ParseError{"", "bad TALINK NextName", l} + return &ParseError{err: "bad TALINK NextName", lex: l} } rr.NextName = nextName @@ -592,7 +611,7 @@ func (rr *LOC) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 32) if e != nil || l.err || i > 90 { - return &ParseError{"", "bad LOC Latitude", l} + return &ParseError{err: "bad LOC Latitude", lex: l} } rr.Latitude = 1000 * 60 * 60 * uint32(i) @@ -603,7 +622,7 @@ func (rr *LOC) parse(c *zlexer, o string) *ParseError { goto East } if i, err := strconv.ParseUint(l.token, 10, 32); err != nil || l.err || i > 59 { - return &ParseError{"", "bad LOC Latitude minutes", l} + return &ParseError{err: "bad LOC Latitude minutes", lex: l} } else { rr.Latitude += 1000 * 60 * uint32(i) } @@ -611,7 +630,7 @@ func (rr *LOC) parse(c *zlexer, o string) *ParseError { c.Next() // zBlank l, _ = c.Next() if i, err := strconv.ParseFloat(l.token, 64); err != nil || l.err || i < 0 || i >= 60 { - return &ParseError{"", "bad LOC Latitude seconds", l} + return &ParseError{err: "bad LOC Latitude seconds", lex: l} } else { rr.Latitude += uint32(1000 * i) } @@ -622,14 +641,14 @@ func (rr *LOC) parse(c *zlexer, o string) *ParseError { goto East } // If still alive, flag an error - return &ParseError{"", "bad LOC Latitude North/South", l} + return &ParseError{err: "bad LOC Latitude North/South", lex: l} East: // East c.Next() // zBlank l, _ = c.Next() if i, err := strconv.ParseUint(l.token, 10, 32); err != nil || l.err || i > 180 { - return &ParseError{"", "bad LOC Longitude", l} + return &ParseError{err: "bad LOC Longitude", lex: l} } else { rr.Longitude = 1000 * 60 * 60 * uint32(i) } @@ -640,14 +659,14 @@ East: goto Altitude } if i, err := strconv.ParseUint(l.token, 10, 32); err != nil || l.err || i > 59 { - return &ParseError{"", "bad LOC Longitude minutes", l} + return &ParseError{err: "bad LOC Longitude minutes", lex: l} } else { rr.Longitude += 1000 * 60 * uint32(i) } c.Next() // zBlank l, _ = c.Next() if i, err := strconv.ParseFloat(l.token, 64); err != nil || l.err || i < 0 || i >= 60 { - return &ParseError{"", "bad LOC Longitude seconds", l} + return &ParseError{err: "bad LOC Longitude seconds", lex: l} } else { rr.Longitude += uint32(1000 * i) } @@ -658,19 +677,19 @@ East: goto Altitude } // If still alive, flag an error - return &ParseError{"", "bad LOC Longitude East/West", l} + return &ParseError{err: "bad LOC Longitude East/West", lex: l} Altitude: c.Next() // zBlank l, _ = c.Next() if l.token == "" || l.err { - return &ParseError{"", "bad LOC Altitude", l} + return &ParseError{err: "bad LOC Altitude", lex: l} } if l.token[len(l.token)-1] == 'M' || l.token[len(l.token)-1] == 'm' { l.token = l.token[0 : len(l.token)-1] } if i, err := strconv.ParseFloat(l.token, 64); err != nil { - return &ParseError{"", "bad LOC Altitude", l} + return &ParseError{err: "bad LOC Altitude", lex: l} } else { rr.Altitude = uint32(i*100.0 + 10000000.0 + 0.5) } @@ -685,19 +704,19 @@ Altitude: case 0: // Size exp, m, ok := stringToCm(l.token) if !ok { - return &ParseError{"", "bad LOC Size", l} + return &ParseError{err: "bad LOC Size", lex: l} } rr.Size = exp&0x0f | m<<4&0xf0 case 1: // HorizPre exp, m, ok := stringToCm(l.token) if !ok { - return &ParseError{"", "bad LOC HorizPre", l} + return &ParseError{err: "bad LOC HorizPre", lex: l} } rr.HorizPre = exp&0x0f | m<<4&0xf0 case 2: // VertPre exp, m, ok := stringToCm(l.token) if !ok { - return &ParseError{"", "bad LOC VertPre", l} + return &ParseError{err: "bad LOC VertPre", lex: l} } rr.VertPre = exp&0x0f | m<<4&0xf0 } @@ -705,7 +724,7 @@ Altitude: case zBlank: // Ok default: - return &ParseError{"", "bad LOC Size, HorizPre or VertPre", l} + return &ParseError{err: "bad LOC Size, HorizPre or VertPre", lex: l} } l, _ = c.Next() } @@ -717,14 +736,14 @@ func (rr *HIP) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad HIP PublicKeyAlgorithm", l} + return &ParseError{err: "bad HIP PublicKeyAlgorithm", lex: l} } rr.PublicKeyAlgorithm = uint8(i) c.Next() // zBlank l, _ = c.Next() // zString if l.token == "" || l.err { - return &ParseError{"", "bad HIP Hit", l} + return &ParseError{err: "bad HIP Hit", lex: l} } rr.Hit = l.token // This can not contain spaces, see RFC 5205 Section 6. rr.HitLength = uint8(len(rr.Hit)) / 2 @@ -732,12 +751,12 @@ func (rr *HIP) parse(c *zlexer, o string) *ParseError { c.Next() // zBlank l, _ = c.Next() // zString if l.token == "" || l.err { - return &ParseError{"", "bad HIP PublicKey", l} + return &ParseError{err: "bad HIP PublicKey", lex: l} } rr.PublicKey = l.token // This cannot contain spaces decodedPK, decodedPKerr := base64.StdEncoding.DecodeString(rr.PublicKey) if decodedPKerr != nil { - return &ParseError{"", "bad HIP PublicKey", l} + return &ParseError{err: "bad HIP PublicKey", lex: l} } rr.PublicKeyLength = uint16(len(decodedPK)) @@ -749,13 +768,13 @@ func (rr *HIP) parse(c *zlexer, o string) *ParseError { case zString: name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad HIP RendezvousServers", l} + return &ParseError{err: "bad HIP RendezvousServers", lex: l} } xs = append(xs, name) case zBlank: // Ok default: - return &ParseError{"", "bad HIP RendezvousServers", l} + return &ParseError{err: "bad HIP RendezvousServers", lex: l} } l, _ = c.Next() } @@ -769,7 +788,7 @@ func (rr *CERT) parse(c *zlexer, o string) *ParseError { if v, ok := StringToCertType[l.token]; ok { rr.Type = v } else if i, err := strconv.ParseUint(l.token, 10, 16); err != nil { - return &ParseError{"", "bad CERT Type", l} + return &ParseError{err: "bad CERT Type", lex: l} } else { rr.Type = uint16(i) } @@ -777,7 +796,7 @@ func (rr *CERT) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() // zString i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad CERT KeyTag", l} + return &ParseError{err: "bad CERT KeyTag", lex: l} } rr.KeyTag = uint16(i) c.Next() // zBlank @@ -785,7 +804,7 @@ func (rr *CERT) parse(c *zlexer, o string) *ParseError { if v, ok := StringToAlgorithm[l.token]; ok { rr.Algorithm = v } else if i, err := strconv.ParseUint(l.token, 10, 8); err != nil { - return &ParseError{"", "bad CERT Algorithm", l} + return &ParseError{err: "bad CERT Algorithm", lex: l} } else { rr.Algorithm = uint8(i) } @@ -811,7 +830,7 @@ func (rr *CSYNC) parse(c *zlexer, o string) *ParseError { j, e := strconv.ParseUint(l.token, 10, 32) if e != nil { // Serial must be a number - return &ParseError{"", "bad CSYNC serial", l} + return &ParseError{err: "bad CSYNC serial", lex: l} } rr.Serial = uint32(j) @@ -821,7 +840,7 @@ func (rr *CSYNC) parse(c *zlexer, o string) *ParseError { j, e1 := strconv.ParseUint(l.token, 10, 16) if e1 != nil { // Serial must be a number - return &ParseError{"", "bad CSYNC flags", l} + return &ParseError{err: "bad CSYNC flags", lex: l} } rr.Flags = uint16(j) @@ -839,12 +858,12 @@ func (rr *CSYNC) parse(c *zlexer, o string) *ParseError { tokenUpper := strings.ToUpper(l.token) if k, ok = StringToType[tokenUpper]; !ok { if k, ok = typeToInt(l.token); !ok { - return &ParseError{"", "bad CSYNC TypeBitMap", l} + return &ParseError{err: "bad CSYNC TypeBitMap", lex: l} } } rr.TypeBitMap = append(rr.TypeBitMap, k) default: - return &ParseError{"", "bad CSYNC TypeBitMap", l} + return &ParseError{err: "bad CSYNC TypeBitMap", lex: l} } l, _ = c.Next() } @@ -855,7 +874,7 @@ func (rr *ZONEMD) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 32) if e != nil || l.err { - return &ParseError{"", "bad ZONEMD Serial", l} + return &ParseError{err: "bad ZONEMD Serial", lex: l} } rr.Serial = uint32(i) @@ -863,7 +882,7 @@ func (rr *ZONEMD) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad ZONEMD Scheme", l} + return &ParseError{err: "bad ZONEMD Scheme", lex: l} } rr.Scheme = uint8(i) @@ -871,7 +890,7 @@ func (rr *ZONEMD) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, err := strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad ZONEMD Hash Algorithm", l} + return &ParseError{err: "bad ZONEMD Hash Algorithm", lex: l} } rr.Hash = uint8(i) @@ -892,11 +911,11 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { if strings.HasPrefix(tokenUpper, "TYPE") { t, ok = typeToInt(l.token) if !ok { - return &ParseError{"", "bad RRSIG Typecovered", l} + return &ParseError{err: "bad RRSIG Typecovered", lex: l} } rr.TypeCovered = t } else { - return &ParseError{"", "bad RRSIG Typecovered", l} + return &ParseError{err: "bad RRSIG Typecovered", lex: l} } } else { rr.TypeCovered = t @@ -905,14 +924,14 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { c.Next() // zBlank l, _ = c.Next() if l.err { - return &ParseError{"", "bad RRSIG Algorithm", l} + return &ParseError{err: "bad RRSIG Algorithm", lex: l} } i, e := strconv.ParseUint(l.token, 10, 8) rr.Algorithm = uint8(i) // if 0 we'll check the mnemonic in the if if e != nil { v, ok := StringToAlgorithm[l.token] if !ok { - return &ParseError{"", "bad RRSIG Algorithm", l} + return &ParseError{err: "bad RRSIG Algorithm", lex: l} } rr.Algorithm = v } @@ -921,7 +940,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad RRSIG Labels", l} + return &ParseError{err: "bad RRSIG Labels", lex: l} } rr.Labels = uint8(i) @@ -929,7 +948,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e2 := strconv.ParseUint(l.token, 10, 32) if e2 != nil || l.err { - return &ParseError{"", "bad RRSIG OrigTtl", l} + return &ParseError{err: "bad RRSIG OrigTtl", lex: l} } rr.OrigTtl = uint32(i) @@ -940,7 +959,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { if i, err := strconv.ParseUint(l.token, 10, 32); err == nil { rr.Expiration = uint32(i) } else { - return &ParseError{"", "bad RRSIG Expiration", l} + return &ParseError{err: "bad RRSIG Expiration", lex: l} } } else { rr.Expiration = i @@ -952,7 +971,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { if i, err := strconv.ParseUint(l.token, 10, 32); err == nil { rr.Inception = uint32(i) } else { - return &ParseError{"", "bad RRSIG Inception", l} + return &ParseError{err: "bad RRSIG Inception", lex: l} } } else { rr.Inception = i @@ -962,7 +981,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e3 := strconv.ParseUint(l.token, 10, 16) if e3 != nil || l.err { - return &ParseError{"", "bad RRSIG KeyTag", l} + return &ParseError{err: "bad RRSIG KeyTag", lex: l} } rr.KeyTag = uint16(i) @@ -971,7 +990,7 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { rr.SignerName = l.token name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad RRSIG SignerName", l} + return &ParseError{err: "bad RRSIG SignerName", lex: l} } rr.SignerName = name @@ -984,11 +1003,13 @@ func (rr *RRSIG) parse(c *zlexer, o string) *ParseError { return nil } +func (rr *NXT) parse(c *zlexer, o string) *ParseError { return rr.NSEC.parse(c, o) } + func (rr *NSEC) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad NSEC NextDomain", l} + return &ParseError{err: "bad NSEC NextDomain", lex: l} } rr.NextDomain = name @@ -1006,12 +1027,12 @@ func (rr *NSEC) parse(c *zlexer, o string) *ParseError { tokenUpper := strings.ToUpper(l.token) if k, ok = StringToType[tokenUpper]; !ok { if k, ok = typeToInt(l.token); !ok { - return &ParseError{"", "bad NSEC TypeBitMap", l} + return &ParseError{err: "bad NSEC TypeBitMap", lex: l} } } rr.TypeBitMap = append(rr.TypeBitMap, k) default: - return &ParseError{"", "bad NSEC TypeBitMap", l} + return &ParseError{err: "bad NSEC TypeBitMap", lex: l} } l, _ = c.Next() } @@ -1022,27 +1043,27 @@ func (rr *NSEC3) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad NSEC3 Hash", l} + return &ParseError{err: "bad NSEC3 Hash", lex: l} } rr.Hash = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad NSEC3 Flags", l} + return &ParseError{err: "bad NSEC3 Flags", lex: l} } rr.Flags = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e2 := strconv.ParseUint(l.token, 10, 16) if e2 != nil || l.err { - return &ParseError{"", "bad NSEC3 Iterations", l} + return &ParseError{err: "bad NSEC3 Iterations", lex: l} } rr.Iterations = uint16(i) c.Next() l, _ = c.Next() if l.token == "" || l.err { - return &ParseError{"", "bad NSEC3 Salt", l} + return &ParseError{err: "bad NSEC3 Salt", lex: l} } if l.token != "-" { rr.SaltLength = uint8(len(l.token)) / 2 @@ -1052,7 +1073,7 @@ func (rr *NSEC3) parse(c *zlexer, o string) *ParseError { c.Next() l, _ = c.Next() if l.token == "" || l.err { - return &ParseError{"", "bad NSEC3 NextDomain", l} + return &ParseError{err: "bad NSEC3 NextDomain", lex: l} } rr.HashLength = 20 // Fix for NSEC3 (sha1 160 bits) rr.NextDomain = l.token @@ -1071,12 +1092,12 @@ func (rr *NSEC3) parse(c *zlexer, o string) *ParseError { tokenUpper := strings.ToUpper(l.token) if k, ok = StringToType[tokenUpper]; !ok { if k, ok = typeToInt(l.token); !ok { - return &ParseError{"", "bad NSEC3 TypeBitMap", l} + return &ParseError{err: "bad NSEC3 TypeBitMap", lex: l} } } rr.TypeBitMap = append(rr.TypeBitMap, k) default: - return &ParseError{"", "bad NSEC3 TypeBitMap", l} + return &ParseError{err: "bad NSEC3 TypeBitMap", lex: l} } l, _ = c.Next() } @@ -1087,21 +1108,21 @@ func (rr *NSEC3PARAM) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad NSEC3PARAM Hash", l} + return &ParseError{err: "bad NSEC3PARAM Hash", lex: l} } rr.Hash = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad NSEC3PARAM Flags", l} + return &ParseError{err: "bad NSEC3PARAM Flags", lex: l} } rr.Flags = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e2 := strconv.ParseUint(l.token, 10, 16) if e2 != nil || l.err { - return &ParseError{"", "bad NSEC3PARAM Iterations", l} + return &ParseError{err: "bad NSEC3PARAM Iterations", lex: l} } rr.Iterations = uint16(i) c.Next() @@ -1116,7 +1137,7 @@ func (rr *NSEC3PARAM) parse(c *zlexer, o string) *ParseError { func (rr *EUI48) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() if len(l.token) != 17 || l.err { - return &ParseError{"", "bad EUI48 Address", l} + return &ParseError{err: "bad EUI48 Address", lex: l} } addr := make([]byte, 12) dash := 0 @@ -1125,7 +1146,7 @@ func (rr *EUI48) parse(c *zlexer, o string) *ParseError { addr[i+1] = l.token[i+1+dash] dash++ if l.token[i+1+dash] != '-' { - return &ParseError{"", "bad EUI48 Address", l} + return &ParseError{err: "bad EUI48 Address", lex: l} } } addr[10] = l.token[15] @@ -1133,7 +1154,7 @@ func (rr *EUI48) parse(c *zlexer, o string) *ParseError { i, e := strconv.ParseUint(string(addr), 16, 48) if e != nil { - return &ParseError{"", "bad EUI48 Address", l} + return &ParseError{err: "bad EUI48 Address", lex: l} } rr.Address = i return slurpRemainder(c) @@ -1142,7 +1163,7 @@ func (rr *EUI48) parse(c *zlexer, o string) *ParseError { func (rr *EUI64) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() if len(l.token) != 23 || l.err { - return &ParseError{"", "bad EUI64 Address", l} + return &ParseError{err: "bad EUI64 Address", lex: l} } addr := make([]byte, 16) dash := 0 @@ -1151,7 +1172,7 @@ func (rr *EUI64) parse(c *zlexer, o string) *ParseError { addr[i+1] = l.token[i+1+dash] dash++ if l.token[i+1+dash] != '-' { - return &ParseError{"", "bad EUI64 Address", l} + return &ParseError{err: "bad EUI64 Address", lex: l} } } addr[14] = l.token[21] @@ -1159,7 +1180,7 @@ func (rr *EUI64) parse(c *zlexer, o string) *ParseError { i, e := strconv.ParseUint(string(addr), 16, 64) if e != nil { - return &ParseError{"", "bad EUI68 Address", l} + return &ParseError{err: "bad EUI68 Address", lex: l} } rr.Address = i return slurpRemainder(c) @@ -1169,14 +1190,14 @@ func (rr *SSHFP) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad SSHFP Algorithm", l} + return &ParseError{err: "bad SSHFP Algorithm", lex: l} } rr.Algorithm = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad SSHFP Type", l} + return &ParseError{err: "bad SSHFP Type", lex: l} } rr.Type = uint8(i) c.Next() // zBlank @@ -1192,21 +1213,21 @@ func (rr *DNSKEY) parseDNSKEY(c *zlexer, o, typ string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad " + typ + " Flags", l} + return &ParseError{err: "bad " + typ + " Flags", lex: l} } rr.Flags = uint16(i) c.Next() // zBlank l, _ = c.Next() // zString i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad " + typ + " Protocol", l} + return &ParseError{err: "bad " + typ + " Protocol", lex: l} } rr.Protocol = uint8(i) c.Next() // zBlank l, _ = c.Next() // zString i, e2 := strconv.ParseUint(l.token, 10, 8) if e2 != nil || l.err { - return &ParseError{"", "bad " + typ + " Algorithm", l} + return &ParseError{err: "bad " + typ + " Algorithm", lex: l} } rr.Algorithm = uint8(i) s, e3 := endingToString(c, "bad "+typ+" PublicKey") @@ -1228,7 +1249,7 @@ func (rr *IPSECKEY) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() num, err := strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad IPSECKEY value", l} + return &ParseError{err: "bad IPSECKEY value", lex: l} } rr.Precedence = uint8(num) c.Next() // zBlank @@ -1236,7 +1257,7 @@ func (rr *IPSECKEY) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() num, err = strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad IPSECKEY value", l} + return &ParseError{err: "bad IPSECKEY value", lex: l} } rr.GatewayType = uint8(num) c.Next() // zBlank @@ -1244,19 +1265,19 @@ func (rr *IPSECKEY) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() num, err = strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad IPSECKEY value", l} + return &ParseError{err: "bad IPSECKEY value", lex: l} } rr.Algorithm = uint8(num) c.Next() // zBlank l, _ = c.Next() if l.err { - return &ParseError{"", "bad IPSECKEY gateway", l} + return &ParseError{err: "bad IPSECKEY gateway", lex: l} } rr.GatewayAddr, rr.GatewayHost, err = parseAddrHostUnion(l.token, o, rr.GatewayType) if err != nil { - return &ParseError{"", "IPSECKEY " + err.Error(), l} + return &ParseError{wrappedErr: fmt.Errorf("IPSECKEY %w", err), lex: l} } c.Next() // zBlank @@ -1273,14 +1294,14 @@ func (rr *AMTRELAY) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() num, err := strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad AMTRELAY value", l} + return &ParseError{err: "bad AMTRELAY value", lex: l} } rr.Precedence = uint8(num) c.Next() // zBlank l, _ = c.Next() if l.err || !(l.token == "0" || l.token == "1") { - return &ParseError{"", "bad discovery value", l} + return &ParseError{err: "bad discovery value", lex: l} } if l.token == "1" { rr.GatewayType = 0x80 @@ -1291,19 +1312,19 @@ func (rr *AMTRELAY) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() num, err = strconv.ParseUint(l.token, 10, 8) if err != nil || l.err { - return &ParseError{"", "bad AMTRELAY value", l} + return &ParseError{err: "bad AMTRELAY value", lex: l} } rr.GatewayType |= uint8(num) c.Next() // zBlank l, _ = c.Next() if l.err { - return &ParseError{"", "bad AMTRELAY gateway", l} + return &ParseError{err: "bad AMTRELAY gateway", lex: l} } rr.GatewayAddr, rr.GatewayHost, err = parseAddrHostUnion(l.token, o, rr.GatewayType&0x7f) if err != nil { - return &ParseError{"", "AMTRELAY " + err.Error(), l} + return &ParseError{wrappedErr: fmt.Errorf("AMTRELAY %w", err), lex: l} } return slurpRemainder(c) @@ -1339,21 +1360,21 @@ func (rr *RKEY) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad RKEY Flags", l} + return &ParseError{err: "bad RKEY Flags", lex: l} } rr.Flags = uint16(i) c.Next() // zBlank l, _ = c.Next() // zString i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad RKEY Protocol", l} + return &ParseError{err: "bad RKEY Protocol", lex: l} } rr.Protocol = uint8(i) c.Next() // zBlank l, _ = c.Next() // zString i, e2 := strconv.ParseUint(l.token, 10, 8) if e2 != nil || l.err { - return &ParseError{"", "bad RKEY Algorithm", l} + return &ParseError{err: "bad RKEY Algorithm", lex: l} } rr.Algorithm = uint8(i) s, e3 := endingToString(c, "bad RKEY PublicKey") @@ -1386,21 +1407,21 @@ func (rr *GPOS) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() _, e := strconv.ParseFloat(l.token, 64) if e != nil || l.err { - return &ParseError{"", "bad GPOS Longitude", l} + return &ParseError{err: "bad GPOS Longitude", lex: l} } rr.Longitude = l.token c.Next() // zBlank l, _ = c.Next() _, e1 := strconv.ParseFloat(l.token, 64) if e1 != nil || l.err { - return &ParseError{"", "bad GPOS Latitude", l} + return &ParseError{err: "bad GPOS Latitude", lex: l} } rr.Latitude = l.token c.Next() // zBlank l, _ = c.Next() _, e2 := strconv.ParseFloat(l.token, 64) if e2 != nil || l.err { - return &ParseError{"", "bad GPOS Altitude", l} + return &ParseError{err: "bad GPOS Altitude", lex: l} } rr.Altitude = l.token return slurpRemainder(c) @@ -1410,7 +1431,7 @@ func (rr *DS) parseDS(c *zlexer, o, typ string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad " + typ + " KeyTag", l} + return &ParseError{err: "bad " + typ + " KeyTag", lex: l} } rr.KeyTag = uint16(i) c.Next() // zBlank @@ -1419,7 +1440,7 @@ func (rr *DS) parseDS(c *zlexer, o, typ string) *ParseError { tokenUpper := strings.ToUpper(l.token) i, ok := StringToAlgorithm[tokenUpper] if !ok || l.err { - return &ParseError{"", "bad " + typ + " Algorithm", l} + return &ParseError{err: "bad " + typ + " Algorithm", lex: l} } rr.Algorithm = i } else { @@ -1429,7 +1450,7 @@ func (rr *DS) parseDS(c *zlexer, o, typ string) *ParseError { l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad " + typ + " DigestType", l} + return &ParseError{err: "bad " + typ + " DigestType", lex: l} } rr.DigestType = uint8(i) s, e2 := endingToString(c, "bad "+typ+" Digest") @@ -1444,7 +1465,7 @@ func (rr *TA) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad TA KeyTag", l} + return &ParseError{err: "bad TA KeyTag", lex: l} } rr.KeyTag = uint16(i) c.Next() // zBlank @@ -1453,7 +1474,7 @@ func (rr *TA) parse(c *zlexer, o string) *ParseError { tokenUpper := strings.ToUpper(l.token) i, ok := StringToAlgorithm[tokenUpper] if !ok || l.err { - return &ParseError{"", "bad TA Algorithm", l} + return &ParseError{err: "bad TA Algorithm", lex: l} } rr.Algorithm = i } else { @@ -1463,7 +1484,7 @@ func (rr *TA) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad TA DigestType", l} + return &ParseError{err: "bad TA DigestType", lex: l} } rr.DigestType = uint8(i) s, e2 := endingToString(c, "bad TA Digest") @@ -1478,21 +1499,21 @@ func (rr *TLSA) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad TLSA Usage", l} + return &ParseError{err: "bad TLSA Usage", lex: l} } rr.Usage = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad TLSA Selector", l} + return &ParseError{err: "bad TLSA Selector", lex: l} } rr.Selector = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e2 := strconv.ParseUint(l.token, 10, 8) if e2 != nil || l.err { - return &ParseError{"", "bad TLSA MatchingType", l} + return &ParseError{err: "bad TLSA MatchingType", lex: l} } rr.MatchingType = uint8(i) // So this needs be e2 (i.e. different than e), because...??t @@ -1508,21 +1529,21 @@ func (rr *SMIMEA) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad SMIMEA Usage", l} + return &ParseError{err: "bad SMIMEA Usage", lex: l} } rr.Usage = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad SMIMEA Selector", l} + return &ParseError{err: "bad SMIMEA Selector", lex: l} } rr.Selector = uint8(i) c.Next() // zBlank l, _ = c.Next() i, e2 := strconv.ParseUint(l.token, 10, 8) if e2 != nil || l.err { - return &ParseError{"", "bad SMIMEA MatchingType", l} + return &ParseError{err: "bad SMIMEA MatchingType", lex: l} } rr.MatchingType = uint8(i) // So this needs be e2 (i.e. different than e), because...??t @@ -1537,14 +1558,14 @@ func (rr *SMIMEA) parse(c *zlexer, o string) *ParseError { func (rr *RFC3597) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() if l.token != "\\#" { - return &ParseError{"", "bad RFC3597 Rdata", l} + return &ParseError{err: "bad RFC3597 Rdata", lex: l} } c.Next() // zBlank l, _ = c.Next() rdlength, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad RFC3597 Rdata ", l} + return &ParseError{err: "bad RFC3597 Rdata ", lex: l} } s, e1 := endingToString(c, "bad RFC3597 Rdata") @@ -1552,7 +1573,7 @@ func (rr *RFC3597) parse(c *zlexer, o string) *ParseError { return e1 } if int(rdlength)*2 != len(s) { - return &ParseError{"", "bad RFC3597 Rdata", l} + return &ParseError{err: "bad RFC3597 Rdata", lex: l} } rr.Rdata = s return nil @@ -1600,14 +1621,14 @@ func (rr *URI) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad URI Priority", l} + return &ParseError{err: "bad URI Priority", lex: l} } rr.Priority = uint16(i) c.Next() // zBlank l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 16) if e1 != nil || l.err { - return &ParseError{"", "bad URI Weight", l} + return &ParseError{err: "bad URI Weight", lex: l} } rr.Weight = uint16(i) @@ -1617,7 +1638,7 @@ func (rr *URI) parse(c *zlexer, o string) *ParseError { return e2 } if len(s) != 1 { - return &ParseError{"", "bad URI Target", l} + return &ParseError{err: "bad URI Target", lex: l} } rr.Target = s[0] return nil @@ -1637,7 +1658,7 @@ func (rr *NID) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad NID Preference", l} + return &ParseError{err: "bad NID Preference", lex: l} } rr.Preference = uint16(i) c.Next() // zBlank @@ -1654,14 +1675,14 @@ func (rr *L32) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad L32 Preference", l} + return &ParseError{err: "bad L32 Preference", lex: l} } rr.Preference = uint16(i) c.Next() // zBlank l, _ = c.Next() // zString rr.Locator32 = net.ParseIP(l.token) if rr.Locator32 == nil || l.err { - return &ParseError{"", "bad L32 Locator", l} + return &ParseError{err: "bad L32 Locator", lex: l} } return slurpRemainder(c) } @@ -1670,7 +1691,7 @@ func (rr *LP) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad LP Preference", l} + return &ParseError{err: "bad LP Preference", lex: l} } rr.Preference = uint16(i) @@ -1679,7 +1700,7 @@ func (rr *LP) parse(c *zlexer, o string) *ParseError { rr.Fqdn = l.token name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{"", "bad LP Fqdn", l} + return &ParseError{err: "bad LP Fqdn", lex: l} } rr.Fqdn = name return slurpRemainder(c) @@ -1689,7 +1710,7 @@ func (rr *L64) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad L64 Preference", l} + return &ParseError{err: "bad L64 Preference", lex: l} } rr.Preference = uint16(i) c.Next() // zBlank @@ -1706,7 +1727,7 @@ func (rr *UID) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 32) if e != nil || l.err { - return &ParseError{"", "bad UID Uid", l} + return &ParseError{err: "bad UID Uid", lex: l} } rr.Uid = uint32(i) return slurpRemainder(c) @@ -1716,7 +1737,7 @@ func (rr *GID) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 32) if e != nil || l.err { - return &ParseError{"", "bad GID Gid", l} + return &ParseError{err: "bad GID Gid", lex: l} } rr.Gid = uint32(i) return slurpRemainder(c) @@ -1738,7 +1759,7 @@ func (rr *PX) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{"", "bad PX Preference", l} + return &ParseError{err: "bad PX Preference", lex: l} } rr.Preference = uint16(i) @@ -1747,7 +1768,7 @@ func (rr *PX) parse(c *zlexer, o string) *ParseError { rr.Map822 = l.token map822, map822Ok := toAbsoluteName(l.token, o) if l.err || !map822Ok { - return &ParseError{"", "bad PX Map822", l} + return &ParseError{err: "bad PX Map822", lex: l} } rr.Map822 = map822 @@ -1756,7 +1777,7 @@ func (rr *PX) parse(c *zlexer, o string) *ParseError { rr.Mapx400 = l.token mapx400, mapx400Ok := toAbsoluteName(l.token, o) if l.err || !mapx400Ok { - return &ParseError{"", "bad PX Mapx400", l} + return &ParseError{err: "bad PX Mapx400", lex: l} } rr.Mapx400 = mapx400 return slurpRemainder(c) @@ -1766,14 +1787,14 @@ func (rr *CAA) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad CAA Flag", l} + return &ParseError{err: "bad CAA Flag", lex: l} } rr.Flag = uint8(i) c.Next() // zBlank l, _ = c.Next() // zString if l.value != zString { - return &ParseError{"", "bad CAA Tag", l} + return &ParseError{err: "bad CAA Tag", lex: l} } rr.Tag = l.token @@ -1783,7 +1804,7 @@ func (rr *CAA) parse(c *zlexer, o string) *ParseError { return e1 } if len(s) != 1 { - return &ParseError{"", "bad CAA Value", l} + return &ParseError{err: "bad CAA Value", lex: l} } rr.Value = s[0] return nil @@ -1794,7 +1815,7 @@ func (rr *TKEY) parse(c *zlexer, o string) *ParseError { // Algorithm if l.value != zString { - return &ParseError{"", "bad TKEY algorithm", l} + return &ParseError{err: "bad TKEY algorithm", lex: l} } rr.Algorithm = l.token c.Next() // zBlank @@ -1803,13 +1824,13 @@ func (rr *TKEY) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e := strconv.ParseUint(l.token, 10, 8) if e != nil || l.err { - return &ParseError{"", "bad TKEY key length", l} + return &ParseError{err: "bad TKEY key length", lex: l} } rr.KeySize = uint16(i) c.Next() // zBlank l, _ = c.Next() if l.value != zString { - return &ParseError{"", "bad TKEY key", l} + return &ParseError{err: "bad TKEY key", lex: l} } rr.Key = l.token c.Next() // zBlank @@ -1818,13 +1839,13 @@ func (rr *TKEY) parse(c *zlexer, o string) *ParseError { l, _ = c.Next() i, e1 := strconv.ParseUint(l.token, 10, 8) if e1 != nil || l.err { - return &ParseError{"", "bad TKEY otherdata length", l} + return &ParseError{err: "bad TKEY otherdata length", lex: l} } rr.OtherLen = uint16(i) c.Next() // zBlank l, _ = c.Next() if l.value != zString { - return &ParseError{"", "bad TKEY otherday", l} + return &ParseError{err: "bad TKEY otherday", lex: l} } rr.OtherData = l.token return nil @@ -1842,14 +1863,14 @@ func (rr *APL) parse(c *zlexer, o string) *ParseError { continue } if l.value != zString { - return &ParseError{"", "unexpected APL field", l} + return &ParseError{err: "unexpected APL field", lex: l} } // Expected format: [!]afi:address/prefix colon := strings.IndexByte(l.token, ':') if colon == -1 { - return &ParseError{"", "missing colon in APL field", l} + return &ParseError{err: "missing colon in APL field", lex: l} } family, cidr := l.token[:colon], l.token[colon+1:] @@ -1862,7 +1883,7 @@ func (rr *APL) parse(c *zlexer, o string) *ParseError { afi, e := strconv.ParseUint(family, 10, 16) if e != nil { - return &ParseError{"", "failed to parse APL family: " + e.Error(), l} + return &ParseError{wrappedErr: fmt.Errorf("failed to parse APL family: %w", e), lex: l} } var addrLen int switch afi { @@ -1871,19 +1892,19 @@ func (rr *APL) parse(c *zlexer, o string) *ParseError { case 2: addrLen = net.IPv6len default: - return &ParseError{"", "unrecognized APL family", l} + return &ParseError{err: "unrecognized APL family", lex: l} } ip, subnet, e1 := net.ParseCIDR(cidr) if e1 != nil { - return &ParseError{"", "failed to parse APL address: " + e1.Error(), l} + return &ParseError{wrappedErr: fmt.Errorf("failed to parse APL address: %w", e1), lex: l} } if !ip.Equal(subnet.IP) { - return &ParseError{"", "extra bits in APL address", l} + return &ParseError{err: "extra bits in APL address", lex: l} } if len(subnet.IP) != addrLen { - return &ParseError{"", "address mismatch with the APL family", l} + return &ParseError{err: "address mismatch with the APL family", lex: l} } prefixes = append(prefixes, APLPrefix{ @@ -1895,3 +1916,32 @@ func (rr *APL) parse(c *zlexer, o string) *ParseError { rr.Prefixes = prefixes return nil } + +// escapedStringOffset finds the offset within a string (which may contain escape +// sequences) that corresponds to a certain byte offset. If the input offset is +// out of bounds, -1 is returned. +func escapedStringOffset(s string, byteOffset int) int { + if byteOffset == 0 { + return 0 + } + + offset := 0 + for i := 0; i < len(s); i++ { + offset += 1 + + // Skip escape sequences + if s[i] != '\\' { + // Not an escape sequence; nothing to do. + } else if isDDD(s[i+1:]) { + i += 3 + } else { + i++ + } + + if offset >= byteOffset { + return i + 1 + } + } + + return -1 +} diff --git a/vendor/github.com/miekg/dns/server.go b/vendor/github.com/miekg/dns/server.go index 64e3885..0207d6d 100644 --- a/vendor/github.com/miekg/dns/server.go +++ b/vendor/github.com/miekg/dns/server.go @@ -226,6 +226,10 @@ type Server struct { // Whether to set the SO_REUSEPORT socket option, allowing multiple listeners to be bound to a single address. // It is only supported on certain GOOSes and when using ListenAndServe. ReusePort bool + // Whether to set the SO_REUSEADDR socket option, allowing multiple listeners to be bound to a single address. + // Crucially this allows binding when an existing server is listening on `0.0.0.0` or `::`. + // It is only supported on certain GOOSes and when using ListenAndServe. + ReuseAddr bool // AcceptMsgFunc will check the incoming message and will reject it early in the process. // By default DefaultMsgAcceptFunc will be used. MsgAcceptFunc MsgAcceptFunc @@ -304,7 +308,7 @@ func (srv *Server) ListenAndServe() error { switch srv.Net { case "tcp", "tcp4", "tcp6": - l, err := listenTCP(srv.Net, addr, srv.ReusePort) + l, err := listenTCP(srv.Net, addr, srv.ReusePort, srv.ReuseAddr) if err != nil { return err } @@ -317,7 +321,7 @@ func (srv *Server) ListenAndServe() error { return errors.New("dns: neither Certificates nor GetCertificate set in Config") } network := strings.TrimSuffix(srv.Net, "-tls") - l, err := listenTCP(network, addr, srv.ReusePort) + l, err := listenTCP(network, addr, srv.ReusePort, srv.ReuseAddr) if err != nil { return err } @@ -327,7 +331,7 @@ func (srv *Server) ListenAndServe() error { unlock() return srv.serveTCP(l) case "udp", "udp4", "udp6": - l, err := listenUDP(srv.Net, addr, srv.ReusePort) + l, err := listenUDP(srv.Net, addr, srv.ReusePort, srv.ReuseAddr) if err != nil { return err } diff --git a/vendor/github.com/miekg/dns/svcb.go b/vendor/github.com/miekg/dns/svcb.go index 6d496d7..c1a740b 100644 --- a/vendor/github.com/miekg/dns/svcb.go +++ b/vendor/github.com/miekg/dns/svcb.go @@ -85,7 +85,7 @@ func (rr *SVCB) parse(c *zlexer, o string) *ParseError { l, _ := c.Next() i, e := strconv.ParseUint(l.token, 10, 16) if e != nil || l.err { - return &ParseError{l.token, "bad SVCB priority", l} + return &ParseError{file: l.token, err: "bad SVCB priority", lex: l} } rr.Priority = uint16(i) @@ -95,7 +95,7 @@ func (rr *SVCB) parse(c *zlexer, o string) *ParseError { name, nameOk := toAbsoluteName(l.token, o) if l.err || !nameOk { - return &ParseError{l.token, "bad SVCB Target", l} + return &ParseError{file: l.token, err: "bad SVCB Target", lex: l} } rr.Target = name @@ -111,7 +111,7 @@ func (rr *SVCB) parse(c *zlexer, o string) *ParseError { if !canHaveNextKey { // The key we can now read was probably meant to be // a part of the last value. - return &ParseError{l.token, "bad SVCB value quotation", l} + return &ParseError{file: l.token, err: "bad SVCB value quotation", lex: l} } // In key=value pairs, value does not have to be quoted unless value @@ -124,7 +124,7 @@ func (rr *SVCB) parse(c *zlexer, o string) *ParseError { // Key with no value and no equality sign key = l.token } else if idx == 0 { - return &ParseError{l.token, "bad SVCB key", l} + return &ParseError{file: l.token, err: "bad SVCB key", lex: l} } else { key, value = l.token[:idx], l.token[idx+1:] @@ -144,30 +144,30 @@ func (rr *SVCB) parse(c *zlexer, o string) *ParseError { value = l.token l, _ = c.Next() if l.value != zQuote { - return &ParseError{l.token, "SVCB unterminated value", l} + return &ParseError{file: l.token, err: "SVCB unterminated value", lex: l} } case zQuote: // There's nothing in double quotes. default: - return &ParseError{l.token, "bad SVCB value", l} + return &ParseError{file: l.token, err: "bad SVCB value", lex: l} } } } } kv := makeSVCBKeyValue(svcbStringToKey(key)) if kv == nil { - return &ParseError{l.token, "bad SVCB key", l} + return &ParseError{file: l.token, err: "bad SVCB key", lex: l} } if err := kv.parse(value); err != nil { - return &ParseError{l.token, err.Error(), l} + return &ParseError{file: l.token, wrappedErr: err, lex: l} } xs = append(xs, kv) case zQuote: - return &ParseError{l.token, "SVCB key can't contain double quotes", l} + return &ParseError{file: l.token, err: "SVCB key can't contain double quotes", lex: l} case zBlank: canHaveNextKey = true default: - return &ParseError{l.token, "bad SVCB values", l} + return &ParseError{file: l.token, err: "bad SVCB values", lex: l} } l, _ = c.Next() } @@ -314,10 +314,11 @@ func (s *SVCBMandatory) unpack(b []byte) error { } func (s *SVCBMandatory) parse(b string) error { - str := strings.Split(b, ",") - codes := make([]SVCBKey, 0, len(str)) - for _, e := range str { - codes = append(codes, svcbStringToKey(e)) + codes := make([]SVCBKey, 0, strings.Count(b, ",")+1) + for len(b) > 0 { + var key string + key, b, _ = strings.Cut(b, ",") + codes = append(codes, svcbStringToKey(key)) } s.Code = codes return nil @@ -613,19 +614,24 @@ func (s *SVCBIPv4Hint) String() string { } func (s *SVCBIPv4Hint) parse(b string) error { + if b == "" { + return errors.New("dns: svcbipv4hint: empty hint") + } if strings.Contains(b, ":") { return errors.New("dns: svcbipv4hint: expected ipv4, got ipv6") } - str := strings.Split(b, ",") - dst := make([]net.IP, len(str)) - for i, e := range str { + + hint := make([]net.IP, 0, strings.Count(b, ",")+1) + for len(b) > 0 { + var e string + e, b, _ = strings.Cut(b, ",") ip := net.ParseIP(e).To4() if ip == nil { return errors.New("dns: svcbipv4hint: bad ip") } - dst[i] = ip + hint = append(hint, ip) } - s.Hint = dst + s.Hint = hint return nil } @@ -733,9 +739,14 @@ func (s *SVCBIPv6Hint) String() string { } func (s *SVCBIPv6Hint) parse(b string) error { - str := strings.Split(b, ",") - dst := make([]net.IP, len(str)) - for i, e := range str { + if b == "" { + return errors.New("dns: svcbipv6hint: empty hint") + } + + hint := make([]net.IP, 0, strings.Count(b, ",")+1) + for len(b) > 0 { + var e string + e, b, _ = strings.Cut(b, ",") ip := net.ParseIP(e) if ip == nil { return errors.New("dns: svcbipv6hint: bad ip") @@ -743,9 +754,9 @@ func (s *SVCBIPv6Hint) parse(b string) error { if ip.To4() != nil { return errors.New("dns: svcbipv6hint: expected ipv6, got ipv4-mapped-ipv6") } - dst[i] = ip + hint = append(hint, ip) } - s.Hint = dst + s.Hint = hint return nil } diff --git a/vendor/github.com/miekg/dns/types.go b/vendor/github.com/miekg/dns/types.go index 03afecc..8e3129c 100644 --- a/vendor/github.com/miekg/dns/types.go +++ b/vendor/github.com/miekg/dns/types.go @@ -135,8 +135,8 @@ const ( RcodeNXRrset = 8 // NXRRSet - RR Set that should exist does not [DNS Update] RcodeNotAuth = 9 // NotAuth - Server Not Authoritative for zone [DNS Update] RcodeNotZone = 10 // NotZone - Name not contained in zone [DNS Update/TSIG] - RcodeBadSig = 16 // BADSIG - TSIG Signature Failure [TSIG] - RcodeBadVers = 16 // BADVERS - Bad OPT Version [EDNS0] + RcodeBadSig = 16 // BADSIG - TSIG Signature Failure [TSIG] https://www.rfc-editor.org/rfc/rfc6895.html#section-2.3 + RcodeBadVers = 16 // BADVERS - Bad OPT Version [EDNS0] https://www.rfc-editor.org/rfc/rfc6895.html#section-2.3 RcodeBadKey = 17 // BADKEY - Key not recognized [TSIG] RcodeBadTime = 18 // BADTIME - Signature out of time window [TSIG] RcodeBadMode = 19 // BADMODE - Bad TKEY Mode [TKEY] @@ -236,6 +236,9 @@ var CertTypeToString = map[uint16]string{ CertOID: "OID", } +// Prefix for IPv4 encoded as IPv6 address +const ipv4InIPv6Prefix = "::ffff:" + //go:generate go run types_generate.go // Question holds a DNS question. Usually there is just one. While the @@ -399,6 +402,17 @@ func (rr *X25) String() string { return rr.Hdr.String() + rr.PSDNAddress } +// ISDN RR. See RFC 1183, Section 3.2. +type ISDN struct { + Hdr RR_Header + Address string + SubAddress string +} + +func (rr *ISDN) String() string { + return rr.Hdr.String() + sprintTxt([]string{rr.Address, rr.SubAddress}) +} + // RT RR. See RFC 1183, Section 3.3. type RT struct { Hdr RR_Header @@ -751,6 +765,11 @@ func (rr *AAAA) String() string { if rr.AAAA == nil { return rr.Hdr.String() } + + if rr.AAAA.To4() != nil { + return rr.Hdr.String() + ipv4InIPv6Prefix + rr.AAAA.String() + } + return rr.Hdr.String() + rr.AAAA.String() } @@ -778,7 +797,7 @@ func (rr *GPOS) String() string { return rr.Hdr.String() + rr.Longitude + " " + rr.Latitude + " " + rr.Altitude } -// LOC RR. See RFC RFC 1876. +// LOC RR. See RFC 1876. type LOC struct { Hdr RR_Header Version uint8 @@ -890,6 +909,11 @@ func (rr *RRSIG) String() string { return s } +// NXT RR. See RFC 2535. +type NXT struct { + NSEC +} + // NSEC RR. See RFC 4034 and RFC 3755. type NSEC struct { Hdr RR_Header @@ -974,7 +998,7 @@ func (rr *TALINK) String() string { sprintName(rr.PreviousName) + " " + sprintName(rr.NextName) } -// SSHFP RR. See RFC RFC 4255. +// SSHFP RR. See RFC 4255. type SSHFP struct { Hdr RR_Header Algorithm uint8 @@ -988,7 +1012,7 @@ func (rr *SSHFP) String() string { " " + strings.ToUpper(rr.FingerPrint) } -// KEY RR. See RFC RFC 2535. +// KEY RR. See RFC 2535. type KEY struct { DNSKEY } @@ -1298,7 +1322,7 @@ type NINFO struct { func (rr *NINFO) String() string { return rr.Hdr.String() + sprintTxt(rr.ZSData) } -// NID RR. See RFC RFC 6742. +// NID RR. See RFC 6742. type NID struct { Hdr RR_Header Preference uint16 @@ -1517,7 +1541,7 @@ func (a *APLPrefix) str() string { case net.IPv6len: // add prefix for IPv4-mapped IPv6 if v4 := a.Network.IP.To4(); v4 != nil { - sb.WriteString("::ffff:") + sb.WriteString(ipv4InIPv6Prefix) } sb.WriteString(a.Network.IP.String()) } diff --git a/vendor/github.com/miekg/dns/version.go b/vendor/github.com/miekg/dns/version.go index 5891044..dc34e59 100644 --- a/vendor/github.com/miekg/dns/version.go +++ b/vendor/github.com/miekg/dns/version.go @@ -3,7 +3,7 @@ package dns import "fmt" // Version is current version of this library. -var Version = v{1, 1, 55} +var Version = v{1, 1, 58} // v holds the version of this library. type v struct { diff --git a/vendor/github.com/miekg/dns/xfr.go b/vendor/github.com/miekg/dns/xfr.go index 0a831c8..2187c45 100644 --- a/vendor/github.com/miekg/dns/xfr.go +++ b/vendor/github.com/miekg/dns/xfr.go @@ -1,6 +1,7 @@ package dns import ( + "crypto/tls" "fmt" "time" ) @@ -20,6 +21,7 @@ type Transfer struct { TsigProvider TsigProvider // An implementation of the TsigProvider interface. If defined it replaces TsigSecret and is used for all TSIG operations. TsigSecret map[string]string // Secret(s) for Tsig map[], zonename must be in canonical form (lowercase, fqdn, see RFC 4034 Section 6.2) tsigTimersOnly bool + TLS *tls.Config // TLS config. If Xfr over TLS will be attempted } func (t *Transfer) tsigProvider() TsigProvider { @@ -57,7 +59,11 @@ func (t *Transfer) In(q *Msg, a string) (env chan *Envelope, err error) { } if t.Conn == nil { - t.Conn, err = DialTimeout("tcp", a, timeout) + if t.TLS != nil { + t.Conn, err = DialTimeoutWithTLS("tcp-tls", a, t.TLS, timeout) + } else { + t.Conn, err = DialTimeout("tcp", a, timeout) + } if err != nil { return nil, err } @@ -80,8 +86,13 @@ func (t *Transfer) In(q *Msg, a string) (env chan *Envelope, err error) { func (t *Transfer) inAxfr(q *Msg, c chan *Envelope) { first := true - defer t.Close() - defer close(c) + defer func() { + // First close the connection, then the channel. This allows functions blocked on + // the channel to assume that the connection is closed and no further operations are + // pending when they resume. + t.Close() + close(c) + }() timeout := dnsTimeout if t.ReadTimeout != 0 { timeout = t.ReadTimeout @@ -131,8 +142,13 @@ func (t *Transfer) inIxfr(q *Msg, c chan *Envelope) { axfr := true n := 0 qser := q.Ns[0].(*SOA).Serial - defer t.Close() - defer close(c) + defer func() { + // First close the connection, then the channel. This allows functions blocked on + // the channel to assume that the connection is closed and no further operations are + // pending when they resume. + t.Close() + close(c) + }() timeout := dnsTimeout if t.ReadTimeout != 0 { timeout = t.ReadTimeout @@ -172,7 +188,7 @@ func (t *Transfer) inIxfr(q *Msg, c chan *Envelope) { if v, ok := rr.(*SOA); ok { if v.Serial == serial { n++ - // quit if it's a full axfr or the the servers' SOA is repeated the third time + // quit if it's a full axfr or the servers' SOA is repeated the third time if axfr && n == 2 || n == 3 { c <- &Envelope{in.Answer, nil} return diff --git a/vendor/github.com/miekg/dns/zduplicate.go b/vendor/github.com/miekg/dns/zduplicate.go index 450bbbc..03029fb 100644 --- a/vendor/github.com/miekg/dns/zduplicate.go +++ b/vendor/github.com/miekg/dns/zduplicate.go @@ -481,6 +481,21 @@ func (r1 *IPSECKEY) isDuplicate(_r2 RR) bool { return true } +func (r1 *ISDN) isDuplicate(_r2 RR) bool { + r2, ok := _r2.(*ISDN) + if !ok { + return false + } + _ = r2 + if r1.Address != r2.Address { + return false + } + if r1.SubAddress != r2.SubAddress { + return false + } + return true +} + func (r1 *KEY) isDuplicate(_r2 RR) bool { r2, ok := _r2.(*KEY) if !ok { @@ -871,6 +886,26 @@ func (r1 *NULL) isDuplicate(_r2 RR) bool { return true } +func (r1 *NXT) isDuplicate(_r2 RR) bool { + r2, ok := _r2.(*NXT) + if !ok { + return false + } + _ = r2 + if !isDuplicateName(r1.NextDomain, r2.NextDomain) { + return false + } + if len(r1.TypeBitMap) != len(r2.TypeBitMap) { + return false + } + for i := 0; i < len(r1.TypeBitMap); i++ { + if r1.TypeBitMap[i] != r2.TypeBitMap[i] { + return false + } + } + return true +} + func (r1 *OPENPGPKEY) isDuplicate(_r2 RR) bool { r2, ok := _r2.(*OPENPGPKEY) if !ok { diff --git a/vendor/github.com/miekg/dns/zmsg.go b/vendor/github.com/miekg/dns/zmsg.go index 3ea0eb4..39b3bc8 100644 --- a/vendor/github.com/miekg/dns/zmsg.go +++ b/vendor/github.com/miekg/dns/zmsg.go @@ -372,6 +372,18 @@ func (rr *IPSECKEY) pack(msg []byte, off int, compression compressionMap, compre return off, nil } +func (rr *ISDN) pack(msg []byte, off int, compression compressionMap, compress bool) (off1 int, err error) { + off, err = packString(rr.Address, msg, off) + if err != nil { + return off, err + } + off, err = packString(rr.SubAddress, msg, off) + if err != nil { + return off, err + } + return off, nil +} + func (rr *KEY) pack(msg []byte, off int, compression compressionMap, compress bool) (off1 int, err error) { off, err = packUint16(rr.Flags, msg, off) if err != nil { @@ -694,6 +706,18 @@ func (rr *NULL) pack(msg []byte, off int, compression compressionMap, compress b return off, nil } +func (rr *NXT) pack(msg []byte, off int, compression compressionMap, compress bool) (off1 int, err error) { + off, err = packDomainName(rr.NextDomain, msg, off, compression, false) + if err != nil { + return off, err + } + off, err = packDataNsec(rr.TypeBitMap, msg, off) + if err != nil { + return off, err + } + return off, nil +} + func (rr *OPENPGPKEY) pack(msg []byte, off int, compression compressionMap, compress bool) (off1 int, err error) { off, err = packStringBase64(rr.PublicKey, msg, off) if err != nil { @@ -1746,6 +1770,24 @@ func (rr *IPSECKEY) unpack(msg []byte, off int) (off1 int, err error) { return off, nil } +func (rr *ISDN) unpack(msg []byte, off int) (off1 int, err error) { + rdStart := off + _ = rdStart + + rr.Address, off, err = unpackString(msg, off) + if err != nil { + return off, err + } + if off == len(msg) { + return off, nil + } + rr.SubAddress, off, err = unpackString(msg, off) + if err != nil { + return off, err + } + return off, nil +} + func (rr *KEY) unpack(msg []byte, off int) (off1 int, err error) { rdStart := off _ = rdStart @@ -2224,6 +2266,24 @@ func (rr *NULL) unpack(msg []byte, off int) (off1 int, err error) { return off, nil } +func (rr *NXT) unpack(msg []byte, off int) (off1 int, err error) { + rdStart := off + _ = rdStart + + rr.NextDomain, off, err = UnpackDomainName(msg, off) + if err != nil { + return off, err + } + if off == len(msg) { + return off, nil + } + rr.TypeBitMap, off, err = unpackDataNsec(msg, off) + if err != nil { + return off, err + } + return off, nil +} + func (rr *OPENPGPKEY) unpack(msg []byte, off int) (off1 int, err error) { rdStart := off _ = rdStart diff --git a/vendor/github.com/miekg/dns/ztypes.go b/vendor/github.com/miekg/dns/ztypes.go index 1b6f432..2c70fc4 100644 --- a/vendor/github.com/miekg/dns/ztypes.go +++ b/vendor/github.com/miekg/dns/ztypes.go @@ -36,6 +36,7 @@ var TypeToRR = map[uint16]func() RR{ TypeHIP: func() RR { return new(HIP) }, TypeHTTPS: func() RR { return new(HTTPS) }, TypeIPSECKEY: func() RR { return new(IPSECKEY) }, + TypeISDN: func() RR { return new(ISDN) }, TypeKEY: func() RR { return new(KEY) }, TypeKX: func() RR { return new(KX) }, TypeL32: func() RR { return new(L32) }, @@ -59,6 +60,7 @@ var TypeToRR = map[uint16]func() RR{ TypeNSEC3: func() RR { return new(NSEC3) }, TypeNSEC3PARAM: func() RR { return new(NSEC3PARAM) }, TypeNULL: func() RR { return new(NULL) }, + TypeNXT: func() RR { return new(NXT) }, TypeOPENPGPKEY: func() RR { return new(OPENPGPKEY) }, TypeOPT: func() RR { return new(OPT) }, TypePTR: func() RR { return new(PTR) }, @@ -204,6 +206,7 @@ func (rr *HINFO) Header() *RR_Header { return &rr.Hdr } func (rr *HIP) Header() *RR_Header { return &rr.Hdr } func (rr *HTTPS) Header() *RR_Header { return &rr.Hdr } func (rr *IPSECKEY) Header() *RR_Header { return &rr.Hdr } +func (rr *ISDN) Header() *RR_Header { return &rr.Hdr } func (rr *KEY) Header() *RR_Header { return &rr.Hdr } func (rr *KX) Header() *RR_Header { return &rr.Hdr } func (rr *L32) Header() *RR_Header { return &rr.Hdr } @@ -227,6 +230,7 @@ func (rr *NSEC) Header() *RR_Header { return &rr.Hdr } func (rr *NSEC3) Header() *RR_Header { return &rr.Hdr } func (rr *NSEC3PARAM) Header() *RR_Header { return &rr.Hdr } func (rr *NULL) Header() *RR_Header { return &rr.Hdr } +func (rr *NXT) Header() *RR_Header { return &rr.Hdr } func (rr *OPENPGPKEY) Header() *RR_Header { return &rr.Hdr } func (rr *OPT) Header() *RR_Header { return &rr.Hdr } func (rr *PTR) Header() *RR_Header { return &rr.Hdr } @@ -437,6 +441,13 @@ func (rr *IPSECKEY) len(off int, compression map[string]struct{}) int { return l } +func (rr *ISDN) len(off int, compression map[string]struct{}) int { + l := rr.Hdr.len(off, compression) + l += len(rr.Address) + 1 + l += len(rr.SubAddress) + 1 + return l +} + func (rr *KX) len(off int, compression map[string]struct{}) int { l := rr.Hdr.len(off, compression) l += 2 // Preference @@ -966,6 +977,10 @@ func (rr *IPSECKEY) copy() RR { } } +func (rr *ISDN) copy() RR { + return &ISDN{rr.Hdr, rr.Address, rr.SubAddress} +} + func (rr *KEY) copy() RR { return &KEY{*rr.DNSKEY.copy().(*DNSKEY)} } @@ -1092,6 +1107,10 @@ func (rr *NULL) copy() RR { return &NULL{rr.Hdr, rr.Data} } +func (rr *NXT) copy() RR { + return &NXT{*rr.NSEC.copy().(*NSEC)} +} + func (rr *OPENPGPKEY) copy() RR { return &OPENPGPKEY{rr.Hdr, rr.PublicKey} } diff --git a/vendor/go.uber.org/atomic/.codecov.yml b/vendor/go.uber.org/atomic/.codecov.yml deleted file mode 100644 index 571116c..0000000 --- a/vendor/go.uber.org/atomic/.codecov.yml +++ /dev/null @@ -1,19 +0,0 @@ -coverage: - range: 80..100 - round: down - precision: 2 - - status: - project: # measuring the overall project coverage - default: # context, you can create multiple ones with custom titles - enabled: yes # must be yes|true to enable this status - target: 100 # specify the target coverage for each commit status - # option: "auto" (must increase from parent commit or pull request base) - # option: "X%" a static target percentage to hit - if_not_found: success # if parent is not found report status as success, error, or failure - if_ci_failed: error # if ci fails report status as success, error, or failure - -# Also update COVER_IGNORE_PKGS in the Makefile. -ignore: - - /internal/gen-atomicint/ - - /internal/gen-valuewrapper/ diff --git a/vendor/go.uber.org/atomic/.gitignore b/vendor/go.uber.org/atomic/.gitignore deleted file mode 100644 index 2e337a0..0000000 --- a/vendor/go.uber.org/atomic/.gitignore +++ /dev/null @@ -1,15 +0,0 @@ -/bin -.DS_Store -/vendor -cover.html -cover.out -lint.log - -# Binaries -*.test - -# Profiling output -*.prof - -# Output of fossa analyzer -/fossa diff --git a/vendor/go.uber.org/atomic/CHANGELOG.md b/vendor/go.uber.org/atomic/CHANGELOG.md deleted file mode 100644 index 6f87f33..0000000 --- a/vendor/go.uber.org/atomic/CHANGELOG.md +++ /dev/null @@ -1,127 +0,0 @@ -# Changelog -All notable changes to this project will be documented in this file. - -The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), -and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). - -## [1.11.0] - 2023-05-02 -### Fixed -- Fix initialization of `Value` wrappers. - -### Added -- Add `String` method to `atomic.Pointer[T]` type allowing users to safely print -underlying values of pointers. - -[1.11.0]: https://github.com/uber-go/atomic/compare/v1.10.0...v1.11.0 - -## [1.10.0] - 2022-08-11 -### Added -- Add `atomic.Float32` type for atomic operations on `float32`. -- Add `CompareAndSwap` and `Swap` methods to `atomic.String`, `atomic.Error`, - and `atomic.Value`. -- Add generic `atomic.Pointer[T]` type for atomic operations on pointers of any - type. This is present only for Go 1.18 or higher, and is a drop-in for - replacement for the standard library's `sync/atomic.Pointer` type. - -### Changed -- Deprecate `CAS` methods on all types in favor of corresponding - `CompareAndSwap` methods. - -Thanks to @eNV25 and @icpd for their contributions to this release. - -[1.10.0]: https://github.com/uber-go/atomic/compare/v1.9.0...v1.10.0 - -## [1.9.0] - 2021-07-15 -### Added -- Add `Float64.Swap` to match int atomic operations. -- Add `atomic.Time` type for atomic operations on `time.Time` values. - -[1.9.0]: https://github.com/uber-go/atomic/compare/v1.8.0...v1.9.0 - -## [1.8.0] - 2021-06-09 -### Added -- Add `atomic.Uintptr` type for atomic operations on `uintptr` values. -- Add `atomic.UnsafePointer` type for atomic operations on `unsafe.Pointer` values. - -[1.8.0]: https://github.com/uber-go/atomic/compare/v1.7.0...v1.8.0 - -## [1.7.0] - 2020-09-14 -### Added -- Support JSON serialization and deserialization of primitive atomic types. -- Support Text marshalling and unmarshalling for string atomics. - -### Changed -- Disallow incorrect comparison of atomic values in a non-atomic way. - -### Removed -- Remove dependency on `golang.org/x/{lint, tools}`. - -[1.7.0]: https://github.com/uber-go/atomic/compare/v1.6.0...v1.7.0 - -## [1.6.0] - 2020-02-24 -### Changed -- Drop library dependency on `golang.org/x/{lint, tools}`. - -[1.6.0]: https://github.com/uber-go/atomic/compare/v1.5.1...v1.6.0 - -## [1.5.1] - 2019-11-19 -- Fix bug where `Bool.CAS` and `Bool.Toggle` do work correctly together - causing `CAS` to fail even though the old value matches. - -[1.5.1]: https://github.com/uber-go/atomic/compare/v1.5.0...v1.5.1 - -## [1.5.0] - 2019-10-29 -### Changed -- With Go modules, only the `go.uber.org/atomic` import path is supported now. - If you need to use the old import path, please add a `replace` directive to - your `go.mod`. - -[1.5.0]: https://github.com/uber-go/atomic/compare/v1.4.0...v1.5.0 - -## [1.4.0] - 2019-05-01 -### Added - - Add `atomic.Error` type for atomic operations on `error` values. - -[1.4.0]: https://github.com/uber-go/atomic/compare/v1.3.2...v1.4.0 - -## [1.3.2] - 2018-05-02 -### Added -- Add `atomic.Duration` type for atomic operations on `time.Duration` values. - -[1.3.2]: https://github.com/uber-go/atomic/compare/v1.3.1...v1.3.2 - -## [1.3.1] - 2017-11-14 -### Fixed -- Revert optimization for `atomic.String.Store("")` which caused data races. - -[1.3.1]: https://github.com/uber-go/atomic/compare/v1.3.0...v1.3.1 - -## [1.3.0] - 2017-11-13 -### Added -- Add `atomic.Bool.CAS` for compare-and-swap semantics on bools. - -### Changed -- Optimize `atomic.String.Store("")` by avoiding an allocation. - -[1.3.0]: https://github.com/uber-go/atomic/compare/v1.2.0...v1.3.0 - -## [1.2.0] - 2017-04-12 -### Added -- Shadow `atomic.Value` from `sync/atomic`. - -[1.2.0]: https://github.com/uber-go/atomic/compare/v1.1.0...v1.2.0 - -## [1.1.0] - 2017-03-10 -### Added -- Add atomic `Float64` type. - -### Changed -- Support new `go.uber.org/atomic` import path. - -[1.1.0]: https://github.com/uber-go/atomic/compare/v1.0.0...v1.1.0 - -## [1.0.0] - 2016-07-18 - -- Initial release. - -[1.0.0]: https://github.com/uber-go/atomic/releases/tag/v1.0.0 diff --git a/vendor/go.uber.org/atomic/Makefile b/vendor/go.uber.org/atomic/Makefile deleted file mode 100644 index 46c945b..0000000 --- a/vendor/go.uber.org/atomic/Makefile +++ /dev/null @@ -1,79 +0,0 @@ -# Directory to place `go install`ed binaries into. -export GOBIN ?= $(shell pwd)/bin - -GOLINT = $(GOBIN)/golint -GEN_ATOMICINT = $(GOBIN)/gen-atomicint -GEN_ATOMICWRAPPER = $(GOBIN)/gen-atomicwrapper -STATICCHECK = $(GOBIN)/staticcheck - -GO_FILES ?= $(shell find . '(' -path .git -o -path vendor ')' -prune -o -name '*.go' -print) - -# Also update ignore section in .codecov.yml. -COVER_IGNORE_PKGS = \ - go.uber.org/atomic/internal/gen-atomicint \ - go.uber.org/atomic/internal/gen-atomicwrapper - -.PHONY: build -build: - go build ./... - -.PHONY: test -test: - go test -race ./... - -.PHONY: gofmt -gofmt: - $(eval FMT_LOG := $(shell mktemp -t gofmt.XXXXX)) - gofmt -e -s -l $(GO_FILES) > $(FMT_LOG) || true - @[ ! -s "$(FMT_LOG)" ] || (echo "gofmt failed:" && cat $(FMT_LOG) && false) - -$(GOLINT): - cd tools && go install golang.org/x/lint/golint - -$(STATICCHECK): - cd tools && go install honnef.co/go/tools/cmd/staticcheck - -$(GEN_ATOMICWRAPPER): $(wildcard ./internal/gen-atomicwrapper/*) - go build -o $@ ./internal/gen-atomicwrapper - -$(GEN_ATOMICINT): $(wildcard ./internal/gen-atomicint/*) - go build -o $@ ./internal/gen-atomicint - -.PHONY: golint -golint: $(GOLINT) - $(GOLINT) ./... - -.PHONY: staticcheck -staticcheck: $(STATICCHECK) - $(STATICCHECK) ./... - -.PHONY: lint -lint: gofmt golint staticcheck generatenodirty - -# comma separated list of packages to consider for code coverage. -COVER_PKG = $(shell \ - go list -find ./... | \ - grep -v $(foreach pkg,$(COVER_IGNORE_PKGS),-e "^$(pkg)$$") | \ - paste -sd, -) - -.PHONY: cover -cover: - go test -coverprofile=cover.out -coverpkg $(COVER_PKG) -v ./... - go tool cover -html=cover.out -o cover.html - -.PHONY: generate -generate: $(GEN_ATOMICINT) $(GEN_ATOMICWRAPPER) - go generate ./... - -.PHONY: generatenodirty -generatenodirty: - @[ -z "$$(git status --porcelain)" ] || ( \ - echo "Working tree is dirty. Commit your changes first."; \ - git status; \ - exit 1 ) - @make generate - @status=$$(git status --porcelain); \ - [ -z "$$status" ] || ( \ - echo "Working tree is dirty after `make generate`:"; \ - echo "$$status"; \ - echo "Please ensure that the generated code is up-to-date." ) diff --git a/vendor/go.uber.org/atomic/README.md b/vendor/go.uber.org/atomic/README.md deleted file mode 100644 index 96b47a1..0000000 --- a/vendor/go.uber.org/atomic/README.md +++ /dev/null @@ -1,63 +0,0 @@ -# atomic [![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] [![Go Report Card][reportcard-img]][reportcard] - -Simple wrappers for primitive types to enforce atomic access. - -## Installation - -```shell -$ go get -u go.uber.org/atomic@v1 -``` - -### Legacy Import Path - -As of v1.5.0, the import path `go.uber.org/atomic` is the only supported way -of using this package. If you are using Go modules, this package will fail to -compile with the legacy import path path `github.com/uber-go/atomic`. - -We recommend migrating your code to the new import path but if you're unable -to do so, or if your dependencies are still using the old import path, you -will have to add a `replace` directive to your `go.mod` file downgrading the -legacy import path to an older version. - -``` -replace github.com/uber-go/atomic => github.com/uber-go/atomic v1.4.0 -``` - -You can do so automatically by running the following command. - -```shell -$ go mod edit -replace github.com/uber-go/atomic=github.com/uber-go/atomic@v1.4.0 -``` - -## Usage - -The standard library's `sync/atomic` is powerful, but it's easy to forget which -variables must be accessed atomically. `go.uber.org/atomic` preserves all the -functionality of the standard library, but wraps the primitive types to -provide a safer, more convenient API. - -```go -var atom atomic.Uint32 -atom.Store(42) -atom.Sub(2) -atom.CAS(40, 11) -``` - -See the [documentation][doc] for a complete API specification. - -## Development Status - -Stable. - ---- - -Released under the [MIT License](LICENSE.txt). - -[doc-img]: https://godoc.org/github.com/uber-go/atomic?status.svg -[doc]: https://godoc.org/go.uber.org/atomic -[ci-img]: https://github.com/uber-go/atomic/actions/workflows/go.yml/badge.svg -[ci]: https://github.com/uber-go/atomic/actions/workflows/go.yml -[cov-img]: https://codecov.io/gh/uber-go/atomic/branch/master/graph/badge.svg -[cov]: https://codecov.io/gh/uber-go/atomic -[reportcard-img]: https://goreportcard.com/badge/go.uber.org/atomic -[reportcard]: https://goreportcard.com/report/go.uber.org/atomic diff --git a/vendor/go.uber.org/atomic/bool.go b/vendor/go.uber.org/atomic/bool.go deleted file mode 100644 index f0a2ddd..0000000 --- a/vendor/go.uber.org/atomic/bool.go +++ /dev/null @@ -1,88 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" -) - -// Bool is an atomic type-safe wrapper for bool values. -type Bool struct { - _ nocmp // disallow non-atomic comparison - - v Uint32 -} - -var _zeroBool bool - -// NewBool creates a new Bool. -func NewBool(val bool) *Bool { - x := &Bool{} - if val != _zeroBool { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped bool. -func (x *Bool) Load() bool { - return truthy(x.v.Load()) -} - -// Store atomically stores the passed bool. -func (x *Bool) Store(val bool) { - x.v.Store(boolToInt(val)) -} - -// CAS is an atomic compare-and-swap for bool values. -// -// Deprecated: Use CompareAndSwap. -func (x *Bool) CAS(old, new bool) (swapped bool) { - return x.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap for bool values. -func (x *Bool) CompareAndSwap(old, new bool) (swapped bool) { - return x.v.CompareAndSwap(boolToInt(old), boolToInt(new)) -} - -// Swap atomically stores the given bool and returns the old -// value. -func (x *Bool) Swap(val bool) (old bool) { - return truthy(x.v.Swap(boolToInt(val))) -} - -// MarshalJSON encodes the wrapped bool into JSON. -func (x *Bool) MarshalJSON() ([]byte, error) { - return json.Marshal(x.Load()) -} - -// UnmarshalJSON decodes a bool from JSON. -func (x *Bool) UnmarshalJSON(b []byte) error { - var v bool - if err := json.Unmarshal(b, &v); err != nil { - return err - } - x.Store(v) - return nil -} diff --git a/vendor/go.uber.org/atomic/doc.go b/vendor/go.uber.org/atomic/doc.go deleted file mode 100644 index ae7390e..0000000 --- a/vendor/go.uber.org/atomic/doc.go +++ /dev/null @@ -1,23 +0,0 @@ -// Copyright (c) 2020 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -// Package atomic provides simple wrappers around numerics to enforce atomic -// access. -package atomic diff --git a/vendor/go.uber.org/atomic/duration.go b/vendor/go.uber.org/atomic/duration.go deleted file mode 100644 index 7c23868..0000000 --- a/vendor/go.uber.org/atomic/duration.go +++ /dev/null @@ -1,89 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "time" -) - -// Duration is an atomic type-safe wrapper for time.Duration values. -type Duration struct { - _ nocmp // disallow non-atomic comparison - - v Int64 -} - -var _zeroDuration time.Duration - -// NewDuration creates a new Duration. -func NewDuration(val time.Duration) *Duration { - x := &Duration{} - if val != _zeroDuration { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped time.Duration. -func (x *Duration) Load() time.Duration { - return time.Duration(x.v.Load()) -} - -// Store atomically stores the passed time.Duration. -func (x *Duration) Store(val time.Duration) { - x.v.Store(int64(val)) -} - -// CAS is an atomic compare-and-swap for time.Duration values. -// -// Deprecated: Use CompareAndSwap. -func (x *Duration) CAS(old, new time.Duration) (swapped bool) { - return x.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap for time.Duration values. -func (x *Duration) CompareAndSwap(old, new time.Duration) (swapped bool) { - return x.v.CompareAndSwap(int64(old), int64(new)) -} - -// Swap atomically stores the given time.Duration and returns the old -// value. -func (x *Duration) Swap(val time.Duration) (old time.Duration) { - return time.Duration(x.v.Swap(int64(val))) -} - -// MarshalJSON encodes the wrapped time.Duration into JSON. -func (x *Duration) MarshalJSON() ([]byte, error) { - return json.Marshal(x.Load()) -} - -// UnmarshalJSON decodes a time.Duration from JSON. -func (x *Duration) UnmarshalJSON(b []byte) error { - var v time.Duration - if err := json.Unmarshal(b, &v); err != nil { - return err - } - x.Store(v) - return nil -} diff --git a/vendor/go.uber.org/atomic/duration_ext.go b/vendor/go.uber.org/atomic/duration_ext.go deleted file mode 100644 index 4c18b0a..0000000 --- a/vendor/go.uber.org/atomic/duration_ext.go +++ /dev/null @@ -1,40 +0,0 @@ -// Copyright (c) 2020 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import "time" - -//go:generate bin/gen-atomicwrapper -name=Duration -type=time.Duration -wrapped=Int64 -pack=int64 -unpack=time.Duration -cas -swap -json -imports time -file=duration.go - -// Add atomically adds to the wrapped time.Duration and returns the new value. -func (d *Duration) Add(delta time.Duration) time.Duration { - return time.Duration(d.v.Add(int64(delta))) -} - -// Sub atomically subtracts from the wrapped time.Duration and returns the new value. -func (d *Duration) Sub(delta time.Duration) time.Duration { - return time.Duration(d.v.Sub(int64(delta))) -} - -// String encodes the wrapped value as a string. -func (d *Duration) String() string { - return d.Load().String() -} diff --git a/vendor/go.uber.org/atomic/error.go b/vendor/go.uber.org/atomic/error.go deleted file mode 100644 index b7e3f12..0000000 --- a/vendor/go.uber.org/atomic/error.go +++ /dev/null @@ -1,72 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -// Error is an atomic type-safe wrapper for error values. -type Error struct { - _ nocmp // disallow non-atomic comparison - - v Value -} - -var _zeroError error - -// NewError creates a new Error. -func NewError(val error) *Error { - x := &Error{} - if val != _zeroError { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped error. -func (x *Error) Load() error { - return unpackError(x.v.Load()) -} - -// Store atomically stores the passed error. -func (x *Error) Store(val error) { - x.v.Store(packError(val)) -} - -// CompareAndSwap is an atomic compare-and-swap for error values. -func (x *Error) CompareAndSwap(old, new error) (swapped bool) { - if x.v.CompareAndSwap(packError(old), packError(new)) { - return true - } - - if old == _zeroError { - // If the old value is the empty value, then it's possible the - // underlying Value hasn't been set and is nil, so retry with nil. - return x.v.CompareAndSwap(nil, packError(new)) - } - - return false -} - -// Swap atomically stores the given error and returns the old -// value. -func (x *Error) Swap(val error) (old error) { - return unpackError(x.v.Swap(packError(val))) -} diff --git a/vendor/go.uber.org/atomic/error_ext.go b/vendor/go.uber.org/atomic/error_ext.go deleted file mode 100644 index d31fb63..0000000 --- a/vendor/go.uber.org/atomic/error_ext.go +++ /dev/null @@ -1,39 +0,0 @@ -// Copyright (c) 2020-2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -// atomic.Value panics on nil inputs, or if the underlying type changes. -// Stabilize by always storing a custom struct that we control. - -//go:generate bin/gen-atomicwrapper -name=Error -type=error -wrapped=Value -pack=packError -unpack=unpackError -compareandswap -swap -file=error.go - -type packedError struct{ Value error } - -func packError(v error) interface{} { - return packedError{v} -} - -func unpackError(v interface{}) error { - if err, ok := v.(packedError); ok { - return err.Value - } - return nil -} diff --git a/vendor/go.uber.org/atomic/float32.go b/vendor/go.uber.org/atomic/float32.go deleted file mode 100644 index 62c3633..0000000 --- a/vendor/go.uber.org/atomic/float32.go +++ /dev/null @@ -1,77 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "math" -) - -// Float32 is an atomic type-safe wrapper for float32 values. -type Float32 struct { - _ nocmp // disallow non-atomic comparison - - v Uint32 -} - -var _zeroFloat32 float32 - -// NewFloat32 creates a new Float32. -func NewFloat32(val float32) *Float32 { - x := &Float32{} - if val != _zeroFloat32 { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped float32. -func (x *Float32) Load() float32 { - return math.Float32frombits(x.v.Load()) -} - -// Store atomically stores the passed float32. -func (x *Float32) Store(val float32) { - x.v.Store(math.Float32bits(val)) -} - -// Swap atomically stores the given float32 and returns the old -// value. -func (x *Float32) Swap(val float32) (old float32) { - return math.Float32frombits(x.v.Swap(math.Float32bits(val))) -} - -// MarshalJSON encodes the wrapped float32 into JSON. -func (x *Float32) MarshalJSON() ([]byte, error) { - return json.Marshal(x.Load()) -} - -// UnmarshalJSON decodes a float32 from JSON. -func (x *Float32) UnmarshalJSON(b []byte) error { - var v float32 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - x.Store(v) - return nil -} diff --git a/vendor/go.uber.org/atomic/float32_ext.go b/vendor/go.uber.org/atomic/float32_ext.go deleted file mode 100644 index b0cd8d9..0000000 --- a/vendor/go.uber.org/atomic/float32_ext.go +++ /dev/null @@ -1,76 +0,0 @@ -// Copyright (c) 2020-2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "math" - "strconv" -) - -//go:generate bin/gen-atomicwrapper -name=Float32 -type=float32 -wrapped=Uint32 -pack=math.Float32bits -unpack=math.Float32frombits -swap -json -imports math -file=float32.go - -// Add atomically adds to the wrapped float32 and returns the new value. -func (f *Float32) Add(delta float32) float32 { - for { - old := f.Load() - new := old + delta - if f.CAS(old, new) { - return new - } - } -} - -// Sub atomically subtracts from the wrapped float32 and returns the new value. -func (f *Float32) Sub(delta float32) float32 { - return f.Add(-delta) -} - -// CAS is an atomic compare-and-swap for float32 values. -// -// Deprecated: Use CompareAndSwap -func (f *Float32) CAS(old, new float32) (swapped bool) { - return f.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap for float32 values. -// -// Note: CompareAndSwap handles NaN incorrectly. NaN != NaN using Go's inbuilt operators -// but CompareAndSwap allows a stored NaN to compare equal to a passed in NaN. -// This avoids typical CompareAndSwap loops from blocking forever, e.g., -// -// for { -// old := atom.Load() -// new = f(old) -// if atom.CompareAndSwap(old, new) { -// break -// } -// } -// -// If CompareAndSwap did not match NaN to match, then the above would loop forever. -func (f *Float32) CompareAndSwap(old, new float32) (swapped bool) { - return f.v.CompareAndSwap(math.Float32bits(old), math.Float32bits(new)) -} - -// String encodes the wrapped value as a string. -func (f *Float32) String() string { - // 'g' is the behavior for floats with %v. - return strconv.FormatFloat(float64(f.Load()), 'g', -1, 32) -} diff --git a/vendor/go.uber.org/atomic/float64.go b/vendor/go.uber.org/atomic/float64.go deleted file mode 100644 index 5bc11ca..0000000 --- a/vendor/go.uber.org/atomic/float64.go +++ /dev/null @@ -1,77 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "math" -) - -// Float64 is an atomic type-safe wrapper for float64 values. -type Float64 struct { - _ nocmp // disallow non-atomic comparison - - v Uint64 -} - -var _zeroFloat64 float64 - -// NewFloat64 creates a new Float64. -func NewFloat64(val float64) *Float64 { - x := &Float64{} - if val != _zeroFloat64 { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped float64. -func (x *Float64) Load() float64 { - return math.Float64frombits(x.v.Load()) -} - -// Store atomically stores the passed float64. -func (x *Float64) Store(val float64) { - x.v.Store(math.Float64bits(val)) -} - -// Swap atomically stores the given float64 and returns the old -// value. -func (x *Float64) Swap(val float64) (old float64) { - return math.Float64frombits(x.v.Swap(math.Float64bits(val))) -} - -// MarshalJSON encodes the wrapped float64 into JSON. -func (x *Float64) MarshalJSON() ([]byte, error) { - return json.Marshal(x.Load()) -} - -// UnmarshalJSON decodes a float64 from JSON. -func (x *Float64) UnmarshalJSON(b []byte) error { - var v float64 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - x.Store(v) - return nil -} diff --git a/vendor/go.uber.org/atomic/float64_ext.go b/vendor/go.uber.org/atomic/float64_ext.go deleted file mode 100644 index 48c52b0..0000000 --- a/vendor/go.uber.org/atomic/float64_ext.go +++ /dev/null @@ -1,76 +0,0 @@ -// Copyright (c) 2020-2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "math" - "strconv" -) - -//go:generate bin/gen-atomicwrapper -name=Float64 -type=float64 -wrapped=Uint64 -pack=math.Float64bits -unpack=math.Float64frombits -swap -json -imports math -file=float64.go - -// Add atomically adds to the wrapped float64 and returns the new value. -func (f *Float64) Add(delta float64) float64 { - for { - old := f.Load() - new := old + delta - if f.CAS(old, new) { - return new - } - } -} - -// Sub atomically subtracts from the wrapped float64 and returns the new value. -func (f *Float64) Sub(delta float64) float64 { - return f.Add(-delta) -} - -// CAS is an atomic compare-and-swap for float64 values. -// -// Deprecated: Use CompareAndSwap -func (f *Float64) CAS(old, new float64) (swapped bool) { - return f.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap for float64 values. -// -// Note: CompareAndSwap handles NaN incorrectly. NaN != NaN using Go's inbuilt operators -// but CompareAndSwap allows a stored NaN to compare equal to a passed in NaN. -// This avoids typical CompareAndSwap loops from blocking forever, e.g., -// -// for { -// old := atom.Load() -// new = f(old) -// if atom.CompareAndSwap(old, new) { -// break -// } -// } -// -// If CompareAndSwap did not match NaN to match, then the above would loop forever. -func (f *Float64) CompareAndSwap(old, new float64) (swapped bool) { - return f.v.CompareAndSwap(math.Float64bits(old), math.Float64bits(new)) -} - -// String encodes the wrapped value as a string. -func (f *Float64) String() string { - // 'g' is the behavior for floats with %v. - return strconv.FormatFloat(f.Load(), 'g', -1, 64) -} diff --git a/vendor/go.uber.org/atomic/gen.go b/vendor/go.uber.org/atomic/gen.go deleted file mode 100644 index 1e9ef4f..0000000 --- a/vendor/go.uber.org/atomic/gen.go +++ /dev/null @@ -1,27 +0,0 @@ -// Copyright (c) 2020 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -//go:generate bin/gen-atomicint -name=Int32 -wrapped=int32 -file=int32.go -//go:generate bin/gen-atomicint -name=Int64 -wrapped=int64 -file=int64.go -//go:generate bin/gen-atomicint -name=Uint32 -wrapped=uint32 -unsigned -file=uint32.go -//go:generate bin/gen-atomicint -name=Uint64 -wrapped=uint64 -unsigned -file=uint64.go -//go:generate bin/gen-atomicint -name=Uintptr -wrapped=uintptr -unsigned -file=uintptr.go diff --git a/vendor/go.uber.org/atomic/int32.go b/vendor/go.uber.org/atomic/int32.go deleted file mode 100644 index 5320eac..0000000 --- a/vendor/go.uber.org/atomic/int32.go +++ /dev/null @@ -1,109 +0,0 @@ -// @generated Code generated by gen-atomicint. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "strconv" - "sync/atomic" -) - -// Int32 is an atomic wrapper around int32. -type Int32 struct { - _ nocmp // disallow non-atomic comparison - - v int32 -} - -// NewInt32 creates a new Int32. -func NewInt32(val int32) *Int32 { - return &Int32{v: val} -} - -// Load atomically loads the wrapped value. -func (i *Int32) Load() int32 { - return atomic.LoadInt32(&i.v) -} - -// Add atomically adds to the wrapped int32 and returns the new value. -func (i *Int32) Add(delta int32) int32 { - return atomic.AddInt32(&i.v, delta) -} - -// Sub atomically subtracts from the wrapped int32 and returns the new value. -func (i *Int32) Sub(delta int32) int32 { - return atomic.AddInt32(&i.v, -delta) -} - -// Inc atomically increments the wrapped int32 and returns the new value. -func (i *Int32) Inc() int32 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped int32 and returns the new value. -func (i *Int32) Dec() int32 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap. -func (i *Int32) CAS(old, new int32) (swapped bool) { - return i.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (i *Int32) CompareAndSwap(old, new int32) (swapped bool) { - return atomic.CompareAndSwapInt32(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Int32) Store(val int32) { - atomic.StoreInt32(&i.v, val) -} - -// Swap atomically swaps the wrapped int32 and returns the old value. -func (i *Int32) Swap(val int32) (old int32) { - return atomic.SwapInt32(&i.v, val) -} - -// MarshalJSON encodes the wrapped int32 into JSON. -func (i *Int32) MarshalJSON() ([]byte, error) { - return json.Marshal(i.Load()) -} - -// UnmarshalJSON decodes JSON into the wrapped int32. -func (i *Int32) UnmarshalJSON(b []byte) error { - var v int32 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - i.Store(v) - return nil -} - -// String encodes the wrapped value as a string. -func (i *Int32) String() string { - v := i.Load() - return strconv.FormatInt(int64(v), 10) -} diff --git a/vendor/go.uber.org/atomic/int64.go b/vendor/go.uber.org/atomic/int64.go deleted file mode 100644 index 460821d..0000000 --- a/vendor/go.uber.org/atomic/int64.go +++ /dev/null @@ -1,109 +0,0 @@ -// @generated Code generated by gen-atomicint. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "strconv" - "sync/atomic" -) - -// Int64 is an atomic wrapper around int64. -type Int64 struct { - _ nocmp // disallow non-atomic comparison - - v int64 -} - -// NewInt64 creates a new Int64. -func NewInt64(val int64) *Int64 { - return &Int64{v: val} -} - -// Load atomically loads the wrapped value. -func (i *Int64) Load() int64 { - return atomic.LoadInt64(&i.v) -} - -// Add atomically adds to the wrapped int64 and returns the new value. -func (i *Int64) Add(delta int64) int64 { - return atomic.AddInt64(&i.v, delta) -} - -// Sub atomically subtracts from the wrapped int64 and returns the new value. -func (i *Int64) Sub(delta int64) int64 { - return atomic.AddInt64(&i.v, -delta) -} - -// Inc atomically increments the wrapped int64 and returns the new value. -func (i *Int64) Inc() int64 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped int64 and returns the new value. -func (i *Int64) Dec() int64 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap. -func (i *Int64) CAS(old, new int64) (swapped bool) { - return i.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (i *Int64) CompareAndSwap(old, new int64) (swapped bool) { - return atomic.CompareAndSwapInt64(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Int64) Store(val int64) { - atomic.StoreInt64(&i.v, val) -} - -// Swap atomically swaps the wrapped int64 and returns the old value. -func (i *Int64) Swap(val int64) (old int64) { - return atomic.SwapInt64(&i.v, val) -} - -// MarshalJSON encodes the wrapped int64 into JSON. -func (i *Int64) MarshalJSON() ([]byte, error) { - return json.Marshal(i.Load()) -} - -// UnmarshalJSON decodes JSON into the wrapped int64. -func (i *Int64) UnmarshalJSON(b []byte) error { - var v int64 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - i.Store(v) - return nil -} - -// String encodes the wrapped value as a string. -func (i *Int64) String() string { - v := i.Load() - return strconv.FormatInt(int64(v), 10) -} diff --git a/vendor/go.uber.org/atomic/nocmp.go b/vendor/go.uber.org/atomic/nocmp.go deleted file mode 100644 index 54b7417..0000000 --- a/vendor/go.uber.org/atomic/nocmp.go +++ /dev/null @@ -1,35 +0,0 @@ -// Copyright (c) 2020 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -// nocmp is an uncomparable struct. Embed this inside another struct to make -// it uncomparable. -// -// type Foo struct { -// nocmp -// // ... -// } -// -// This DOES NOT: -// -// - Disallow shallow copies of structs -// - Disallow comparison of pointers to uncomparable structs -type nocmp [0]func() diff --git a/vendor/go.uber.org/atomic/pointer_go118.go b/vendor/go.uber.org/atomic/pointer_go118.go deleted file mode 100644 index 1fb6c03..0000000 --- a/vendor/go.uber.org/atomic/pointer_go118.go +++ /dev/null @@ -1,31 +0,0 @@ -// Copyright (c) 2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -//go:build go1.18 -// +build go1.18 - -package atomic - -import "fmt" - -// String returns a human readable representation of a Pointer's underlying value. -func (p *Pointer[T]) String() string { - return fmt.Sprint(p.Load()) -} diff --git a/vendor/go.uber.org/atomic/pointer_go118_pre119.go b/vendor/go.uber.org/atomic/pointer_go118_pre119.go deleted file mode 100644 index e0f47db..0000000 --- a/vendor/go.uber.org/atomic/pointer_go118_pre119.go +++ /dev/null @@ -1,60 +0,0 @@ -// Copyright (c) 2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -//go:build go1.18 && !go1.19 -// +build go1.18,!go1.19 - -package atomic - -import "unsafe" - -type Pointer[T any] struct { - _ nocmp // disallow non-atomic comparison - p UnsafePointer -} - -// NewPointer creates a new Pointer. -func NewPointer[T any](v *T) *Pointer[T] { - var p Pointer[T] - if v != nil { - p.p.Store(unsafe.Pointer(v)) - } - return &p -} - -// Load atomically loads the wrapped value. -func (p *Pointer[T]) Load() *T { - return (*T)(p.p.Load()) -} - -// Store atomically stores the passed value. -func (p *Pointer[T]) Store(val *T) { - p.p.Store(unsafe.Pointer(val)) -} - -// Swap atomically swaps the wrapped pointer and returns the old value. -func (p *Pointer[T]) Swap(val *T) (old *T) { - return (*T)(p.p.Swap(unsafe.Pointer(val))) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (p *Pointer[T]) CompareAndSwap(old, new *T) (swapped bool) { - return p.p.CompareAndSwap(unsafe.Pointer(old), unsafe.Pointer(new)) -} diff --git a/vendor/go.uber.org/atomic/pointer_go119.go b/vendor/go.uber.org/atomic/pointer_go119.go deleted file mode 100644 index 6726f17..0000000 --- a/vendor/go.uber.org/atomic/pointer_go119.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright (c) 2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -//go:build go1.19 -// +build go1.19 - -package atomic - -import "sync/atomic" - -// Pointer is an atomic pointer of type *T. -type Pointer[T any] struct { - _ nocmp // disallow non-atomic comparison - p atomic.Pointer[T] -} - -// NewPointer creates a new Pointer. -func NewPointer[T any](v *T) *Pointer[T] { - var p Pointer[T] - if v != nil { - p.p.Store(v) - } - return &p -} - -// Load atomically loads the wrapped value. -func (p *Pointer[T]) Load() *T { - return p.p.Load() -} - -// Store atomically stores the passed value. -func (p *Pointer[T]) Store(val *T) { - p.p.Store(val) -} - -// Swap atomically swaps the wrapped pointer and returns the old value. -func (p *Pointer[T]) Swap(val *T) (old *T) { - return p.p.Swap(val) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (p *Pointer[T]) CompareAndSwap(old, new *T) (swapped bool) { - return p.p.CompareAndSwap(old, new) -} diff --git a/vendor/go.uber.org/atomic/string.go b/vendor/go.uber.org/atomic/string.go deleted file mode 100644 index 061466c..0000000 --- a/vendor/go.uber.org/atomic/string.go +++ /dev/null @@ -1,72 +0,0 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -// String is an atomic type-safe wrapper for string values. -type String struct { - _ nocmp // disallow non-atomic comparison - - v Value -} - -var _zeroString string - -// NewString creates a new String. -func NewString(val string) *String { - x := &String{} - if val != _zeroString { - x.Store(val) - } - return x -} - -// Load atomically loads the wrapped string. -func (x *String) Load() string { - return unpackString(x.v.Load()) -} - -// Store atomically stores the passed string. -func (x *String) Store(val string) { - x.v.Store(packString(val)) -} - -// CompareAndSwap is an atomic compare-and-swap for string values. -func (x *String) CompareAndSwap(old, new string) (swapped bool) { - if x.v.CompareAndSwap(packString(old), packString(new)) { - return true - } - - if old == _zeroString { - // If the old value is the empty value, then it's possible the - // underlying Value hasn't been set and is nil, so retry with nil. - return x.v.CompareAndSwap(nil, packString(new)) - } - - return false -} - -// Swap atomically stores the given string and returns the old -// value. -func (x *String) Swap(val string) (old string) { - return unpackString(x.v.Swap(packString(val))) -} diff --git a/vendor/go.uber.org/atomic/string_ext.go b/vendor/go.uber.org/atomic/string_ext.go deleted file mode 100644 index 019109c..0000000 --- a/vendor/go.uber.org/atomic/string_ext.go +++ /dev/null @@ -1,54 +0,0 @@ -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -//go:generate bin/gen-atomicwrapper -name=String -type=string -wrapped Value -pack packString -unpack unpackString -compareandswap -swap -file=string.go - -func packString(s string) interface{} { - return s -} - -func unpackString(v interface{}) string { - if s, ok := v.(string); ok { - return s - } - return "" -} - -// String returns the wrapped value. -func (s *String) String() string { - return s.Load() -} - -// MarshalText encodes the wrapped string into a textual form. -// -// This makes it encodable as JSON, YAML, XML, and more. -func (s *String) MarshalText() ([]byte, error) { - return []byte(s.Load()), nil -} - -// UnmarshalText decodes text and replaces the wrapped string with it. -// -// This makes it decodable from JSON, YAML, XML, and more. -func (s *String) UnmarshalText(b []byte) error { - s.Store(string(b)) - return nil -} diff --git a/vendor/go.uber.org/atomic/time_ext.go b/vendor/go.uber.org/atomic/time_ext.go deleted file mode 100644 index 1e3dc97..0000000 --- a/vendor/go.uber.org/atomic/time_ext.go +++ /dev/null @@ -1,36 +0,0 @@ -// Copyright (c) 2021 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import "time" - -//go:generate bin/gen-atomicwrapper -name=Time -type=time.Time -wrapped=Value -pack=packTime -unpack=unpackTime -imports time -file=time.go - -func packTime(t time.Time) interface{} { - return t -} - -func unpackTime(v interface{}) time.Time { - if t, ok := v.(time.Time); ok { - return t - } - return time.Time{} -} diff --git a/vendor/go.uber.org/atomic/uint32.go b/vendor/go.uber.org/atomic/uint32.go deleted file mode 100644 index 4adc294..0000000 --- a/vendor/go.uber.org/atomic/uint32.go +++ /dev/null @@ -1,109 +0,0 @@ -// @generated Code generated by gen-atomicint. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "strconv" - "sync/atomic" -) - -// Uint32 is an atomic wrapper around uint32. -type Uint32 struct { - _ nocmp // disallow non-atomic comparison - - v uint32 -} - -// NewUint32 creates a new Uint32. -func NewUint32(val uint32) *Uint32 { - return &Uint32{v: val} -} - -// Load atomically loads the wrapped value. -func (i *Uint32) Load() uint32 { - return atomic.LoadUint32(&i.v) -} - -// Add atomically adds to the wrapped uint32 and returns the new value. -func (i *Uint32) Add(delta uint32) uint32 { - return atomic.AddUint32(&i.v, delta) -} - -// Sub atomically subtracts from the wrapped uint32 and returns the new value. -func (i *Uint32) Sub(delta uint32) uint32 { - return atomic.AddUint32(&i.v, ^(delta - 1)) -} - -// Inc atomically increments the wrapped uint32 and returns the new value. -func (i *Uint32) Inc() uint32 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped uint32 and returns the new value. -func (i *Uint32) Dec() uint32 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap. -func (i *Uint32) CAS(old, new uint32) (swapped bool) { - return i.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (i *Uint32) CompareAndSwap(old, new uint32) (swapped bool) { - return atomic.CompareAndSwapUint32(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Uint32) Store(val uint32) { - atomic.StoreUint32(&i.v, val) -} - -// Swap atomically swaps the wrapped uint32 and returns the old value. -func (i *Uint32) Swap(val uint32) (old uint32) { - return atomic.SwapUint32(&i.v, val) -} - -// MarshalJSON encodes the wrapped uint32 into JSON. -func (i *Uint32) MarshalJSON() ([]byte, error) { - return json.Marshal(i.Load()) -} - -// UnmarshalJSON decodes JSON into the wrapped uint32. -func (i *Uint32) UnmarshalJSON(b []byte) error { - var v uint32 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - i.Store(v) - return nil -} - -// String encodes the wrapped value as a string. -func (i *Uint32) String() string { - v := i.Load() - return strconv.FormatUint(uint64(v), 10) -} diff --git a/vendor/go.uber.org/atomic/uint64.go b/vendor/go.uber.org/atomic/uint64.go deleted file mode 100644 index 0e2eddb..0000000 --- a/vendor/go.uber.org/atomic/uint64.go +++ /dev/null @@ -1,109 +0,0 @@ -// @generated Code generated by gen-atomicint. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "strconv" - "sync/atomic" -) - -// Uint64 is an atomic wrapper around uint64. -type Uint64 struct { - _ nocmp // disallow non-atomic comparison - - v uint64 -} - -// NewUint64 creates a new Uint64. -func NewUint64(val uint64) *Uint64 { - return &Uint64{v: val} -} - -// Load atomically loads the wrapped value. -func (i *Uint64) Load() uint64 { - return atomic.LoadUint64(&i.v) -} - -// Add atomically adds to the wrapped uint64 and returns the new value. -func (i *Uint64) Add(delta uint64) uint64 { - return atomic.AddUint64(&i.v, delta) -} - -// Sub atomically subtracts from the wrapped uint64 and returns the new value. -func (i *Uint64) Sub(delta uint64) uint64 { - return atomic.AddUint64(&i.v, ^(delta - 1)) -} - -// Inc atomically increments the wrapped uint64 and returns the new value. -func (i *Uint64) Inc() uint64 { - return i.Add(1) -} - -// Dec atomically decrements the wrapped uint64 and returns the new value. -func (i *Uint64) Dec() uint64 { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap. -func (i *Uint64) CAS(old, new uint64) (swapped bool) { - return i.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (i *Uint64) CompareAndSwap(old, new uint64) (swapped bool) { - return atomic.CompareAndSwapUint64(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Uint64) Store(val uint64) { - atomic.StoreUint64(&i.v, val) -} - -// Swap atomically swaps the wrapped uint64 and returns the old value. -func (i *Uint64) Swap(val uint64) (old uint64) { - return atomic.SwapUint64(&i.v, val) -} - -// MarshalJSON encodes the wrapped uint64 into JSON. -func (i *Uint64) MarshalJSON() ([]byte, error) { - return json.Marshal(i.Load()) -} - -// UnmarshalJSON decodes JSON into the wrapped uint64. -func (i *Uint64) UnmarshalJSON(b []byte) error { - var v uint64 - if err := json.Unmarshal(b, &v); err != nil { - return err - } - i.Store(v) - return nil -} - -// String encodes the wrapped value as a string. -func (i *Uint64) String() string { - v := i.Load() - return strconv.FormatUint(uint64(v), 10) -} diff --git a/vendor/go.uber.org/atomic/uintptr.go b/vendor/go.uber.org/atomic/uintptr.go deleted file mode 100644 index 7d5b000..0000000 --- a/vendor/go.uber.org/atomic/uintptr.go +++ /dev/null @@ -1,109 +0,0 @@ -// @generated Code generated by gen-atomicint. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "encoding/json" - "strconv" - "sync/atomic" -) - -// Uintptr is an atomic wrapper around uintptr. -type Uintptr struct { - _ nocmp // disallow non-atomic comparison - - v uintptr -} - -// NewUintptr creates a new Uintptr. -func NewUintptr(val uintptr) *Uintptr { - return &Uintptr{v: val} -} - -// Load atomically loads the wrapped value. -func (i *Uintptr) Load() uintptr { - return atomic.LoadUintptr(&i.v) -} - -// Add atomically adds to the wrapped uintptr and returns the new value. -func (i *Uintptr) Add(delta uintptr) uintptr { - return atomic.AddUintptr(&i.v, delta) -} - -// Sub atomically subtracts from the wrapped uintptr and returns the new value. -func (i *Uintptr) Sub(delta uintptr) uintptr { - return atomic.AddUintptr(&i.v, ^(delta - 1)) -} - -// Inc atomically increments the wrapped uintptr and returns the new value. -func (i *Uintptr) Inc() uintptr { - return i.Add(1) -} - -// Dec atomically decrements the wrapped uintptr and returns the new value. -func (i *Uintptr) Dec() uintptr { - return i.Sub(1) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap. -func (i *Uintptr) CAS(old, new uintptr) (swapped bool) { - return i.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (i *Uintptr) CompareAndSwap(old, new uintptr) (swapped bool) { - return atomic.CompareAndSwapUintptr(&i.v, old, new) -} - -// Store atomically stores the passed value. -func (i *Uintptr) Store(val uintptr) { - atomic.StoreUintptr(&i.v, val) -} - -// Swap atomically swaps the wrapped uintptr and returns the old value. -func (i *Uintptr) Swap(val uintptr) (old uintptr) { - return atomic.SwapUintptr(&i.v, val) -} - -// MarshalJSON encodes the wrapped uintptr into JSON. -func (i *Uintptr) MarshalJSON() ([]byte, error) { - return json.Marshal(i.Load()) -} - -// UnmarshalJSON decodes JSON into the wrapped uintptr. -func (i *Uintptr) UnmarshalJSON(b []byte) error { - var v uintptr - if err := json.Unmarshal(b, &v); err != nil { - return err - } - i.Store(v) - return nil -} - -// String encodes the wrapped value as a string. -func (i *Uintptr) String() string { - v := i.Load() - return strconv.FormatUint(uint64(v), 10) -} diff --git a/vendor/go.uber.org/atomic/unsafe_pointer.go b/vendor/go.uber.org/atomic/unsafe_pointer.go deleted file mode 100644 index 34868ba..0000000 --- a/vendor/go.uber.org/atomic/unsafe_pointer.go +++ /dev/null @@ -1,65 +0,0 @@ -// Copyright (c) 2021-2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import ( - "sync/atomic" - "unsafe" -) - -// UnsafePointer is an atomic wrapper around unsafe.Pointer. -type UnsafePointer struct { - _ nocmp // disallow non-atomic comparison - - v unsafe.Pointer -} - -// NewUnsafePointer creates a new UnsafePointer. -func NewUnsafePointer(val unsafe.Pointer) *UnsafePointer { - return &UnsafePointer{v: val} -} - -// Load atomically loads the wrapped value. -func (p *UnsafePointer) Load() unsafe.Pointer { - return atomic.LoadPointer(&p.v) -} - -// Store atomically stores the passed value. -func (p *UnsafePointer) Store(val unsafe.Pointer) { - atomic.StorePointer(&p.v, val) -} - -// Swap atomically swaps the wrapped unsafe.Pointer and returns the old value. -func (p *UnsafePointer) Swap(val unsafe.Pointer) (old unsafe.Pointer) { - return atomic.SwapPointer(&p.v, val) -} - -// CAS is an atomic compare-and-swap. -// -// Deprecated: Use CompareAndSwap -func (p *UnsafePointer) CAS(old, new unsafe.Pointer) (swapped bool) { - return p.CompareAndSwap(old, new) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (p *UnsafePointer) CompareAndSwap(old, new unsafe.Pointer) (swapped bool) { - return atomic.CompareAndSwapPointer(&p.v, old, new) -} diff --git a/vendor/go.uber.org/atomic/value.go b/vendor/go.uber.org/atomic/value.go deleted file mode 100644 index 52caedb..0000000 --- a/vendor/go.uber.org/atomic/value.go +++ /dev/null @@ -1,31 +0,0 @@ -// Copyright (c) 2020 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package atomic - -import "sync/atomic" - -// Value shadows the type of the same name from sync/atomic -// https://godoc.org/sync/atomic#Value -type Value struct { - _ nocmp // disallow non-atomic comparison - - atomic.Value -} diff --git a/vendor/go.uber.org/zap/.golangci.yml b/vendor/go.uber.org/zap/.golangci.yml new file mode 100644 index 0000000..2346df1 --- /dev/null +++ b/vendor/go.uber.org/zap/.golangci.yml @@ -0,0 +1,77 @@ +output: + # Make output more digestible with quickfix in vim/emacs/etc. + sort-results: true + print-issued-lines: false + +linters: + # We'll track the golangci-lint default linters manually + # instead of letting them change without our control. + disable-all: true + enable: + # golangci-lint defaults: + - errcheck + - gosimple + - govet + - ineffassign + - staticcheck + - unused + + # Our own extras: + - gofumpt + - nolintlint # lints nolint directives + - revive + +linters-settings: + govet: + # These govet checks are disabled by default, but they're useful. + enable: + - niliness + - reflectvaluecompare + - sortslice + - unusedwrite + + errcheck: + exclude-functions: + # These methods can not fail. + # They operate on an in-memory buffer. + - (*go.uber.org/zap/buffer.Buffer).Write + - (*go.uber.org/zap/buffer.Buffer).WriteByte + - (*go.uber.org/zap/buffer.Buffer).WriteString + + - (*go.uber.org/zap/zapio.Writer).Close + - (*go.uber.org/zap/zapio.Writer).Sync + - (*go.uber.org/zap/zapio.Writer).Write + # Write to zapio.Writer cannot fail, + # so io.WriteString on it cannot fail. + - io.WriteString(*go.uber.org/zap/zapio.Writer) + + # Writing a plain string to a fmt.State cannot fail. + - io.WriteString(fmt.State) + +issues: + # Print all issues reported by all linters. + max-issues-per-linter: 0 + max-same-issues: 0 + + # Don't ignore some of the issues that golangci-lint considers okay. + # This includes documenting all exported entities. + exclude-use-default: false + + exclude-rules: + # Don't warn on unused parameters. + # Parameter names are useful; replacing them with '_' is undesirable. + - linters: [revive] + text: 'unused-parameter: parameter \S+ seems to be unused, consider removing or renaming it as _' + + # staticcheck already has smarter checks for empty blocks. + # revive's empty-block linter has false positives. + # For example, as of writing this, the following is not allowed. + # for foo() { } + - linters: [revive] + text: 'empty-block: this block is empty, you can remove it' + + # Ignore logger.Sync() errcheck failures in example_test.go + # since those are intended to be uncomplicated examples. + - linters: [errcheck] + path: example_test.go + text: 'Error return value of `logger.Sync` is not checked' diff --git a/vendor/go.uber.org/zap/.readme.tmpl b/vendor/go.uber.org/zap/.readme.tmpl index 92aa65d..4fea302 100644 --- a/vendor/go.uber.org/zap/.readme.tmpl +++ b/vendor/go.uber.org/zap/.readme.tmpl @@ -1,7 +1,15 @@ # :zap: zap [![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] +
+ Blazing fast, structured, leveled logging in Go. +![Zap logo](assets/logo.png) + +[![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] + +
+ ## Installation `go get -u go.uber.org/zap` @@ -92,7 +100,7 @@ standard.
-Released under the [MIT License](LICENSE.txt). +Released under the [MIT License](LICENSE). 1 In particular, keep in mind that we may be benchmarking against slightly older versions of other packages. Versions are diff --git a/vendor/go.uber.org/zap/CHANGELOG.md b/vendor/go.uber.org/zap/CHANGELOG.md index 0db1f9f..6d6cd5f 100644 --- a/vendor/go.uber.org/zap/CHANGELOG.md +++ b/vendor/go.uber.org/zap/CHANGELOG.md @@ -1,7 +1,55 @@ # Changelog All notable changes to this project will be documented in this file. -This project adheres to [Semantic Versioning](http://semver.org/spec/v2.0.0.html). +This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). + +## 1.27.0 (20 Feb 2024) +Enhancements: +* [#1378][]: Add `WithLazy` method for `SugaredLogger`. +* [#1399][]: zaptest: Add `NewTestingWriter` for customizing TestingWriter with more flexibility than `NewLogger`. +* [#1406][]: Add `Log`, `Logw`, `Logln` methods for `SugaredLogger`. +* [#1416][]: Add `WithPanicHook` option for testing panic logs. + +Thanks to @defval, @dimmo, @arxeiss, and @MKrupauskas for their contributions to this release. + +[#1378]: https://github.com/uber-go/zap/pull/1378 +[#1399]: https://github.com/uber-go/zap/pull/1399 +[#1406]: https://github.com/uber-go/zap/pull/1406 +[#1416]: https://github.com/uber-go/zap/pull/1416 + +## 1.26.0 (14 Sep 2023) +Enhancements: +* [#1297][]: Add Dict as a Field. +* [#1319][]: Add `WithLazy` method to `Logger` which lazily evaluates the structured +context. +* [#1350][]: String encoding is much (~50%) faster now. + +Thanks to @hhk7734, @jquirke, and @cdvr1993 for their contributions to this release. + +[#1297]: https://github.com/uber-go/zap/pull/1297 +[#1319]: https://github.com/uber-go/zap/pull/1319 +[#1350]: https://github.com/uber-go/zap/pull/1350 + +## 1.25.0 (1 Aug 2023) + +This release contains several improvements including performance, API additions, +and two new experimental packages whose APIs are unstable and may change in the +future. + +Enhancements: +* [#1246][]: Add `zap/exp/zapslog` package for integration with slog. +* [#1273][]: Add `Name` to `Logger` which returns the Logger's name if one is set. +* [#1281][]: Add `zap/exp/expfield` package which contains helper methods +`Str` and `Strs` for constructing String-like zap.Fields. +* [#1310][]: Reduce stack size on `Any`. + +Thanks to @knight42, @dzakaammar, @bcspragu, and @rexywork for their contributions +to this release. + +[#1246]: https://github.com/uber-go/zap/pull/1246 +[#1273]: https://github.com/uber-go/zap/pull/1273 +[#1281]: https://github.com/uber-go/zap/pull/1281 +[#1310]: https://github.com/uber-go/zap/pull/1310 ## 1.24.0 (30 Nov 2022) @@ -27,7 +75,6 @@ Enhancements: [#1147]: https://github.com/uber-go/zap/pull/1147 [#1155]: https://github.com/uber-go/zap/pull/1155 - ## 1.22.0 (8 Aug 2022) Enhancements: @@ -176,6 +223,16 @@ Enhancements: Thanks to @ash2k, @FMLS, @jimmystewpot, @Oncilla, @tsoslow, @tylitianrui, @withshubh, and @wziww for their contributions to this release. +[#865]: https://github.com/uber-go/zap/pull/865 +[#867]: https://github.com/uber-go/zap/pull/867 +[#881]: https://github.com/uber-go/zap/pull/881 +[#903]: https://github.com/uber-go/zap/pull/903 +[#912]: https://github.com/uber-go/zap/pull/912 +[#913]: https://github.com/uber-go/zap/pull/913 +[#928]: https://github.com/uber-go/zap/pull/928 +[#931]: https://github.com/uber-go/zap/pull/931 +[#936]: https://github.com/uber-go/zap/pull/936 + ## 1.16.0 (1 Sep 2020) Bugfixes: @@ -197,6 +254,17 @@ Enhancements: Thanks to @SteelPhase, @tmshn, @lixingwang, @wyxloading, @moul, @segevfiner, @andy-retailnext and @jcorbin for their contributions to this release. +[#629]: https://github.com/uber-go/zap/pull/629 +[#697]: https://github.com/uber-go/zap/pull/697 +[#828]: https://github.com/uber-go/zap/pull/828 +[#835]: https://github.com/uber-go/zap/pull/835 +[#843]: https://github.com/uber-go/zap/pull/843 +[#844]: https://github.com/uber-go/zap/pull/844 +[#852]: https://github.com/uber-go/zap/pull/852 +[#854]: https://github.com/uber-go/zap/pull/854 +[#861]: https://github.com/uber-go/zap/pull/861 +[#862]: https://github.com/uber-go/zap/pull/862 + ## 1.15.0 (23 Apr 2020) Bugfixes: @@ -213,6 +281,11 @@ Enhancements: Thanks to @danielbprice for their contributions to this release. +[#804]: https://github.com/uber-go/zap/pull/804 +[#812]: https://github.com/uber-go/zap/pull/812 +[#806]: https://github.com/uber-go/zap/pull/806 +[#813]: https://github.com/uber-go/zap/pull/813 + ## 1.14.1 (14 Mar 2020) Bugfixes: @@ -225,6 +298,10 @@ Bugfixes: Thanks to @YashishDua for their contributions to this release. +[#791]: https://github.com/uber-go/zap/pull/791 +[#795]: https://github.com/uber-go/zap/pull/795 +[#799]: https://github.com/uber-go/zap/pull/799 + ## 1.14.0 (20 Feb 2020) Enhancements: @@ -235,6 +312,11 @@ Enhancements: Thanks to @caibirdme for their contributions to this release. +[#771]: https://github.com/uber-go/zap/pull/771 +[#773]: https://github.com/uber-go/zap/pull/773 +[#775]: https://github.com/uber-go/zap/pull/775 +[#786]: https://github.com/uber-go/zap/pull/786 + ## 1.13.0 (13 Nov 2019) Enhancements: @@ -243,11 +325,15 @@ Enhancements: Thanks to @jbizzle for their contributions to this release. +[#758]: https://github.com/uber-go/zap/pull/758 + ## 1.12.0 (29 Oct 2019) Enhancements: * [#751][]: Migrate to Go modules. +[#751]: https://github.com/uber-go/zap/pull/751 + ## 1.11.0 (21 Oct 2019) Enhancements: @@ -256,6 +342,9 @@ Enhancements: Thanks to @juicemia, @uhthomas for their contributions to this release. +[#725]: https://github.com/uber-go/zap/pull/725 +[#736]: https://github.com/uber-go/zap/pull/736 + ## 1.10.0 (29 Apr 2019) Bugfixes: @@ -273,13 +362,21 @@ Enhancements: Thanks to @iaroslav-ciupin, @lelenanam, @joa, @NWilson for their contributions to this release. -## v1.9.1 (06 Aug 2018) +[#657]: https://github.com/uber-go/zap/pull/657 +[#706]: https://github.com/uber-go/zap/pull/706 +[#610]: https://github.com/uber-go/zap/pull/610 +[#675]: https://github.com/uber-go/zap/pull/675 +[#704]: https://github.com/uber-go/zap/pull/704 + +## 1.9.1 (06 Aug 2018) Bugfixes: * [#614][]: MapObjectEncoder should not ignore empty slices. -## v1.9.0 (19 Jul 2018) +[#614]: https://github.com/uber-go/zap/pull/614 + +## 1.9.0 (19 Jul 2018) Enhancements: * [#602][]: Reduce number of allocations when logging with reflection. @@ -288,7 +385,11 @@ Enhancements: Thanks to @nfarah86, @AlekSi, @JeanMertz, @philippgille, @etsangsplk, and @dimroc for their contributions to this release. -## v1.8.0 (13 Apr 2018) +[#602]: https://github.com/uber-go/zap/pull/602 +[#572]: https://github.com/uber-go/zap/pull/572 +[#606]: https://github.com/uber-go/zap/pull/606 + +## 1.8.0 (13 Apr 2018) Enhancements: * [#508][]: Make log level configurable when redirecting the standard @@ -301,19 +402,28 @@ Bugfixes: Thanks to @DiSiqueira and @djui for their contributions to this release. -## v1.7.1 (25 Sep 2017) +[#508]: https://github.com/uber-go/zap/pull/508 +[#518]: https://github.com/uber-go/zap/pull/518 +[#577]: https://github.com/uber-go/zap/pull/577 +[#574]: https://github.com/uber-go/zap/pull/574 + +## 1.7.1 (25 Sep 2017) Bugfixes: * [#504][]: Store strings when using AddByteString with the map encoder. -## v1.7.0 (21 Sep 2017) +[#504]: https://github.com/uber-go/zap/pull/504 + +## 1.7.0 (21 Sep 2017) Enhancements: * [#487][]: Add `NewStdLogAt`, which extends `NewStdLog` by allowing the user to specify the level of the logged messages. -## v1.6.0 (30 Aug 2017) +[#487]: https://github.com/uber-go/zap/pull/487 + +## 1.6.0 (30 Aug 2017) Enhancements: @@ -321,7 +431,10 @@ Enhancements: * [#490][]: Add a `ContextMap` method to observer logs for simpler field validation in tests. -## v1.5.0 (22 Jul 2017) +[#490]: https://github.com/uber-go/zap/pull/490 +[#491]: https://github.com/uber-go/zap/pull/491 + +## 1.5.0 (22 Jul 2017) Enhancements: @@ -334,7 +447,12 @@ Bugfixes: Thanks to @richard-tunein and @pavius for their contributions to this release. -## v1.4.1 (08 Jun 2017) +[#477]: https://github.com/uber-go/zap/pull/477 +[#465]: https://github.com/uber-go/zap/pull/465 +[#460]: https://github.com/uber-go/zap/pull/460 +[#470]: https://github.com/uber-go/zap/pull/470 + +## 1.4.1 (08 Jun 2017) This release fixes two bugs. @@ -343,7 +461,10 @@ Bugfixes: * [#435][]: Support a variety of case conventions when unmarshaling levels. * [#444][]: Fix a panic in the observer. -## v1.4.0 (12 May 2017) +[#435]: https://github.com/uber-go/zap/pull/435 +[#444]: https://github.com/uber-go/zap/pull/444 + +## 1.4.0 (12 May 2017) This release adds a few small features and is fully backward-compatible. @@ -355,7 +476,11 @@ Enhancements: * [#431][]: Make `zap.AtomicLevel` implement `fmt.Stringer`, which makes a variety of operations a bit simpler. -## v1.3.0 (25 Apr 2017) +[#424]: https://github.com/uber-go/zap/pull/424 +[#425]: https://github.com/uber-go/zap/pull/425 +[#431]: https://github.com/uber-go/zap/pull/431 + +## 1.3.0 (25 Apr 2017) This release adds an enhancement to zap's testing helpers as well as the ability to marshal an AtomicLevel. It is fully backward-compatible. @@ -366,7 +491,10 @@ Enhancements: particularly useful when testing the `SugaredLogger`. * [#416][]: Make `AtomicLevel` implement `encoding.TextMarshaler`. -## v1.2.0 (13 Apr 2017) +[#415]: https://github.com/uber-go/zap/pull/415 +[#416]: https://github.com/uber-go/zap/pull/416 + +## 1.2.0 (13 Apr 2017) This release adds a gRPC compatibility wrapper. It is fully backward-compatible. @@ -375,7 +503,9 @@ Enhancements: * [#402][]: Add a `zapgrpc` package that wraps zap's Logger and implements `grpclog.Logger`. -## v1.1.0 (31 Mar 2017) +[#402]: https://github.com/uber-go/zap/pull/402 + +## 1.1.0 (31 Mar 2017) This release fixes two bugs and adds some enhancements to zap's testing helpers. It is fully backward-compatible. @@ -392,7 +522,11 @@ Enhancements: Thanks to @moitias for contributing to this release. -## v1.0.0 (14 Mar 2017) +[#385]: https://github.com/uber-go/zap/pull/385 +[#396]: https://github.com/uber-go/zap/pull/396 +[#386]: https://github.com/uber-go/zap/pull/386 + +## 1.0.0 (14 Mar 2017) This is zap's first stable release. All exported APIs are now final, and no further breaking changes will be made in the 1.x release series. Anyone using a @@ -437,7 +571,21 @@ Enhancements: Thanks to @suyash, @htrendev, @flisky, @Ulexus, and @skipor for their contributions to this release. -## v1.0.0-rc.3 (7 Mar 2017) +[#366]: https://github.com/uber-go/zap/pull/366 +[#364]: https://github.com/uber-go/zap/pull/364 +[#371]: https://github.com/uber-go/zap/pull/371 +[#362]: https://github.com/uber-go/zap/pull/362 +[#369]: https://github.com/uber-go/zap/pull/369 +[#347]: https://github.com/uber-go/zap/pull/347 +[#373]: https://github.com/uber-go/zap/pull/373 +[#348]: https://github.com/uber-go/zap/pull/348 +[#327]: https://github.com/uber-go/zap/pull/327 +[#376]: https://github.com/uber-go/zap/pull/376 +[#346]: https://github.com/uber-go/zap/pull/346 +[#365]: https://github.com/uber-go/zap/pull/365 +[#372]: https://github.com/uber-go/zap/pull/372 + +## 1.0.0-rc.3 (7 Mar 2017) This is the third release candidate for zap's stable release. There are no breaking changes. @@ -458,7 +606,12 @@ Enhancements: Thanks to @ansel1 and @suyash for their contributions to this release. -## v1.0.0-rc.2 (21 Feb 2017) +[#339]: https://github.com/uber-go/zap/pull/339 +[#307]: https://github.com/uber-go/zap/pull/307 +[#353]: https://github.com/uber-go/zap/pull/353 +[#311]: https://github.com/uber-go/zap/pull/311 + +## 1.0.0-rc.2 (21 Feb 2017) This is the second release candidate for zap's stable release. It includes two breaking changes. @@ -495,7 +648,16 @@ Enhancements: Thanks to @skipor and @chapsuk for their contributions to this release. -## v1.0.0-rc.1 (14 Feb 2017) +[#316]: https://github.com/uber-go/zap/pull/316 +[#309]: https://github.com/uber-go/zap/pull/309 +[#317]: https://github.com/uber-go/zap/pull/317 +[#321]: https://github.com/uber-go/zap/pull/321 +[#325]: https://github.com/uber-go/zap/pull/325 +[#333]: https://github.com/uber-go/zap/pull/333 +[#326]: https://github.com/uber-go/zap/pull/326 +[#300]: https://github.com/uber-go/zap/pull/300 + +## 1.0.0-rc.1 (14 Feb 2017) This is the first release candidate for zap's stable release. There are multiple breaking changes and improvements from the pre-release version. Most notably: @@ -515,7 +677,7 @@ breaking changes and improvements from the pre-release version. Most notably: * Sampling is more accurate, and doesn't depend on the standard library's shared timer heap. -## v0.1.0-beta.1 (6 Feb 2017) +## 0.1.0-beta.1 (6 Feb 2017) This is a minor version, tagged to allow users to pin to the pre-1.0 APIs and upgrade at their leisure. Since this is the first tagged release, there are no @@ -523,95 +685,3 @@ backward compatibility concerns and all functionality is new. Early zap adopters should pin to the 0.1.x minor version until they're ready to upgrade to the upcoming stable release. - -[#316]: https://github.com/uber-go/zap/pull/316 -[#309]: https://github.com/uber-go/zap/pull/309 -[#317]: https://github.com/uber-go/zap/pull/317 -[#321]: https://github.com/uber-go/zap/pull/321 -[#325]: https://github.com/uber-go/zap/pull/325 -[#333]: https://github.com/uber-go/zap/pull/333 -[#326]: https://github.com/uber-go/zap/pull/326 -[#300]: https://github.com/uber-go/zap/pull/300 -[#339]: https://github.com/uber-go/zap/pull/339 -[#307]: https://github.com/uber-go/zap/pull/307 -[#353]: https://github.com/uber-go/zap/pull/353 -[#311]: https://github.com/uber-go/zap/pull/311 -[#366]: https://github.com/uber-go/zap/pull/366 -[#364]: https://github.com/uber-go/zap/pull/364 -[#371]: https://github.com/uber-go/zap/pull/371 -[#362]: https://github.com/uber-go/zap/pull/362 -[#369]: https://github.com/uber-go/zap/pull/369 -[#347]: https://github.com/uber-go/zap/pull/347 -[#373]: https://github.com/uber-go/zap/pull/373 -[#348]: https://github.com/uber-go/zap/pull/348 -[#327]: https://github.com/uber-go/zap/pull/327 -[#376]: https://github.com/uber-go/zap/pull/376 -[#346]: https://github.com/uber-go/zap/pull/346 -[#365]: https://github.com/uber-go/zap/pull/365 -[#372]: https://github.com/uber-go/zap/pull/372 -[#385]: https://github.com/uber-go/zap/pull/385 -[#396]: https://github.com/uber-go/zap/pull/396 -[#386]: https://github.com/uber-go/zap/pull/386 -[#402]: https://github.com/uber-go/zap/pull/402 -[#415]: https://github.com/uber-go/zap/pull/415 -[#416]: https://github.com/uber-go/zap/pull/416 -[#424]: https://github.com/uber-go/zap/pull/424 -[#425]: https://github.com/uber-go/zap/pull/425 -[#431]: https://github.com/uber-go/zap/pull/431 -[#435]: https://github.com/uber-go/zap/pull/435 -[#444]: https://github.com/uber-go/zap/pull/444 -[#477]: https://github.com/uber-go/zap/pull/477 -[#465]: https://github.com/uber-go/zap/pull/465 -[#460]: https://github.com/uber-go/zap/pull/460 -[#470]: https://github.com/uber-go/zap/pull/470 -[#487]: https://github.com/uber-go/zap/pull/487 -[#490]: https://github.com/uber-go/zap/pull/490 -[#491]: https://github.com/uber-go/zap/pull/491 -[#504]: https://github.com/uber-go/zap/pull/504 -[#508]: https://github.com/uber-go/zap/pull/508 -[#518]: https://github.com/uber-go/zap/pull/518 -[#577]: https://github.com/uber-go/zap/pull/577 -[#574]: https://github.com/uber-go/zap/pull/574 -[#602]: https://github.com/uber-go/zap/pull/602 -[#572]: https://github.com/uber-go/zap/pull/572 -[#606]: https://github.com/uber-go/zap/pull/606 -[#614]: https://github.com/uber-go/zap/pull/614 -[#657]: https://github.com/uber-go/zap/pull/657 -[#706]: https://github.com/uber-go/zap/pull/706 -[#610]: https://github.com/uber-go/zap/pull/610 -[#675]: https://github.com/uber-go/zap/pull/675 -[#704]: https://github.com/uber-go/zap/pull/704 -[#725]: https://github.com/uber-go/zap/pull/725 -[#736]: https://github.com/uber-go/zap/pull/736 -[#751]: https://github.com/uber-go/zap/pull/751 -[#758]: https://github.com/uber-go/zap/pull/758 -[#771]: https://github.com/uber-go/zap/pull/771 -[#773]: https://github.com/uber-go/zap/pull/773 -[#775]: https://github.com/uber-go/zap/pull/775 -[#786]: https://github.com/uber-go/zap/pull/786 -[#791]: https://github.com/uber-go/zap/pull/791 -[#795]: https://github.com/uber-go/zap/pull/795 -[#799]: https://github.com/uber-go/zap/pull/799 -[#804]: https://github.com/uber-go/zap/pull/804 -[#812]: https://github.com/uber-go/zap/pull/812 -[#806]: https://github.com/uber-go/zap/pull/806 -[#813]: https://github.com/uber-go/zap/pull/813 -[#629]: https://github.com/uber-go/zap/pull/629 -[#697]: https://github.com/uber-go/zap/pull/697 -[#828]: https://github.com/uber-go/zap/pull/828 -[#835]: https://github.com/uber-go/zap/pull/835 -[#843]: https://github.com/uber-go/zap/pull/843 -[#844]: https://github.com/uber-go/zap/pull/844 -[#852]: https://github.com/uber-go/zap/pull/852 -[#854]: https://github.com/uber-go/zap/pull/854 -[#861]: https://github.com/uber-go/zap/pull/861 -[#862]: https://github.com/uber-go/zap/pull/862 -[#865]: https://github.com/uber-go/zap/pull/865 -[#867]: https://github.com/uber-go/zap/pull/867 -[#881]: https://github.com/uber-go/zap/pull/881 -[#903]: https://github.com/uber-go/zap/pull/903 -[#912]: https://github.com/uber-go/zap/pull/912 -[#913]: https://github.com/uber-go/zap/pull/913 -[#928]: https://github.com/uber-go/zap/pull/928 -[#931]: https://github.com/uber-go/zap/pull/931 -[#936]: https://github.com/uber-go/zap/pull/936 diff --git a/vendor/go.uber.org/zap/LICENSE.txt b/vendor/go.uber.org/zap/LICENSE similarity index 100% rename from vendor/go.uber.org/zap/LICENSE.txt rename to vendor/go.uber.org/zap/LICENSE diff --git a/vendor/go.uber.org/zap/Makefile b/vendor/go.uber.org/zap/Makefile index 9b1bc3b..eb1cee5 100644 --- a/vendor/go.uber.org/zap/Makefile +++ b/vendor/go.uber.org/zap/Makefile @@ -1,50 +1,51 @@ -export GOBIN ?= $(shell pwd)/bin +# Directory containing the Makefile. +PROJECT_ROOT = $(dir $(abspath $(lastword $(MAKEFILE_LIST)))) -GOLINT = $(GOBIN)/golint -STATICCHECK = $(GOBIN)/staticcheck +export GOBIN ?= $(PROJECT_ROOT)/bin +export PATH := $(GOBIN):$(PATH) + +GOVULNCHECK = $(GOBIN)/govulncheck BENCH_FLAGS ?= -cpuprofile=cpu.pprof -memprofile=mem.pprof -benchmem # Directories containing independent Go modules. -# -# We track coverage only for the main module. -MODULE_DIRS = . ./benchmarks ./zapgrpc/internal/test +MODULE_DIRS = . ./exp ./benchmarks ./zapgrpc/internal/test -# Many Go tools take file globs or directories as arguments instead of packages. -GO_FILES := $(shell \ - find . '(' -path '*/.*' -o -path './vendor' ')' -prune \ - -o -name '*.go' -print | cut -b3-) +# Directories that we want to track coverage for. +COVER_DIRS = . ./exp .PHONY: all all: lint test .PHONY: lint -lint: $(GOLINT) $(STATICCHECK) - @rm -rf lint.log - @echo "Checking formatting..." - @gofmt -d -s $(GO_FILES) 2>&1 | tee lint.log - @echo "Checking vet..." - @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && go vet ./... 2>&1) &&) true | tee -a lint.log - @echo "Checking lint..." - @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && $(GOLINT) ./... 2>&1) &&) true | tee -a lint.log - @echo "Checking staticcheck..." - @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && $(STATICCHECK) ./... 2>&1) &&) true | tee -a lint.log - @echo "Checking for unresolved FIXMEs..." - @git grep -i fixme | grep -v -e Makefile | tee -a lint.log - @echo "Checking for license headers..." - @./checklicense.sh | tee -a lint.log - @[ ! -s lint.log ] - @echo "Checking 'go mod tidy'..." - @make tidy - @if ! git diff --quiet; then \ - echo "'go mod tidy' resulted in changes or working tree is dirty:"; \ - git --no-pager diff; \ - fi - -$(GOLINT): - cd tools && go install golang.org/x/lint/golint - -$(STATICCHECK): - cd tools && go install honnef.co/go/tools/cmd/staticcheck +lint: golangci-lint tidy-lint license-lint + +.PHONY: golangci-lint +golangci-lint: + @$(foreach mod,$(MODULE_DIRS), \ + (cd $(mod) && \ + echo "[lint] golangci-lint: $(mod)" && \ + golangci-lint run --path-prefix $(mod)) &&) true + +.PHONY: tidy +tidy: + @$(foreach dir,$(MODULE_DIRS), \ + (cd $(dir) && go mod tidy) &&) true + +.PHONY: tidy-lint +tidy-lint: + @$(foreach mod,$(MODULE_DIRS), \ + (cd $(mod) && \ + echo "[lint] tidy: $(mod)" && \ + go mod tidy && \ + git diff --exit-code -- go.mod go.sum) &&) true + + +.PHONY: license-lint +license-lint: + ./checklicense.sh + +$(GOVULNCHECK): + cd tools && go install golang.org/x/vuln/cmd/govulncheck .PHONY: test test: @@ -52,8 +53,10 @@ test: .PHONY: cover cover: - go test -race -coverprofile=cover.out -coverpkg=./... ./... - go tool cover -html=cover.out -o cover.html + @$(foreach dir,$(COVER_DIRS), ( \ + cd $(dir) && \ + go test -race -coverprofile=cover.out -coverpkg=./... ./... \ + && go tool cover -html=cover.out -o cover.html) &&) true .PHONY: bench BENCH ?= . @@ -68,6 +71,6 @@ updatereadme: rm -f README.md cat .readme.tmpl | go run internal/readme/readme.go > README.md -.PHONY: tidy -tidy: - @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && go mod tidy) &&) true +.PHONY: vulncheck +vulncheck: $(GOVULNCHECK) + $(GOVULNCHECK) ./... diff --git a/vendor/go.uber.org/zap/README.md b/vendor/go.uber.org/zap/README.md index a553a42..a17035c 100644 --- a/vendor/go.uber.org/zap/README.md +++ b/vendor/go.uber.org/zap/README.md @@ -1,7 +1,16 @@ -# :zap: zap [![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] +# :zap: zap + + +
Blazing fast, structured, leveled logging in Go. +![Zap logo](assets/logo.png) + +[![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] + +
+ ## Installation `go get -u go.uber.org/zap` @@ -54,7 +63,7 @@ and make many small allocations. Put differently, using `encoding/json` and Zap takes a different approach. It includes a reflection-free, zero-allocation JSON encoder, and the base `Logger` strives to avoid serialization overhead and allocations wherever possible. By building the high-level `SugaredLogger` -on that foundation, zap lets users _choose_ when they need to count every +on that foundation, zap lets users *choose* when they need to count every allocation and when they'd prefer a more familiar, loosely typed API. As measured by its own [benchmarking suite][], not only is zap more performant @@ -64,40 +73,46 @@ id="anchor-versions">[1](#footnote-versions) Log a message and 10 fields: -| Package | Time | Time % to zap | Objects Allocated | -| :------------------ | :---------: | :-----------: | :---------------: | -| :zap: zap | 2900 ns/op | +0% | 5 allocs/op | -| :zap: zap (sugared) | 3475 ns/op | +20% | 10 allocs/op | -| zerolog | 10639 ns/op | +267% | 32 allocs/op | -| go-kit | 14434 ns/op | +398% | 59 allocs/op | -| logrus | 17104 ns/op | +490% | 81 allocs/op | -| apex/log | 32424 ns/op | +1018% | 66 allocs/op | -| log15 | 33579 ns/op | +1058% | 76 allocs/op | +| Package | Time | Time % to zap | Objects Allocated | +| :------ | :--: | :-----------: | :---------------: | +| :zap: zap | 656 ns/op | +0% | 5 allocs/op +| :zap: zap (sugared) | 935 ns/op | +43% | 10 allocs/op +| zerolog | 380 ns/op | -42% | 1 allocs/op +| go-kit | 2249 ns/op | +243% | 57 allocs/op +| slog (LogAttrs) | 2479 ns/op | +278% | 40 allocs/op +| slog | 2481 ns/op | +278% | 42 allocs/op +| apex/log | 9591 ns/op | +1362% | 63 allocs/op +| log15 | 11393 ns/op | +1637% | 75 allocs/op +| logrus | 11654 ns/op | +1677% | 79 allocs/op Log a message with a logger that already has 10 fields of context: -| Package | Time | Time % to zap | Objects Allocated | -| :------------------ | :---------: | :-----------: | :---------------: | -| :zap: zap | 373 ns/op | +0% | 0 allocs/op | -| :zap: zap (sugared) | 452 ns/op | +21% | 1 allocs/op | -| zerolog | 288 ns/op | -23% | 0 allocs/op | -| go-kit | 11785 ns/op | +3060% | 58 allocs/op | -| logrus | 19629 ns/op | +5162% | 70 allocs/op | -| log15 | 21866 ns/op | +5762% | 72 allocs/op | -| apex/log | 30890 ns/op | +8182% | 55 allocs/op | +| Package | Time | Time % to zap | Objects Allocated | +| :------ | :--: | :-----------: | :---------------: | +| :zap: zap | 67 ns/op | +0% | 0 allocs/op +| :zap: zap (sugared) | 84 ns/op | +25% | 1 allocs/op +| zerolog | 35 ns/op | -48% | 0 allocs/op +| slog | 193 ns/op | +188% | 0 allocs/op +| slog (LogAttrs) | 200 ns/op | +199% | 0 allocs/op +| go-kit | 2460 ns/op | +3572% | 56 allocs/op +| log15 | 9038 ns/op | +13390% | 70 allocs/op +| apex/log | 9068 ns/op | +13434% | 53 allocs/op +| logrus | 10521 ns/op | +15603% | 68 allocs/op Log a static string, without any context or `printf`-style templating: -| Package | Time | Time % to zap | Objects Allocated | -| :------------------ | :--------: | :-----------: | :---------------: | -| :zap: zap | 381 ns/op | +0% | 0 allocs/op | -| :zap: zap (sugared) | 410 ns/op | +8% | 1 allocs/op | -| zerolog | 369 ns/op | -3% | 0 allocs/op | -| standard library | 385 ns/op | +1% | 2 allocs/op | -| go-kit | 606 ns/op | +59% | 11 allocs/op | -| logrus | 1730 ns/op | +354% | 25 allocs/op | -| apex/log | 1998 ns/op | +424% | 7 allocs/op | -| log15 | 4546 ns/op | +1093% | 22 allocs/op | +| Package | Time | Time % to zap | Objects Allocated | +| :------ | :--: | :-----------: | :---------------: | +| :zap: zap | 63 ns/op | +0% | 0 allocs/op +| :zap: zap (sugared) | 81 ns/op | +29% | 1 allocs/op +| zerolog | 32 ns/op | -49% | 0 allocs/op +| standard library | 124 ns/op | +97% | 1 allocs/op +| slog | 196 ns/op | +211% | 0 allocs/op +| slog (LogAttrs) | 200 ns/op | +217% | 0 allocs/op +| go-kit | 213 ns/op | +238% | 9 allocs/op +| apex/log | 771 ns/op | +1124% | 5 allocs/op +| logrus | 1439 ns/op | +2184% | 23 allocs/op +| log15 | 2069 ns/op | +3184% | 20 allocs/op ## Development Status: Stable @@ -117,7 +132,7 @@ standard.
-Released under the [MIT License](LICENSE.txt). +Released under the [MIT License](LICENSE). 1 In particular, keep in mind that we may be benchmarking against slightly older versions of other packages. Versions are @@ -131,3 +146,4 @@ pinned in the [benchmarks/go.mod][] file. [↩](#anchor-versions) [cov]: https://codecov.io/gh/uber-go/zap [benchmarking suite]: https://github.com/uber-go/zap/tree/master/benchmarks [benchmarks/go.mod]: https://github.com/uber-go/zap/blob/master/benchmarks/go.mod + diff --git a/vendor/go.uber.org/zap/array.go b/vendor/go.uber.org/zap/array.go index 5be3704..abfccb5 100644 --- a/vendor/go.uber.org/zap/array.go +++ b/vendor/go.uber.org/zap/array.go @@ -21,6 +21,7 @@ package zap import ( + "fmt" "time" "go.uber.org/zap/zapcore" @@ -94,11 +95,137 @@ func Int8s(key string, nums []int8) Field { return Array(key, int8s(nums)) } +// Objects constructs a field with the given key, holding a list of the +// provided objects that can be marshaled by Zap. +// +// Note that these objects must implement zapcore.ObjectMarshaler directly. +// That is, if you're trying to marshal a []Request, the MarshalLogObject +// method must be declared on the Request type, not its pointer (*Request). +// If it's on the pointer, use ObjectValues. +// +// Given an object that implements MarshalLogObject on the value receiver, you +// can log a slice of those objects with Objects like so: +// +// type Author struct{ ... } +// func (a Author) MarshalLogObject(enc zapcore.ObjectEncoder) error +// +// var authors []Author = ... +// logger.Info("loading article", zap.Objects("authors", authors)) +// +// Similarly, given a type that implements MarshalLogObject on its pointer +// receiver, you can log a slice of pointers to that object with Objects like +// so: +// +// type Request struct{ ... } +// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error +// +// var requests []*Request = ... +// logger.Info("sending requests", zap.Objects("requests", requests)) +// +// If instead, you have a slice of values of such an object, use the +// ObjectValues constructor. +// +// var requests []Request = ... +// logger.Info("sending requests", zap.ObjectValues("requests", requests)) +func Objects[T zapcore.ObjectMarshaler](key string, values []T) Field { + return Array(key, objects[T](values)) +} + +type objects[T zapcore.ObjectMarshaler] []T + +func (os objects[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error { + for _, o := range os { + if err := arr.AppendObject(o); err != nil { + return err + } + } + return nil +} + +// ObjectMarshalerPtr is a constraint that specifies that the given type +// implements zapcore.ObjectMarshaler on a pointer receiver. +type ObjectMarshalerPtr[T any] interface { + *T + zapcore.ObjectMarshaler +} + +// ObjectValues constructs a field with the given key, holding a list of the +// provided objects, where pointers to these objects can be marshaled by Zap. +// +// Note that pointers to these objects must implement zapcore.ObjectMarshaler. +// That is, if you're trying to marshal a []Request, the MarshalLogObject +// method must be declared on the *Request type, not the value (Request). +// If it's on the value, use Objects. +// +// Given an object that implements MarshalLogObject on the pointer receiver, +// you can log a slice of those objects with ObjectValues like so: +// +// type Request struct{ ... } +// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error +// +// var requests []Request = ... +// logger.Info("sending requests", zap.ObjectValues("requests", requests)) +// +// If instead, you have a slice of pointers of such an object, use the Objects +// field constructor. +// +// var requests []*Request = ... +// logger.Info("sending requests", zap.Objects("requests", requests)) +func ObjectValues[T any, P ObjectMarshalerPtr[T]](key string, values []T) Field { + return Array(key, objectValues[T, P](values)) +} + +type objectValues[T any, P ObjectMarshalerPtr[T]] []T + +func (os objectValues[T, P]) MarshalLogArray(arr zapcore.ArrayEncoder) error { + for i := range os { + // It is necessary for us to explicitly reference the "P" type. + // We cannot simply pass "&os[i]" to AppendObject because its type + // is "*T", which the type system does not consider as + // implementing ObjectMarshaler. + // Only the type "P" satisfies ObjectMarshaler, which we have + // to convert "*T" to explicitly. + var p P = &os[i] + if err := arr.AppendObject(p); err != nil { + return err + } + } + return nil +} + // Strings constructs a field that carries a slice of strings. func Strings(key string, ss []string) Field { return Array(key, stringArray(ss)) } +// Stringers constructs a field with the given key, holding a list of the +// output provided by the value's String method +// +// Given an object that implements String on the value receiver, you +// can log a slice of those objects with Objects like so: +// +// type Request struct{ ... } +// func (a Request) String() string +// +// var requests []Request = ... +// logger.Info("sending requests", zap.Stringers("requests", requests)) +// +// Note that these objects must implement fmt.Stringer directly. +// That is, if you're trying to marshal a []Request, the String method +// must be declared on the Request type, not its pointer (*Request). +func Stringers[T fmt.Stringer](key string, values []T) Field { + return Array(key, stringers[T](values)) +} + +type stringers[T fmt.Stringer] []T + +func (os stringers[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error { + for _, o := range os { + arr.AppendString(o.String()) + } + return nil +} + // Times constructs a field that carries a slice of time.Times. func Times(key string, ts []time.Time) Field { return Array(key, times(ts)) diff --git a/vendor/go.uber.org/zap/array_go118.go b/vendor/go.uber.org/zap/array_go118.go deleted file mode 100644 index d0d2c49..0000000 --- a/vendor/go.uber.org/zap/array_go118.go +++ /dev/null @@ -1,156 +0,0 @@ -// Copyright (c) 2022 Uber Technologies, Inc. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -//go:build go1.18 -// +build go1.18 - -package zap - -import ( - "fmt" - - "go.uber.org/zap/zapcore" -) - -// Objects constructs a field with the given key, holding a list of the -// provided objects that can be marshaled by Zap. -// -// Note that these objects must implement zapcore.ObjectMarshaler directly. -// That is, if you're trying to marshal a []Request, the MarshalLogObject -// method must be declared on the Request type, not its pointer (*Request). -// If it's on the pointer, use ObjectValues. -// -// Given an object that implements MarshalLogObject on the value receiver, you -// can log a slice of those objects with Objects like so: -// -// type Author struct{ ... } -// func (a Author) MarshalLogObject(enc zapcore.ObjectEncoder) error -// -// var authors []Author = ... -// logger.Info("loading article", zap.Objects("authors", authors)) -// -// Similarly, given a type that implements MarshalLogObject on its pointer -// receiver, you can log a slice of pointers to that object with Objects like -// so: -// -// type Request struct{ ... } -// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error -// -// var requests []*Request = ... -// logger.Info("sending requests", zap.Objects("requests", requests)) -// -// If instead, you have a slice of values of such an object, use the -// ObjectValues constructor. -// -// var requests []Request = ... -// logger.Info("sending requests", zap.ObjectValues("requests", requests)) -func Objects[T zapcore.ObjectMarshaler](key string, values []T) Field { - return Array(key, objects[T](values)) -} - -type objects[T zapcore.ObjectMarshaler] []T - -func (os objects[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error { - for _, o := range os { - if err := arr.AppendObject(o); err != nil { - return err - } - } - return nil -} - -// ObjectMarshalerPtr is a constraint that specifies that the given type -// implements zapcore.ObjectMarshaler on a pointer receiver. -type ObjectMarshalerPtr[T any] interface { - *T - zapcore.ObjectMarshaler -} - -// ObjectValues constructs a field with the given key, holding a list of the -// provided objects, where pointers to these objects can be marshaled by Zap. -// -// Note that pointers to these objects must implement zapcore.ObjectMarshaler. -// That is, if you're trying to marshal a []Request, the MarshalLogObject -// method must be declared on the *Request type, not the value (Request). -// If it's on the value, use Objects. -// -// Given an object that implements MarshalLogObject on the pointer receiver, -// you can log a slice of those objects with ObjectValues like so: -// -// type Request struct{ ... } -// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error -// -// var requests []Request = ... -// logger.Info("sending requests", zap.ObjectValues("requests", requests)) -// -// If instead, you have a slice of pointers of such an object, use the Objects -// field constructor. -// -// var requests []*Request = ... -// logger.Info("sending requests", zap.Objects("requests", requests)) -func ObjectValues[T any, P ObjectMarshalerPtr[T]](key string, values []T) Field { - return Array(key, objectValues[T, P](values)) -} - -type objectValues[T any, P ObjectMarshalerPtr[T]] []T - -func (os objectValues[T, P]) MarshalLogArray(arr zapcore.ArrayEncoder) error { - for i := range os { - // It is necessary for us to explicitly reference the "P" type. - // We cannot simply pass "&os[i]" to AppendObject because its type - // is "*T", which the type system does not consider as - // implementing ObjectMarshaler. - // Only the type "P" satisfies ObjectMarshaler, which we have - // to convert "*T" to explicitly. - var p P = &os[i] - if err := arr.AppendObject(p); err != nil { - return err - } - } - return nil -} - -// Stringers constructs a field with the given key, holding a list of the -// output provided by the value's String method -// -// Given an object that implements String on the value receiver, you -// can log a slice of those objects with Objects like so: -// -// type Request struct{ ... } -// func (a Request) String() string -// -// var requests []Request = ... -// logger.Info("sending requests", zap.Stringers("requests", requests)) -// -// Note that these objects must implement fmt.Stringer directly. -// That is, if you're trying to marshal a []Request, the String method -// must be declared on the Request type, not its pointer (*Request). -func Stringers[T fmt.Stringer](key string, values []T) Field { - return Array(key, stringers[T](values)) -} - -type stringers[T fmt.Stringer] []T - -func (os stringers[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error { - for _, o := range os { - arr.AppendString(o.String()) - } - return nil -} diff --git a/vendor/go.uber.org/zap/buffer/buffer.go b/vendor/go.uber.org/zap/buffer/buffer.go index 9e929cd..0b8540c 100644 --- a/vendor/go.uber.org/zap/buffer/buffer.go +++ b/vendor/go.uber.org/zap/buffer/buffer.go @@ -42,6 +42,11 @@ func (b *Buffer) AppendByte(v byte) { b.bs = append(b.bs, v) } +// AppendBytes writes the given slice of bytes to the Buffer. +func (b *Buffer) AppendBytes(v []byte) { + b.bs = append(b.bs, v...) +} + // AppendString writes a string to the Buffer. func (b *Buffer) AppendString(s string) { b.bs = append(b.bs, s...) diff --git a/vendor/go.uber.org/zap/buffer/pool.go b/vendor/go.uber.org/zap/buffer/pool.go index 8fb3e20..8463233 100644 --- a/vendor/go.uber.org/zap/buffer/pool.go +++ b/vendor/go.uber.org/zap/buffer/pool.go @@ -20,25 +20,29 @@ package buffer -import "sync" +import ( + "go.uber.org/zap/internal/pool" +) // A Pool is a type-safe wrapper around a sync.Pool. type Pool struct { - p *sync.Pool + p *pool.Pool[*Buffer] } // NewPool constructs a new Pool. func NewPool() Pool { - return Pool{p: &sync.Pool{ - New: func() interface{} { - return &Buffer{bs: make([]byte, 0, _size)} - }, - }} + return Pool{ + p: pool.New(func() *Buffer { + return &Buffer{ + bs: make([]byte, 0, _size), + } + }), + } } // Get retrieves a Buffer from the pool, creating one if necessary. func (p Pool) Get() *Buffer { - buf := p.p.Get().(*Buffer) + buf := p.p.Get() buf.Reset() buf.pool = p return buf diff --git a/vendor/go.uber.org/zap/config.go b/vendor/go.uber.org/zap/config.go index ee60967..e76e4e6 100644 --- a/vendor/go.uber.org/zap/config.go +++ b/vendor/go.uber.org/zap/config.go @@ -95,6 +95,32 @@ type Config struct { // NewProductionEncoderConfig returns an opinionated EncoderConfig for // production environments. +// +// Messages encoded with this configuration will be JSON-formatted +// and will have the following keys by default: +// +// - "level": The logging level (e.g. "info", "error"). +// - "ts": The current time in number of seconds since the Unix epoch. +// - "msg": The message passed to the log statement. +// - "caller": If available, a short path to the file and line number +// where the log statement was issued. +// The logger configuration determines whether this field is captured. +// - "stacktrace": If available, a stack trace from the line +// where the log statement was issued. +// The logger configuration determines whether this field is captured. +// +// By default, the following formats are used for different types: +// +// - Time is formatted as floating-point number of seconds since the Unix +// epoch. +// - Duration is formatted as floating-point number of seconds. +// +// You may change these by setting the appropriate fields in the returned +// object. +// For example, use the following to change the time encoding format: +// +// cfg := zap.NewProductionEncoderConfig() +// cfg.EncodeTime = zapcore.ISO8601TimeEncoder func NewProductionEncoderConfig() zapcore.EncoderConfig { return zapcore.EncoderConfig{ TimeKey: "ts", @@ -112,11 +138,22 @@ func NewProductionEncoderConfig() zapcore.EncoderConfig { } } -// NewProductionConfig is a reasonable production logging configuration. -// Logging is enabled at InfoLevel and above. +// NewProductionConfig builds a reasonable default production logging +// configuration. +// Logging is enabled at InfoLevel and above, and uses a JSON encoder. +// Logs are written to standard error. +// Stacktraces are included on logs of ErrorLevel and above. +// DPanicLevel logs will not panic, but will write a stacktrace. +// +// Sampling is enabled at 100:100 by default, +// meaning that after the first 100 log entries +// with the same level and message in the same second, +// it will log every 100th entry +// with the same level and message in the same second. +// You may disable this behavior by setting Sampling to nil. // -// It uses a JSON encoder, writes to standard error, and enables sampling. -// Stacktraces are automatically included on logs of ErrorLevel and above. +// See [NewProductionEncoderConfig] for information +// on the default encoder configuration. func NewProductionConfig() Config { return Config{ Level: NewAtomicLevelAt(InfoLevel), @@ -134,6 +171,32 @@ func NewProductionConfig() Config { // NewDevelopmentEncoderConfig returns an opinionated EncoderConfig for // development environments. +// +// Messages encoded with this configuration will use Zap's console encoder +// intended to print human-readable output. +// It will print log messages with the following information: +// +// - The log level (e.g. "INFO", "ERROR"). +// - The time in ISO8601 format (e.g. "2017-01-01T12:00:00Z"). +// - The message passed to the log statement. +// - If available, a short path to the file and line number +// where the log statement was issued. +// The logger configuration determines whether this field is captured. +// - If available, a stacktrace from the line +// where the log statement was issued. +// The logger configuration determines whether this field is captured. +// +// By default, the following formats are used for different types: +// +// - Time is formatted in ISO8601 format (e.g. "2017-01-01T12:00:00Z"). +// - Duration is formatted as a string (e.g. "1.234s"). +// +// You may change these by setting the appropriate fields in the returned +// object. +// For example, use the following to change the time encoding format: +// +// cfg := zap.NewDevelopmentEncoderConfig() +// cfg.EncodeTime = zapcore.ISO8601TimeEncoder func NewDevelopmentEncoderConfig() zapcore.EncoderConfig { return zapcore.EncoderConfig{ // Keys can be anything except the empty string. @@ -152,12 +215,15 @@ func NewDevelopmentEncoderConfig() zapcore.EncoderConfig { } } -// NewDevelopmentConfig is a reasonable development logging configuration. -// Logging is enabled at DebugLevel and above. +// NewDevelopmentConfig builds a reasonable default development logging +// configuration. +// Logging is enabled at DebugLevel and above, and uses a console encoder. +// Logs are written to standard error. +// Stacktraces are included on logs of WarnLevel and above. +// DPanicLevel logs will panic. // -// It enables development mode (which makes DPanicLevel logs panic), uses a -// console encoder, writes to standard error, and disables sampling. -// Stacktraces are automatically included on logs of WarnLevel and above. +// See [NewDevelopmentEncoderConfig] for information +// on the default encoder configuration. func NewDevelopmentConfig() Config { return Config{ Level: NewAtomicLevelAt(DebugLevel), diff --git a/vendor/go.uber.org/zap/error.go b/vendor/go.uber.org/zap/error.go index 65982a5..45f7b83 100644 --- a/vendor/go.uber.org/zap/error.go +++ b/vendor/go.uber.org/zap/error.go @@ -21,14 +21,13 @@ package zap import ( - "sync" - + "go.uber.org/zap/internal/pool" "go.uber.org/zap/zapcore" ) -var _errArrayElemPool = sync.Pool{New: func() interface{} { +var _errArrayElemPool = pool.New(func() *errArrayElem { return &errArrayElem{} -}} +}) // Error is shorthand for the common idiom NamedError("error", err). func Error(err error) Field { @@ -60,11 +59,14 @@ func (errs errArray) MarshalLogArray(arr zapcore.ArrayEncoder) error { // potentially an "errorVerbose" attribute, we need to wrap it in a // type that implements LogObjectMarshaler. To prevent this from // allocating, pool the wrapper type. - elem := _errArrayElemPool.Get().(*errArrayElem) + elem := _errArrayElemPool.Get() elem.error = errs[i] - arr.AppendObject(elem) + err := arr.AppendObject(elem) elem.error = nil _errArrayElemPool.Put(elem) + if err != nil { + return err + } } return nil } diff --git a/vendor/go.uber.org/zap/field.go b/vendor/go.uber.org/zap/field.go index bbb745d..6743930 100644 --- a/vendor/go.uber.org/zap/field.go +++ b/vendor/go.uber.org/zap/field.go @@ -25,6 +25,7 @@ import ( "math" "time" + "go.uber.org/zap/internal/stacktrace" "go.uber.org/zap/zapcore" ) @@ -374,7 +375,7 @@ func StackSkip(key string, skip int) Field { // from expanding the zapcore.Field union struct to include a byte slice. Since // taking a stacktrace is already so expensive (~10us), the extra allocation // is okay. - return String(key, takeStacktrace(skip+1)) // skip StackSkip + return String(key, stacktrace.Take(skip+1)) // skip StackSkip } // Duration constructs a field with the given key and value. The encoder @@ -410,6 +411,65 @@ func Inline(val zapcore.ObjectMarshaler) Field { } } +// Dict constructs a field containing the provided key-value pairs. +// It acts similar to [Object], but with the fields specified as arguments. +func Dict(key string, val ...Field) Field { + return dictField(key, val) +} + +// We need a function with the signature (string, T) for zap.Any. +func dictField(key string, val []Field) Field { + return Object(key, dictObject(val)) +} + +type dictObject []Field + +func (d dictObject) MarshalLogObject(enc zapcore.ObjectEncoder) error { + for _, f := range d { + f.AddTo(enc) + } + return nil +} + +// We discovered an issue where zap.Any can cause a performance degradation +// when used in new goroutines. +// +// This happens because the compiler assigns 4.8kb (one zap.Field per arm of +// switch statement) of stack space for zap.Any when it takes the form: +// +// switch v := v.(type) { +// case string: +// return String(key, v) +// case int: +// return Int(key, v) +// // ... +// default: +// return Reflect(key, v) +// } +// +// To avoid this, we use the type switch to assign a value to a single local variable +// and then call a function on it. +// The local variable is just a function reference so it doesn't allocate +// when converted to an interface{}. +// +// A fair bit of experimentation went into this. +// See also: +// +// - https://github.com/uber-go/zap/pull/1301 +// - https://github.com/uber-go/zap/pull/1303 +// - https://github.com/uber-go/zap/pull/1304 +// - https://github.com/uber-go/zap/pull/1305 +// - https://github.com/uber-go/zap/pull/1308 +// +// See https://github.com/golang/go/issues/62077 for upstream issue. +type anyFieldC[T any] func(string, T) Field + +func (f anyFieldC[T]) Any(key string, val any) Field { + v, _ := val.(T) + // val is guaranteed to be a T, except when it's nil. + return f(key, v) +} + // Any takes a key and an arbitrary value and chooses the best way to represent // them as a field, falling back to a reflection-based approach only if // necessary. @@ -418,132 +478,138 @@ func Inline(val zapcore.ObjectMarshaler) Field { // them. To minimize surprises, []byte values are treated as binary blobs, byte // values are treated as uint8, and runes are always treated as integers. func Any(key string, value interface{}) Field { - switch val := value.(type) { + var c interface{ Any(string, any) Field } + + switch value.(type) { case zapcore.ObjectMarshaler: - return Object(key, val) + c = anyFieldC[zapcore.ObjectMarshaler](Object) case zapcore.ArrayMarshaler: - return Array(key, val) + c = anyFieldC[zapcore.ArrayMarshaler](Array) + case []Field: + c = anyFieldC[[]Field](dictField) case bool: - return Bool(key, val) + c = anyFieldC[bool](Bool) case *bool: - return Boolp(key, val) + c = anyFieldC[*bool](Boolp) case []bool: - return Bools(key, val) + c = anyFieldC[[]bool](Bools) case complex128: - return Complex128(key, val) + c = anyFieldC[complex128](Complex128) case *complex128: - return Complex128p(key, val) + c = anyFieldC[*complex128](Complex128p) case []complex128: - return Complex128s(key, val) + c = anyFieldC[[]complex128](Complex128s) case complex64: - return Complex64(key, val) + c = anyFieldC[complex64](Complex64) case *complex64: - return Complex64p(key, val) + c = anyFieldC[*complex64](Complex64p) case []complex64: - return Complex64s(key, val) + c = anyFieldC[[]complex64](Complex64s) case float64: - return Float64(key, val) + c = anyFieldC[float64](Float64) case *float64: - return Float64p(key, val) + c = anyFieldC[*float64](Float64p) case []float64: - return Float64s(key, val) + c = anyFieldC[[]float64](Float64s) case float32: - return Float32(key, val) + c = anyFieldC[float32](Float32) case *float32: - return Float32p(key, val) + c = anyFieldC[*float32](Float32p) case []float32: - return Float32s(key, val) + c = anyFieldC[[]float32](Float32s) case int: - return Int(key, val) + c = anyFieldC[int](Int) case *int: - return Intp(key, val) + c = anyFieldC[*int](Intp) case []int: - return Ints(key, val) + c = anyFieldC[[]int](Ints) case int64: - return Int64(key, val) + c = anyFieldC[int64](Int64) case *int64: - return Int64p(key, val) + c = anyFieldC[*int64](Int64p) case []int64: - return Int64s(key, val) + c = anyFieldC[[]int64](Int64s) case int32: - return Int32(key, val) + c = anyFieldC[int32](Int32) case *int32: - return Int32p(key, val) + c = anyFieldC[*int32](Int32p) case []int32: - return Int32s(key, val) + c = anyFieldC[[]int32](Int32s) case int16: - return Int16(key, val) + c = anyFieldC[int16](Int16) case *int16: - return Int16p(key, val) + c = anyFieldC[*int16](Int16p) case []int16: - return Int16s(key, val) + c = anyFieldC[[]int16](Int16s) case int8: - return Int8(key, val) + c = anyFieldC[int8](Int8) case *int8: - return Int8p(key, val) + c = anyFieldC[*int8](Int8p) case []int8: - return Int8s(key, val) + c = anyFieldC[[]int8](Int8s) case string: - return String(key, val) + c = anyFieldC[string](String) case *string: - return Stringp(key, val) + c = anyFieldC[*string](Stringp) case []string: - return Strings(key, val) + c = anyFieldC[[]string](Strings) case uint: - return Uint(key, val) + c = anyFieldC[uint](Uint) case *uint: - return Uintp(key, val) + c = anyFieldC[*uint](Uintp) case []uint: - return Uints(key, val) + c = anyFieldC[[]uint](Uints) case uint64: - return Uint64(key, val) + c = anyFieldC[uint64](Uint64) case *uint64: - return Uint64p(key, val) + c = anyFieldC[*uint64](Uint64p) case []uint64: - return Uint64s(key, val) + c = anyFieldC[[]uint64](Uint64s) case uint32: - return Uint32(key, val) + c = anyFieldC[uint32](Uint32) case *uint32: - return Uint32p(key, val) + c = anyFieldC[*uint32](Uint32p) case []uint32: - return Uint32s(key, val) + c = anyFieldC[[]uint32](Uint32s) case uint16: - return Uint16(key, val) + c = anyFieldC[uint16](Uint16) case *uint16: - return Uint16p(key, val) + c = anyFieldC[*uint16](Uint16p) case []uint16: - return Uint16s(key, val) + c = anyFieldC[[]uint16](Uint16s) case uint8: - return Uint8(key, val) + c = anyFieldC[uint8](Uint8) case *uint8: - return Uint8p(key, val) + c = anyFieldC[*uint8](Uint8p) case []byte: - return Binary(key, val) + c = anyFieldC[[]byte](Binary) case uintptr: - return Uintptr(key, val) + c = anyFieldC[uintptr](Uintptr) case *uintptr: - return Uintptrp(key, val) + c = anyFieldC[*uintptr](Uintptrp) case []uintptr: - return Uintptrs(key, val) + c = anyFieldC[[]uintptr](Uintptrs) case time.Time: - return Time(key, val) + c = anyFieldC[time.Time](Time) case *time.Time: - return Timep(key, val) + c = anyFieldC[*time.Time](Timep) case []time.Time: - return Times(key, val) + c = anyFieldC[[]time.Time](Times) case time.Duration: - return Duration(key, val) + c = anyFieldC[time.Duration](Duration) case *time.Duration: - return Durationp(key, val) + c = anyFieldC[*time.Duration](Durationp) case []time.Duration: - return Durations(key, val) + c = anyFieldC[[]time.Duration](Durations) case error: - return NamedError(key, val) + c = anyFieldC[error](NamedError) case []error: - return Errors(key, val) + c = anyFieldC[[]error](Errors) case fmt.Stringer: - return Stringer(key, val) + c = anyFieldC[fmt.Stringer](Stringer) default: - return Reflect(key, val) + c = anyFieldC[any](Reflect) } + + return c.Any(key, value) } diff --git a/vendor/go.uber.org/zap/http_handler.go b/vendor/go.uber.org/zap/http_handler.go index 632b683..2be8f65 100644 --- a/vendor/go.uber.org/zap/http_handler.go +++ b/vendor/go.uber.org/zap/http_handler.go @@ -69,6 +69,13 @@ import ( // // curl -X PUT localhost:8080/log/level -H "Content-Type: application/json" -d '{"level":"debug"}' func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) { + if err := lvl.serveHTTP(w, r); err != nil { + w.WriteHeader(http.StatusInternalServerError) + fmt.Fprintf(w, "internal error: %v", err) + } +} + +func (lvl AtomicLevel) serveHTTP(w http.ResponseWriter, r *http.Request) error { type errorResponse struct { Error string `json:"error"` } @@ -80,19 +87,20 @@ func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) { switch r.Method { case http.MethodGet: - enc.Encode(payload{Level: lvl.Level()}) + return enc.Encode(payload{Level: lvl.Level()}) + case http.MethodPut: requestedLvl, err := decodePutRequest(r.Header.Get("Content-Type"), r) if err != nil { w.WriteHeader(http.StatusBadRequest) - enc.Encode(errorResponse{Error: err.Error()}) - return + return enc.Encode(errorResponse{Error: err.Error()}) } lvl.SetLevel(requestedLvl) - enc.Encode(payload{Level: lvl.Level()}) + return enc.Encode(payload{Level: lvl.Level()}) + default: w.WriteHeader(http.StatusMethodNotAllowed) - enc.Encode(errorResponse{ + return enc.Encode(errorResponse{ Error: "Only GET and PUT are supported.", }) } @@ -129,5 +137,4 @@ func decodePutJSON(body io.Reader) (zapcore.Level, error) { return 0, errors.New("must specify logging level") } return *pld.Level, nil - } diff --git a/vendor/go.uber.org/zap/internal/level_enabler.go b/vendor/go.uber.org/zap/internal/level_enabler.go index 5f3e3f1..40bfed8 100644 --- a/vendor/go.uber.org/zap/internal/level_enabler.go +++ b/vendor/go.uber.org/zap/internal/level_enabler.go @@ -18,6 +18,8 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. +// Package internal and its subpackages hold types and functionality +// that are not part of Zap's public API. package internal import "go.uber.org/zap/zapcore" diff --git a/vendor/go.uber.org/atomic/time.go b/vendor/go.uber.org/zap/internal/pool/pool.go similarity index 56% rename from vendor/go.uber.org/atomic/time.go rename to vendor/go.uber.org/zap/internal/pool/pool.go index cc2a230..60e9d2c 100644 --- a/vendor/go.uber.org/atomic/time.go +++ b/vendor/go.uber.org/zap/internal/pool/pool.go @@ -1,6 +1,4 @@ -// @generated Code generated by gen-atomicwrapper. - -// Copyright (c) 2020-2023 Uber Technologies, Inc. +// Copyright (c) 2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -20,36 +18,41 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -package atomic +// Package pool provides internal pool utilities. +package pool import ( - "time" + "sync" ) -// Time is an atomic type-safe wrapper for time.Time values. -type Time struct { - _ nocmp // disallow non-atomic comparison - - v Value +// A Pool is a generic wrapper around [sync.Pool] to provide strongly-typed +// object pooling. +// +// Note that SA6002 (ref: https://staticcheck.io/docs/checks/#SA6002) will +// not be detected, so all internal pool use must take care to only store +// pointer types. +type Pool[T any] struct { + pool sync.Pool } -var _zeroTime time.Time - -// NewTime creates a new Time. -func NewTime(val time.Time) *Time { - x := &Time{} - if val != _zeroTime { - x.Store(val) +// New returns a new [Pool] for T, and will use fn to construct new Ts when +// the pool is empty. +func New[T any](fn func() T) *Pool[T] { + return &Pool[T]{ + pool: sync.Pool{ + New: func() any { + return fn() + }, + }, } - return x } -// Load atomically loads the wrapped time.Time. -func (x *Time) Load() time.Time { - return unpackTime(x.v.Load()) +// Get gets a T from the pool, or creates a new one if the pool is empty. +func (p *Pool[T]) Get() T { + return p.pool.Get().(T) } -// Store atomically stores the passed time.Time. -func (x *Time) Store(val time.Time) { - x.v.Store(packTime(val)) +// Put returns x into the pool. +func (p *Pool[T]) Put(x T) { + p.pool.Put(x) } diff --git a/vendor/go.uber.org/zap/stacktrace.go b/vendor/go.uber.org/zap/internal/stacktrace/stack.go similarity index 73% rename from vendor/go.uber.org/zap/stacktrace.go rename to vendor/go.uber.org/zap/internal/stacktrace/stack.go index 817a3bd..82af755 100644 --- a/vendor/go.uber.org/zap/stacktrace.go +++ b/vendor/go.uber.org/zap/internal/stacktrace/stack.go @@ -1,4 +1,4 @@ -// Copyright (c) 2016 Uber Technologies, Inc. +// Copyright (c) 2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -18,25 +18,26 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -package zap +// Package stacktrace provides support for gathering stack traces +// efficiently. +package stacktrace import ( "runtime" - "sync" "go.uber.org/zap/buffer" "go.uber.org/zap/internal/bufferpool" + "go.uber.org/zap/internal/pool" ) -var _stacktracePool = sync.Pool{ - New: func() interface{} { - return &stacktrace{ - storage: make([]uintptr, 64), - } - }, -} +var _stackPool = pool.New(func() *Stack { + return &Stack{ + storage: make([]uintptr, 64), + } +}) -type stacktrace struct { +// Stack is a captured stack trace. +type Stack struct { pcs []uintptr // program counters; always a subslice of storage frames *runtime.Frames @@ -50,30 +51,30 @@ type stacktrace struct { storage []uintptr } -// stacktraceDepth specifies how deep of a stack trace should be captured. -type stacktraceDepth int +// Depth specifies how deep of a stack trace should be captured. +type Depth int const ( - // stacktraceFirst captures only the first frame. - stacktraceFirst stacktraceDepth = iota + // First captures only the first frame. + First Depth = iota - // stacktraceFull captures the entire call stack, allocating more + // Full captures the entire call stack, allocating more // storage for it if needed. - stacktraceFull + Full ) -// captureStacktrace captures a stack trace of the specified depth, skipping +// Capture captures a stack trace of the specified depth, skipping // the provided number of frames. skip=0 identifies the caller of -// captureStacktrace. +// Capture. // // The caller must call Free on the returned stacktrace after using it. -func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace { - stack := _stacktracePool.Get().(*stacktrace) +func Capture(skip int, depth Depth) *Stack { + stack := _stackPool.Get() switch depth { - case stacktraceFirst: + case First: stack.pcs = stack.storage[:1] - case stacktraceFull: + case Full: stack.pcs = stack.storage } @@ -87,7 +88,7 @@ func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace { // runtime.Callers truncates the recorded stacktrace if there is no // room in the provided slice. For the full stack trace, keep expanding // storage until there are fewer frames than there is room. - if depth == stacktraceFull { + if depth == Full { pcs := stack.pcs for numFrames == len(pcs) { pcs = make([]uintptr, len(pcs)*2) @@ -109,50 +110,54 @@ func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace { // Free releases resources associated with this stacktrace // and returns it back to the pool. -func (st *stacktrace) Free() { +func (st *Stack) Free() { st.frames = nil st.pcs = nil - _stacktracePool.Put(st) + _stackPool.Put(st) } // Count reports the total number of frames in this stacktrace. // Count DOES NOT change as Next is called. -func (st *stacktrace) Count() int { +func (st *Stack) Count() int { return len(st.pcs) } // Next returns the next frame in the stack trace, // and a boolean indicating whether there are more after it. -func (st *stacktrace) Next() (_ runtime.Frame, more bool) { +func (st *Stack) Next() (_ runtime.Frame, more bool) { return st.frames.Next() } -func takeStacktrace(skip int) string { - stack := captureStacktrace(skip+1, stacktraceFull) +// Take returns a string representation of the current stacktrace. +// +// skip is the number of frames to skip before recording the stack trace. +// skip=0 identifies the caller of Take. +func Take(skip int) string { + stack := Capture(skip+1, Full) defer stack.Free() buffer := bufferpool.Get() defer buffer.Free() - stackfmt := newStackFormatter(buffer) + stackfmt := NewFormatter(buffer) stackfmt.FormatStack(stack) return buffer.String() } -// stackFormatter formats a stack trace into a readable string representation. -type stackFormatter struct { +// Formatter formats a stack trace into a readable string representation. +type Formatter struct { b *buffer.Buffer nonEmpty bool // whehther we've written at least one frame already } -// newStackFormatter builds a new stackFormatter. -func newStackFormatter(b *buffer.Buffer) stackFormatter { - return stackFormatter{b: b} +// NewFormatter builds a new Formatter. +func NewFormatter(b *buffer.Buffer) Formatter { + return Formatter{b: b} } // FormatStack formats all remaining frames in the provided stacktrace -- minus // the final runtime.main/runtime.goexit frame. -func (sf *stackFormatter) FormatStack(stack *stacktrace) { +func (sf *Formatter) FormatStack(stack *Stack) { // Note: On the last iteration, frames.Next() returns false, with a valid // frame, but we ignore this frame. The last frame is a runtime frame which // adds noise, since it's only either runtime.main or runtime.goexit. @@ -162,7 +167,7 @@ func (sf *stackFormatter) FormatStack(stack *stacktrace) { } // FormatFrame formats the given frame. -func (sf *stackFormatter) FormatFrame(frame runtime.Frame) { +func (sf *Formatter) FormatFrame(frame runtime.Frame) { if sf.nonEmpty { sf.b.AppendByte('\n') } diff --git a/vendor/go.uber.org/zap/level.go b/vendor/go.uber.org/zap/level.go index db951e1..155b208 100644 --- a/vendor/go.uber.org/zap/level.go +++ b/vendor/go.uber.org/zap/level.go @@ -21,7 +21,8 @@ package zap import ( - "go.uber.org/atomic" + "sync/atomic" + "go.uber.org/zap/internal" "go.uber.org/zap/zapcore" ) @@ -76,9 +77,9 @@ var _ internal.LeveledEnabler = AtomicLevel{} // NewAtomicLevel creates an AtomicLevel with InfoLevel and above logging // enabled. func NewAtomicLevel() AtomicLevel { - return AtomicLevel{ - l: atomic.NewInt32(int32(InfoLevel)), - } + lvl := AtomicLevel{l: new(atomic.Int32)} + lvl.l.Store(int32(InfoLevel)) + return lvl } // NewAtomicLevelAt is a convenience function that creates an AtomicLevel diff --git a/vendor/go.uber.org/zap/logger.go b/vendor/go.uber.org/zap/logger.go index cd44030..c4d3003 100644 --- a/vendor/go.uber.org/zap/logger.go +++ b/vendor/go.uber.org/zap/logger.go @@ -27,6 +27,7 @@ import ( "strings" "go.uber.org/zap/internal/bufferpool" + "go.uber.org/zap/internal/stacktrace" "go.uber.org/zap/zapcore" ) @@ -42,6 +43,7 @@ type Logger struct { development bool addCaller bool + onPanic zapcore.CheckWriteHook // default is WriteThenPanic onFatal zapcore.CheckWriteHook // default is WriteThenFatal name string @@ -173,7 +175,8 @@ func (log *Logger) WithOptions(opts ...Option) *Logger { } // With creates a child logger and adds structured context to it. Fields added -// to the child don't affect the parent, and vice versa. +// to the child don't affect the parent, and vice versa. Any fields that +// require evaluation (such as Objects) are evaluated upon invocation of With. func (log *Logger) With(fields ...Field) *Logger { if len(fields) == 0 { return log @@ -183,6 +186,28 @@ func (log *Logger) With(fields ...Field) *Logger { return l } +// WithLazy creates a child logger and adds structured context to it lazily. +// +// The fields are evaluated only if the logger is further chained with [With] +// or is written to with any of the log level methods. +// Until that occurs, the logger may retain references to objects inside the fields, +// and logging will reflect the state of an object at the time of logging, +// not the time of WithLazy(). +// +// WithLazy provides a worthwhile performance optimization for contextual loggers +// when the likelihood of using the child logger is low, +// such as error paths and rarely taken branches. +// +// Similar to [With], fields added to the child don't affect the parent, and vice versa. +func (log *Logger) WithLazy(fields ...Field) *Logger { + if len(fields) == 0 { + return log + } + return log.WithOptions(WrapCore(func(core zapcore.Core) zapcore.Core { + return zapcore.NewLazyWith(core, fields) + })) +} + // Level reports the minimum enabled level for this logger. // // For NopLoggers, this is [zapcore.InvalidLevel]. @@ -199,6 +224,8 @@ func (log *Logger) Check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { // Log logs a message at the specified level. The message includes any fields // passed at the log site, as well as any fields accumulated on the logger. +// Any Fields that require evaluation (such as Objects) are evaluated upon +// invocation of Log. func (log *Logger) Log(lvl zapcore.Level, msg string, fields ...Field) { if ce := log.check(lvl, msg); ce != nil { ce.Write(fields...) @@ -281,9 +308,15 @@ func (log *Logger) Core() zapcore.Core { return log.core } +// Name returns the Logger's underlying name, +// or an empty string if the logger is unnamed. +func (log *Logger) Name() string { + return log.name +} + func (log *Logger) clone() *Logger { - copy := *log - return © + clone := *log + return &clone } func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { @@ -313,27 +346,12 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { // Set up any required terminal behavior. switch ent.Level { case zapcore.PanicLevel: - ce = ce.After(ent, zapcore.WriteThenPanic) + ce = ce.After(ent, terminalHookOverride(zapcore.WriteThenPanic, log.onPanic)) case zapcore.FatalLevel: - onFatal := log.onFatal - // nil or WriteThenNoop will lead to continued execution after - // a Fatal log entry, which is unexpected. For example, - // - // f, err := os.Open(..) - // if err != nil { - // log.Fatal("cannot open", zap.Error(err)) - // } - // fmt.Println(f.Name()) - // - // The f.Name() will panic if we continue execution after the - // log.Fatal. - if onFatal == nil || onFatal == zapcore.WriteThenNoop { - onFatal = zapcore.WriteThenFatal - } - ce = ce.After(ent, onFatal) + ce = ce.After(ent, terminalHookOverride(zapcore.WriteThenFatal, log.onFatal)) case zapcore.DPanicLevel: if log.development { - ce = ce.After(ent, zapcore.WriteThenPanic) + ce = ce.After(ent, terminalHookOverride(zapcore.WriteThenPanic, log.onPanic)) } } @@ -354,17 +372,17 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { // Adding the caller or stack trace requires capturing the callers of // this function. We'll share information between these two. - stackDepth := stacktraceFirst + stackDepth := stacktrace.First if addStack { - stackDepth = stacktraceFull + stackDepth = stacktrace.Full } - stack := captureStacktrace(log.callerSkip+callerSkipOffset, stackDepth) + stack := stacktrace.Capture(log.callerSkip+callerSkipOffset, stackDepth) defer stack.Free() if stack.Count() == 0 { if log.addCaller { fmt.Fprintf(log.errorOutput, "%v Logger.check error: failed to get caller\n", ent.Time.UTC()) - log.errorOutput.Sync() + _ = log.errorOutput.Sync() } return ce } @@ -385,7 +403,7 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { buffer := bufferpool.Get() defer buffer.Free() - stackfmt := newStackFormatter(buffer) + stackfmt := stacktrace.NewFormatter(buffer) // We've already extracted the first frame, so format that // separately and defer to stackfmt for the rest. @@ -398,3 +416,20 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry { return ce } + +func terminalHookOverride(defaultHook, override zapcore.CheckWriteHook) zapcore.CheckWriteHook { + // A nil or WriteThenNoop hook will lead to continued execution after + // a Panic or Fatal log entry, which is unexpected. For example, + // + // f, err := os.Open(..) + // if err != nil { + // log.Fatal("cannot open", zap.Error(err)) + // } + // fmt.Println(f.Name()) + // + // The f.Name() will panic if we continue execution after the log.Fatal. + if override == nil || override == zapcore.WriteThenNoop { + return defaultHook + } + return override +} diff --git a/vendor/go.uber.org/zap/options.go b/vendor/go.uber.org/zap/options.go index c4f3bca..43d357a 100644 --- a/vendor/go.uber.org/zap/options.go +++ b/vendor/go.uber.org/zap/options.go @@ -132,6 +132,21 @@ func IncreaseLevel(lvl zapcore.LevelEnabler) Option { }) } +// WithPanicHook sets a CheckWriteHook to run on Panic/DPanic logs. +// Zap will call this hook after writing a log statement with a Panic/DPanic level. +// +// For example, the following builds a logger that will exit the current +// goroutine after writing a Panic/DPanic log message, but it will not start a panic. +// +// zap.New(core, zap.WithPanicHook(zapcore.WriteThenGoexit)) +// +// This is useful for testing Panic/DPanic log output. +func WithPanicHook(hook zapcore.CheckWriteHook) Option { + return optionFunc(func(log *Logger) { + log.onPanic = hook + }) +} + // OnFatal sets the action to take on fatal logs. // // Deprecated: Use [WithFatalHook] instead. diff --git a/vendor/go.uber.org/zap/sink.go b/vendor/go.uber.org/zap/sink.go index 478c9a1..499772a 100644 --- a/vendor/go.uber.org/zap/sink.go +++ b/vendor/go.uber.org/zap/sink.go @@ -66,7 +66,8 @@ func newSinkRegistry() *sinkRegistry { factories: make(map[string]func(*url.URL) (Sink, error)), openFile: os.OpenFile, } - sr.RegisterSink(schemeFile, sr.newFileSinkFromURL) + // Infallible operation: the registry is empty, so we can't have a conflict. + _ = sr.RegisterSink(schemeFile, sr.newFileSinkFromURL) return sr } @@ -154,7 +155,7 @@ func (sr *sinkRegistry) newFileSinkFromPath(path string) (Sink, error) { case "stderr": return nopCloserSink{os.Stderr}, nil } - return sr.openFile(path, os.O_WRONLY|os.O_APPEND|os.O_CREATE, 0666) + return sr.openFile(path, os.O_WRONLY|os.O_APPEND|os.O_CREATE, 0o666) } func normalizeScheme(s string) (string, error) { diff --git a/vendor/go.uber.org/zap/sugar.go b/vendor/go.uber.org/zap/sugar.go index ac387b3..8904cd0 100644 --- a/vendor/go.uber.org/zap/sugar.go +++ b/vendor/go.uber.org/zap/sugar.go @@ -115,6 +115,21 @@ func (s *SugaredLogger) With(args ...interface{}) *SugaredLogger { return &SugaredLogger{base: s.base.With(s.sweetenFields(args)...)} } +// WithLazy adds a variadic number of fields to the logging context lazily. +// The fields are evaluated only if the logger is further chained with [With] +// or is written to with any of the log level methods. +// Until that occurs, the logger may retain references to objects inside the fields, +// and logging will reflect the state of an object at the time of logging, +// not the time of WithLazy(). +// +// Similar to [With], fields added to the child don't affect the parent, +// and vice versa. Also, the keys in key-value pairs should be strings. In development, +// passing a non-string key panics, while in production it logs an error and skips the pair. +// Passing an orphaned key has the same behavior. +func (s *SugaredLogger) WithLazy(args ...interface{}) *SugaredLogger { + return &SugaredLogger{base: s.base.WithLazy(s.sweetenFields(args)...)} +} + // Level reports the minimum enabled level for this logger. // // For NopLoggers, this is [zapcore.InvalidLevel]. @@ -122,78 +137,110 @@ func (s *SugaredLogger) Level() zapcore.Level { return zapcore.LevelOf(s.base.core) } -// Debug uses fmt.Sprint to construct and log a message. +// Log logs the provided arguments at provided level. +// Spaces are added between arguments when neither is a string. +func (s *SugaredLogger) Log(lvl zapcore.Level, args ...interface{}) { + s.log(lvl, "", args, nil) +} + +// Debug logs the provided arguments at [DebugLevel]. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Debug(args ...interface{}) { s.log(DebugLevel, "", args, nil) } -// Info uses fmt.Sprint to construct and log a message. +// Info logs the provided arguments at [InfoLevel]. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Info(args ...interface{}) { s.log(InfoLevel, "", args, nil) } -// Warn uses fmt.Sprint to construct and log a message. +// Warn logs the provided arguments at [WarnLevel]. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Warn(args ...interface{}) { s.log(WarnLevel, "", args, nil) } -// Error uses fmt.Sprint to construct and log a message. +// Error logs the provided arguments at [ErrorLevel]. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Error(args ...interface{}) { s.log(ErrorLevel, "", args, nil) } -// DPanic uses fmt.Sprint to construct and log a message. In development, the -// logger then panics. (See DPanicLevel for details.) +// DPanic logs the provided arguments at [DPanicLevel]. +// In development, the logger then panics. (See [DPanicLevel] for details.) +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) DPanic(args ...interface{}) { s.log(DPanicLevel, "", args, nil) } -// Panic uses fmt.Sprint to construct and log a message, then panics. +// Panic constructs a message with the provided arguments and panics. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Panic(args ...interface{}) { s.log(PanicLevel, "", args, nil) } -// Fatal uses fmt.Sprint to construct and log a message, then calls os.Exit. +// Fatal constructs a message with the provided arguments and calls os.Exit. +// Spaces are added between arguments when neither is a string. func (s *SugaredLogger) Fatal(args ...interface{}) { s.log(FatalLevel, "", args, nil) } -// Debugf uses fmt.Sprintf to log a templated message. +// Logf formats the message according to the format specifier +// and logs it at provided level. +func (s *SugaredLogger) Logf(lvl zapcore.Level, template string, args ...interface{}) { + s.log(lvl, template, args, nil) +} + +// Debugf formats the message according to the format specifier +// and logs it at [DebugLevel]. func (s *SugaredLogger) Debugf(template string, args ...interface{}) { s.log(DebugLevel, template, args, nil) } -// Infof uses fmt.Sprintf to log a templated message. +// Infof formats the message according to the format specifier +// and logs it at [InfoLevel]. func (s *SugaredLogger) Infof(template string, args ...interface{}) { s.log(InfoLevel, template, args, nil) } -// Warnf uses fmt.Sprintf to log a templated message. +// Warnf formats the message according to the format specifier +// and logs it at [WarnLevel]. func (s *SugaredLogger) Warnf(template string, args ...interface{}) { s.log(WarnLevel, template, args, nil) } -// Errorf uses fmt.Sprintf to log a templated message. +// Errorf formats the message according to the format specifier +// and logs it at [ErrorLevel]. func (s *SugaredLogger) Errorf(template string, args ...interface{}) { s.log(ErrorLevel, template, args, nil) } -// DPanicf uses fmt.Sprintf to log a templated message. In development, the -// logger then panics. (See DPanicLevel for details.) +// DPanicf formats the message according to the format specifier +// and logs it at [DPanicLevel]. +// In development, the logger then panics. (See [DPanicLevel] for details.) func (s *SugaredLogger) DPanicf(template string, args ...interface{}) { s.log(DPanicLevel, template, args, nil) } -// Panicf uses fmt.Sprintf to log a templated message, then panics. +// Panicf formats the message according to the format specifier +// and panics. func (s *SugaredLogger) Panicf(template string, args ...interface{}) { s.log(PanicLevel, template, args, nil) } -// Fatalf uses fmt.Sprintf to log a templated message, then calls os.Exit. +// Fatalf formats the message according to the format specifier +// and calls os.Exit. func (s *SugaredLogger) Fatalf(template string, args ...interface{}) { s.log(FatalLevel, template, args, nil) } +// Logw logs a message with some additional context. The variadic key-value +// pairs are treated as they are in With. +func (s *SugaredLogger) Logw(lvl zapcore.Level, msg string, keysAndValues ...interface{}) { + s.log(lvl, msg, nil, keysAndValues) +} + // Debugw logs a message with some additional context. The variadic key-value // pairs are treated as they are in With. // @@ -241,38 +288,51 @@ func (s *SugaredLogger) Fatalw(msg string, keysAndValues ...interface{}) { s.log(FatalLevel, msg, nil, keysAndValues) } -// Debugln uses fmt.Sprintln to construct and log a message. +// Logln logs a message at provided level. +// Spaces are always added between arguments. +func (s *SugaredLogger) Logln(lvl zapcore.Level, args ...interface{}) { + s.logln(lvl, args, nil) +} + +// Debugln logs a message at [DebugLevel]. +// Spaces are always added between arguments. func (s *SugaredLogger) Debugln(args ...interface{}) { s.logln(DebugLevel, args, nil) } -// Infoln uses fmt.Sprintln to construct and log a message. +// Infoln logs a message at [InfoLevel]. +// Spaces are always added between arguments. func (s *SugaredLogger) Infoln(args ...interface{}) { s.logln(InfoLevel, args, nil) } -// Warnln uses fmt.Sprintln to construct and log a message. +// Warnln logs a message at [WarnLevel]. +// Spaces are always added between arguments. func (s *SugaredLogger) Warnln(args ...interface{}) { s.logln(WarnLevel, args, nil) } -// Errorln uses fmt.Sprintln to construct and log a message. +// Errorln logs a message at [ErrorLevel]. +// Spaces are always added between arguments. func (s *SugaredLogger) Errorln(args ...interface{}) { s.logln(ErrorLevel, args, nil) } -// DPanicln uses fmt.Sprintln to construct and log a message. In development, the -// logger then panics. (See DPanicLevel for details.) +// DPanicln logs a message at [DPanicLevel]. +// In development, the logger then panics. (See [DPanicLevel] for details.) +// Spaces are always added between arguments. func (s *SugaredLogger) DPanicln(args ...interface{}) { s.logln(DPanicLevel, args, nil) } -// Panicln uses fmt.Sprintln to construct and log a message, then panics. +// Panicln logs a message at [PanicLevel] and panics. +// Spaces are always added between arguments. func (s *SugaredLogger) Panicln(args ...interface{}) { s.logln(PanicLevel, args, nil) } -// Fatalln uses fmt.Sprintln to construct and log a message, then calls os.Exit. +// Fatalln logs a message at [FatalLevel] and calls os.Exit. +// Spaces are always added between arguments. func (s *SugaredLogger) Fatalln(args ...interface{}) { s.logln(FatalLevel, args, nil) } diff --git a/vendor/go.uber.org/zap/writer.go b/vendor/go.uber.org/zap/writer.go index f08728e..06768c6 100644 --- a/vendor/go.uber.org/zap/writer.go +++ b/vendor/go.uber.org/zap/writer.go @@ -48,21 +48,21 @@ import ( // os.Stdout and os.Stderr. When specified without a scheme, relative file // paths also work. func Open(paths ...string) (zapcore.WriteSyncer, func(), error) { - writers, close, err := open(paths) + writers, closeAll, err := open(paths) if err != nil { return nil, nil, err } writer := CombineWriteSyncers(writers...) - return writer, close, nil + return writer, closeAll, nil } func open(paths []string) ([]zapcore.WriteSyncer, func(), error) { writers := make([]zapcore.WriteSyncer, 0, len(paths)) closers := make([]io.Closer, 0, len(paths)) - close := func() { + closeAll := func() { for _, c := range closers { - c.Close() + _ = c.Close() } } @@ -77,11 +77,11 @@ func open(paths []string) ([]zapcore.WriteSyncer, func(), error) { closers = append(closers, sink) } if openErr != nil { - close() + closeAll() return nil, nil, openErr } - return writers, close, nil + return writers, closeAll, nil } // CombineWriteSyncers is a utility that combines multiple WriteSyncers into a diff --git a/vendor/go.uber.org/zap/zapcore/console_encoder.go b/vendor/go.uber.org/zap/zapcore/console_encoder.go index 1aa5dc3..cc2b4e0 100644 --- a/vendor/go.uber.org/zap/zapcore/console_encoder.go +++ b/vendor/go.uber.org/zap/zapcore/console_encoder.go @@ -22,20 +22,20 @@ package zapcore import ( "fmt" - "sync" "go.uber.org/zap/buffer" "go.uber.org/zap/internal/bufferpool" + "go.uber.org/zap/internal/pool" ) -var _sliceEncoderPool = sync.Pool{ - New: func() interface{} { - return &sliceArrayEncoder{elems: make([]interface{}, 0, 2)} - }, -} +var _sliceEncoderPool = pool.New(func() *sliceArrayEncoder { + return &sliceArrayEncoder{ + elems: make([]interface{}, 0, 2), + } +}) func getSliceEncoder() *sliceArrayEncoder { - return _sliceEncoderPool.Get().(*sliceArrayEncoder) + return _sliceEncoderPool.Get() } func putSliceEncoder(e *sliceArrayEncoder) { @@ -77,7 +77,7 @@ func (c consoleEncoder) EncodeEntry(ent Entry, fields []Field) (*buffer.Buffer, // If this ever becomes a performance bottleneck, we can implement // ArrayEncoder for our plain-text format. arr := getSliceEncoder() - if c.TimeKey != "" && c.EncodeTime != nil { + if c.TimeKey != "" && c.EncodeTime != nil && !ent.Time.IsZero() { c.EncodeTime(ent.Time, arr) } if c.LevelKey != "" && c.EncodeLevel != nil { diff --git a/vendor/go.uber.org/zap/zapcore/core.go b/vendor/go.uber.org/zap/zapcore/core.go index 9dfd640..776e93f 100644 --- a/vendor/go.uber.org/zap/zapcore/core.go +++ b/vendor/go.uber.org/zap/zapcore/core.go @@ -102,9 +102,9 @@ func (c *ioCore) Write(ent Entry, fields []Field) error { return err } if ent.Level > ErrorLevel { - // Since we may be crashing the program, sync the output. Ignore Sync - // errors, pending a clean solution to issue #370. - c.Sync() + // Since we may be crashing the program, sync the output. + // Ignore Sync errors, pending a clean solution to issue #370. + _ = c.Sync() } return nil } diff --git a/vendor/go.uber.org/zap/zapcore/encoder.go b/vendor/go.uber.org/zap/zapcore/encoder.go index 5769ff3..0446254 100644 --- a/vendor/go.uber.org/zap/zapcore/encoder.go +++ b/vendor/go.uber.org/zap/zapcore/encoder.go @@ -37,6 +37,9 @@ const DefaultLineEnding = "\n" const OmitKey = "" // A LevelEncoder serializes a Level to a primitive type. +// +// This function must make exactly one call +// to a PrimitiveArrayEncoder's Append* method. type LevelEncoder func(Level, PrimitiveArrayEncoder) // LowercaseLevelEncoder serializes a Level to a lowercase string. For example, @@ -90,6 +93,9 @@ func (e *LevelEncoder) UnmarshalText(text []byte) error { } // A TimeEncoder serializes a time.Time to a primitive type. +// +// This function must make exactly one call +// to a PrimitiveArrayEncoder's Append* method. type TimeEncoder func(time.Time, PrimitiveArrayEncoder) // EpochTimeEncoder serializes a time.Time to a floating-point number of seconds @@ -219,6 +225,9 @@ func (e *TimeEncoder) UnmarshalJSON(data []byte) error { } // A DurationEncoder serializes a time.Duration to a primitive type. +// +// This function must make exactly one call +// to a PrimitiveArrayEncoder's Append* method. type DurationEncoder func(time.Duration, PrimitiveArrayEncoder) // SecondsDurationEncoder serializes a time.Duration to a floating-point number of seconds elapsed. @@ -262,6 +271,9 @@ func (e *DurationEncoder) UnmarshalText(text []byte) error { } // A CallerEncoder serializes an EntryCaller to a primitive type. +// +// This function must make exactly one call +// to a PrimitiveArrayEncoder's Append* method. type CallerEncoder func(EntryCaller, PrimitiveArrayEncoder) // FullCallerEncoder serializes a caller in /full/path/to/package/file:line @@ -292,6 +304,9 @@ func (e *CallerEncoder) UnmarshalText(text []byte) error { // A NameEncoder serializes a period-separated logger name to a primitive // type. +// +// This function must make exactly one call +// to a PrimitiveArrayEncoder's Append* method. type NameEncoder func(string, PrimitiveArrayEncoder) // FullNameEncoder serializes the logger name as-is. diff --git a/vendor/go.uber.org/zap/zapcore/entry.go b/vendor/go.uber.org/zap/zapcore/entry.go index 9d326e9..459a5d7 100644 --- a/vendor/go.uber.org/zap/zapcore/entry.go +++ b/vendor/go.uber.org/zap/zapcore/entry.go @@ -24,25 +24,23 @@ import ( "fmt" "runtime" "strings" - "sync" "time" "go.uber.org/multierr" "go.uber.org/zap/internal/bufferpool" "go.uber.org/zap/internal/exit" + "go.uber.org/zap/internal/pool" ) -var ( - _cePool = sync.Pool{New: func() interface{} { - // Pre-allocate some space for cores. - return &CheckedEntry{ - cores: make([]Core, 4), - } - }} -) +var _cePool = pool.New(func() *CheckedEntry { + // Pre-allocate some space for cores. + return &CheckedEntry{ + cores: make([]Core, 4), + } +}) func getCheckedEntry() *CheckedEntry { - ce := _cePool.Get().(*CheckedEntry) + ce := _cePool.Get() ce.reset() return ce } @@ -244,7 +242,7 @@ func (ce *CheckedEntry) Write(fields ...Field) { // CheckedEntry is being used after it was returned to the pool, // the message may be an amalgamation from multiple call sites. fmt.Fprintf(ce.ErrorOutput, "%v Unsafe CheckedEntry re-use near Entry %+v.\n", ce.Time, ce.Entry) - ce.ErrorOutput.Sync() + _ = ce.ErrorOutput.Sync() // ignore error } return } @@ -256,7 +254,7 @@ func (ce *CheckedEntry) Write(fields ...Field) { } if err != nil && ce.ErrorOutput != nil { fmt.Fprintf(ce.ErrorOutput, "%v write error: %v\n", ce.Time, err) - ce.ErrorOutput.Sync() + _ = ce.ErrorOutput.Sync() // ignore error } hook := ce.after diff --git a/vendor/go.uber.org/zap/zapcore/error.go b/vendor/go.uber.org/zap/zapcore/error.go index 0635990..c40df13 100644 --- a/vendor/go.uber.org/zap/zapcore/error.go +++ b/vendor/go.uber.org/zap/zapcore/error.go @@ -23,7 +23,8 @@ package zapcore import ( "fmt" "reflect" - "sync" + + "go.uber.org/zap/internal/pool" ) // Encodes the given error into fields of an object. A field with the given @@ -97,15 +98,18 @@ func (errs errArray) MarshalLogArray(arr ArrayEncoder) error { } el := newErrArrayElem(errs[i]) - arr.AppendObject(el) + err := arr.AppendObject(el) el.Free() + if err != nil { + return err + } } return nil } -var _errArrayElemPool = sync.Pool{New: func() interface{} { +var _errArrayElemPool = pool.New(func() *errArrayElem { return &errArrayElem{} -}} +}) // Encodes any error into a {"error": ...} re-using the same errors logic. // @@ -113,7 +117,7 @@ var _errArrayElemPool = sync.Pool{New: func() interface{} { type errArrayElem struct{ err error } func newErrArrayElem(err error) *errArrayElem { - e := _errArrayElemPool.Get().(*errArrayElem) + e := _errArrayElemPool.Get() e.err = err return e } diff --git a/vendor/go.uber.org/zap/zapcore/field.go b/vendor/go.uber.org/zap/zapcore/field.go index 95bdb0a..308c978 100644 --- a/vendor/go.uber.org/zap/zapcore/field.go +++ b/vendor/go.uber.org/zap/zapcore/field.go @@ -47,7 +47,7 @@ const ( ByteStringType // Complex128Type indicates that the field carries a complex128. Complex128Type - // Complex64Type indicates that the field carries a complex128. + // Complex64Type indicates that the field carries a complex64. Complex64Type // DurationType indicates that the field carries a time.Duration. DurationType diff --git a/vendor/go.uber.org/zap/zapcore/json_encoder.go b/vendor/go.uber.org/zap/zapcore/json_encoder.go index 3921c5c..9685169 100644 --- a/vendor/go.uber.org/zap/zapcore/json_encoder.go +++ b/vendor/go.uber.org/zap/zapcore/json_encoder.go @@ -23,24 +23,20 @@ package zapcore import ( "encoding/base64" "math" - "sync" "time" "unicode/utf8" "go.uber.org/zap/buffer" "go.uber.org/zap/internal/bufferpool" + "go.uber.org/zap/internal/pool" ) // For JSON-escaping; see jsonEncoder.safeAddString below. const _hex = "0123456789abcdef" -var _jsonPool = sync.Pool{New: func() interface{} { +var _jsonPool = pool.New(func() *jsonEncoder { return &jsonEncoder{} -}} - -func getJSONEncoder() *jsonEncoder { - return _jsonPool.Get().(*jsonEncoder) -} +}) func putJSONEncoder(enc *jsonEncoder) { if enc.reflectBuf != nil { @@ -354,7 +350,7 @@ func (enc *jsonEncoder) Clone() Encoder { } func (enc *jsonEncoder) clone() *jsonEncoder { - clone := getJSONEncoder() + clone := _jsonPool.Get() clone.EncoderConfig = enc.EncoderConfig clone.spaced = enc.spaced clone.openNamespaces = enc.openNamespaces @@ -376,7 +372,7 @@ func (enc *jsonEncoder) EncodeEntry(ent Entry, fields []Field) (*buffer.Buffer, final.AppendString(ent.Level.String()) } } - if final.TimeKey != "" { + if final.TimeKey != "" && !ent.Time.IsZero() { final.AddTime(final.TimeKey, ent.Time) } if ent.LoggerName != "" && final.NameKey != "" { @@ -490,73 +486,98 @@ func (enc *jsonEncoder) appendFloat(val float64, bitSize int) { // Unlike the standard library's encoder, it doesn't attempt to protect the // user from browser vulnerabilities or JSONP-related problems. func (enc *jsonEncoder) safeAddString(s string) { - for i := 0; i < len(s); { - if enc.tryAddRuneSelf(s[i]) { - i++ - continue - } - r, size := utf8.DecodeRuneInString(s[i:]) - if enc.tryAddRuneError(r, size) { - i++ - continue - } - enc.buf.AppendString(s[i : i+size]) - i += size - } + safeAppendStringLike( + (*buffer.Buffer).AppendString, + utf8.DecodeRuneInString, + enc.buf, + s, + ) } // safeAddByteString is no-alloc equivalent of safeAddString(string(s)) for s []byte. func (enc *jsonEncoder) safeAddByteString(s []byte) { + safeAppendStringLike( + (*buffer.Buffer).AppendBytes, + utf8.DecodeRune, + enc.buf, + s, + ) +} + +// safeAppendStringLike is a generic implementation of safeAddString and safeAddByteString. +// It appends a string or byte slice to the buffer, escaping all special characters. +func safeAppendStringLike[S []byte | string]( + // appendTo appends this string-like object to the buffer. + appendTo func(*buffer.Buffer, S), + // decodeRune decodes the next rune from the string-like object + // and returns its value and width in bytes. + decodeRune func(S) (rune, int), + buf *buffer.Buffer, + s S, +) { + // The encoding logic below works by skipping over characters + // that can be safely copied as-is, + // until a character is found that needs special handling. + // At that point, we copy everything we've seen so far, + // and then handle that special character. + // + // last is the index of the last byte that was copied to the buffer. + last := 0 for i := 0; i < len(s); { - if enc.tryAddRuneSelf(s[i]) { + if s[i] >= utf8.RuneSelf { + // Character >= RuneSelf may be part of a multi-byte rune. + // They need to be decoded before we can decide how to handle them. + r, size := decodeRune(s[i:]) + if r != utf8.RuneError || size != 1 { + // No special handling required. + // Skip over this rune and continue. + i += size + continue + } + + // Invalid UTF-8 sequence. + // Replace it with the Unicode replacement character. + appendTo(buf, s[last:i]) + buf.AppendString(`\ufffd`) + i++ - continue - } - r, size := utf8.DecodeRune(s[i:]) - if enc.tryAddRuneError(r, size) { + last = i + } else { + // Character < RuneSelf is a single-byte UTF-8 rune. + if s[i] >= 0x20 && s[i] != '\\' && s[i] != '"' { + // No escaping necessary. + // Skip over this character and continue. + i++ + continue + } + + // This character needs to be escaped. + appendTo(buf, s[last:i]) + switch s[i] { + case '\\', '"': + buf.AppendByte('\\') + buf.AppendByte(s[i]) + case '\n': + buf.AppendByte('\\') + buf.AppendByte('n') + case '\r': + buf.AppendByte('\\') + buf.AppendByte('r') + case '\t': + buf.AppendByte('\\') + buf.AppendByte('t') + default: + // Encode bytes < 0x20, except for the escape sequences above. + buf.AppendString(`\u00`) + buf.AppendByte(_hex[s[i]>>4]) + buf.AppendByte(_hex[s[i]&0xF]) + } + i++ - continue + last = i } - enc.buf.Write(s[i : i+size]) - i += size - } -} - -// tryAddRuneSelf appends b if it is valid UTF-8 character represented in a single byte. -func (enc *jsonEncoder) tryAddRuneSelf(b byte) bool { - if b >= utf8.RuneSelf { - return false - } - if 0x20 <= b && b != '\\' && b != '"' { - enc.buf.AppendByte(b) - return true - } - switch b { - case '\\', '"': - enc.buf.AppendByte('\\') - enc.buf.AppendByte(b) - case '\n': - enc.buf.AppendByte('\\') - enc.buf.AppendByte('n') - case '\r': - enc.buf.AppendByte('\\') - enc.buf.AppendByte('r') - case '\t': - enc.buf.AppendByte('\\') - enc.buf.AppendByte('t') - default: - // Encode bytes < 0x20, except for the escape sequences above. - enc.buf.AppendString(`\u00`) - enc.buf.AppendByte(_hex[b>>4]) - enc.buf.AppendByte(_hex[b&0xF]) } - return true -} -func (enc *jsonEncoder) tryAddRuneError(r rune, size int) bool { - if r == utf8.RuneError && size == 1 { - enc.buf.AppendString(`\ufffd`) - return true - } - return false + // add remaining + appendTo(buf, s[last:]) } diff --git a/vendor/go.uber.org/atomic/bool_ext.go b/vendor/go.uber.org/zap/zapcore/lazy_with.go similarity index 60% rename from vendor/go.uber.org/atomic/bool_ext.go rename to vendor/go.uber.org/zap/zapcore/lazy_with.go index a2e60e9..05288d6 100644 --- a/vendor/go.uber.org/atomic/bool_ext.go +++ b/vendor/go.uber.org/zap/zapcore/lazy_with.go @@ -1,4 +1,4 @@ -// Copyright (c) 2020 Uber Technologies, Inc. +// Copyright (c) 2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -18,36 +18,37 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -package atomic +package zapcore -import ( - "strconv" -) +import "sync" -//go:generate bin/gen-atomicwrapper -name=Bool -type=bool -wrapped=Uint32 -pack=boolToInt -unpack=truthy -cas -swap -json -file=bool.go - -func truthy(n uint32) bool { - return n == 1 +type lazyWithCore struct { + Core + sync.Once + fields []Field } -func boolToInt(b bool) uint32 { - if b { - return 1 +// NewLazyWith wraps a Core with a "lazy" Core that will only encode fields if +// the logger is written to (or is further chained in a lon-lazy manner). +func NewLazyWith(core Core, fields []Field) Core { + return &lazyWithCore{ + Core: core, + fields: fields, } - return 0 } -// Toggle atomically negates the Boolean and returns the previous value. -func (b *Bool) Toggle() (old bool) { - for { - old := b.Load() - if b.CAS(old, !old) { - return old - } - } +func (d *lazyWithCore) initOnce() { + d.Once.Do(func() { + d.Core = d.Core.With(d.fields) + }) +} + +func (d *lazyWithCore) With(fields []Field) Core { + d.initOnce() + return d.Core.With(fields) } -// String encodes the wrapped value as a string. -func (b *Bool) String() string { - return strconv.FormatBool(b.Load()) +func (d *lazyWithCore) Check(e Entry, ce *CheckedEntry) *CheckedEntry { + d.initOnce() + return d.Core.Check(e, ce) } diff --git a/vendor/go.uber.org/zap/zapcore/sampler.go b/vendor/go.uber.org/zap/zapcore/sampler.go index dc51805..b7c093a 100644 --- a/vendor/go.uber.org/zap/zapcore/sampler.go +++ b/vendor/go.uber.org/zap/zapcore/sampler.go @@ -21,9 +21,8 @@ package zapcore import ( + "sync/atomic" "time" - - "go.uber.org/atomic" ) const ( @@ -66,16 +65,16 @@ func (c *counter) IncCheckReset(t time.Time, tick time.Duration) uint64 { tn := t.UnixNano() resetAfter := c.resetAt.Load() if resetAfter > tn { - return c.counter.Inc() + return c.counter.Add(1) } c.counter.Store(1) newResetAfter := tn + tick.Nanoseconds() - if !c.resetAt.CAS(resetAfter, newResetAfter) { + if !c.resetAt.CompareAndSwap(resetAfter, newResetAfter) { // We raced with another goroutine trying to reset, and it also reset // the counter to 1, so we need to reincrement the counter. - return c.counter.Inc() + return c.counter.Add(1) } return 1 diff --git a/vendor/golang.org/x/mod/semver/semver.go b/vendor/golang.org/x/mod/semver/semver.go index a30a22b..9a2dfd3 100644 --- a/vendor/golang.org/x/mod/semver/semver.go +++ b/vendor/golang.org/x/mod/semver/semver.go @@ -140,7 +140,7 @@ func Compare(v, w string) int { // Max canonicalizes its arguments and then returns the version string // that compares greater. // -// Deprecated: use Compare instead. In most cases, returning a canonicalized +// Deprecated: use [Compare] instead. In most cases, returning a canonicalized // version is not expected or desired. func Max(v, w string) string { v = Canonical(v) @@ -151,7 +151,7 @@ func Max(v, w string) string { return w } -// ByVersion implements sort.Interface for sorting semantic version strings. +// ByVersion implements [sort.Interface] for sorting semantic version strings. type ByVersion []string func (vs ByVersion) Len() int { return len(vs) } @@ -164,7 +164,7 @@ func (vs ByVersion) Less(i, j int) bool { return vs[i] < vs[j] } -// Sort sorts a list of semantic version strings using ByVersion. +// Sort sorts a list of semantic version strings using [ByVersion]. func Sort(list []string) { sort.Sort(ByVersion(list)) } diff --git a/vendor/golang.org/x/sync/LICENSE b/vendor/golang.org/x/sync/LICENSE new file mode 100644 index 0000000..6a66aea --- /dev/null +++ b/vendor/golang.org/x/sync/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/sync/PATENTS b/vendor/golang.org/x/sync/PATENTS new file mode 100644 index 0000000..7330990 --- /dev/null +++ b/vendor/golang.org/x/sync/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/sync/errgroup/errgroup.go b/vendor/golang.org/x/sync/errgroup/errgroup.go new file mode 100644 index 0000000..948a3ee --- /dev/null +++ b/vendor/golang.org/x/sync/errgroup/errgroup.go @@ -0,0 +1,135 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package errgroup provides synchronization, error propagation, and Context +// cancelation for groups of goroutines working on subtasks of a common task. +// +// [errgroup.Group] is related to [sync.WaitGroup] but adds handling of tasks +// returning errors. +package errgroup + +import ( + "context" + "fmt" + "sync" +) + +type token struct{} + +// A Group is a collection of goroutines working on subtasks that are part of +// the same overall task. +// +// A zero Group is valid, has no limit on the number of active goroutines, +// and does not cancel on error. +type Group struct { + cancel func(error) + + wg sync.WaitGroup + + sem chan token + + errOnce sync.Once + err error +} + +func (g *Group) done() { + if g.sem != nil { + <-g.sem + } + g.wg.Done() +} + +// WithContext returns a new Group and an associated Context derived from ctx. +// +// The derived Context is canceled the first time a function passed to Go +// returns a non-nil error or the first time Wait returns, whichever occurs +// first. +func WithContext(ctx context.Context) (*Group, context.Context) { + ctx, cancel := withCancelCause(ctx) + return &Group{cancel: cancel}, ctx +} + +// Wait blocks until all function calls from the Go method have returned, then +// returns the first non-nil error (if any) from them. +func (g *Group) Wait() error { + g.wg.Wait() + if g.cancel != nil { + g.cancel(g.err) + } + return g.err +} + +// Go calls the given function in a new goroutine. +// It blocks until the new goroutine can be added without the number of +// active goroutines in the group exceeding the configured limit. +// +// The first call to return a non-nil error cancels the group's context, if the +// group was created by calling WithContext. The error will be returned by Wait. +func (g *Group) Go(f func() error) { + if g.sem != nil { + g.sem <- token{} + } + + g.wg.Add(1) + go func() { + defer g.done() + + if err := f(); err != nil { + g.errOnce.Do(func() { + g.err = err + if g.cancel != nil { + g.cancel(g.err) + } + }) + } + }() +} + +// TryGo calls the given function in a new goroutine only if the number of +// active goroutines in the group is currently below the configured limit. +// +// The return value reports whether the goroutine was started. +func (g *Group) TryGo(f func() error) bool { + if g.sem != nil { + select { + case g.sem <- token{}: + // Note: this allows barging iff channels in general allow barging. + default: + return false + } + } + + g.wg.Add(1) + go func() { + defer g.done() + + if err := f(); err != nil { + g.errOnce.Do(func() { + g.err = err + if g.cancel != nil { + g.cancel(g.err) + } + }) + } + }() + return true +} + +// SetLimit limits the number of active goroutines in this group to at most n. +// A negative value indicates no limit. +// +// Any subsequent call to the Go method will block until it can add an active +// goroutine without exceeding the configured limit. +// +// The limit must not be modified while any goroutines in the group are active. +func (g *Group) SetLimit(n int) { + if n < 0 { + g.sem = nil + return + } + if len(g.sem) != 0 { + panic(fmt.Errorf("errgroup: modify limit while %v goroutines in the group are still active", len(g.sem))) + } + g.sem = make(chan token, n) +} diff --git a/vendor/golang.org/x/sync/errgroup/go120.go b/vendor/golang.org/x/sync/errgroup/go120.go new file mode 100644 index 0000000..f93c740 --- /dev/null +++ b/vendor/golang.org/x/sync/errgroup/go120.go @@ -0,0 +1,13 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.20 + +package errgroup + +import "context" + +func withCancelCause(parent context.Context) (context.Context, func(error)) { + return context.WithCancelCause(parent) +} diff --git a/vendor/golang.org/x/sync/errgroup/pre_go120.go b/vendor/golang.org/x/sync/errgroup/pre_go120.go new file mode 100644 index 0000000..88ce334 --- /dev/null +++ b/vendor/golang.org/x/sync/errgroup/pre_go120.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.20 + +package errgroup + +import "context" + +func withCancelCause(parent context.Context) (context.Context, func(error)) { + ctx, cancel := context.WithCancel(parent) + return ctx, func(error) { cancel() } +} diff --git a/vendor/golang.org/x/sys/execabs/execabs.go b/vendor/golang.org/x/sys/execabs/execabs.go deleted file mode 100644 index 3bf40fd..0000000 --- a/vendor/golang.org/x/sys/execabs/execabs.go +++ /dev/null @@ -1,102 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package execabs is a drop-in replacement for os/exec -// that requires PATH lookups to find absolute paths. -// That is, execabs.Command("cmd") runs the same PATH lookup -// as exec.Command("cmd"), but if the result is a path -// which is relative, the Run and Start methods will report -// an error instead of running the executable. -// -// See https://blog.golang.org/path-security for more information -// about when it may be necessary or appropriate to use this package. -package execabs - -import ( - "context" - "fmt" - "os/exec" - "path/filepath" - "reflect" - "unsafe" -) - -// ErrNotFound is the error resulting if a path search failed to find an executable file. -// It is an alias for exec.ErrNotFound. -var ErrNotFound = exec.ErrNotFound - -// Cmd represents an external command being prepared or run. -// It is an alias for exec.Cmd. -type Cmd = exec.Cmd - -// Error is returned by LookPath when it fails to classify a file as an executable. -// It is an alias for exec.Error. -type Error = exec.Error - -// An ExitError reports an unsuccessful exit by a command. -// It is an alias for exec.ExitError. -type ExitError = exec.ExitError - -func relError(file, path string) error { - return fmt.Errorf("%s resolves to executable in current directory (.%c%s)", file, filepath.Separator, path) -} - -// LookPath searches for an executable named file in the directories -// named by the PATH environment variable. If file contains a slash, -// it is tried directly and the PATH is not consulted. The result will be -// an absolute path. -// -// LookPath differs from exec.LookPath in its handling of PATH lookups, -// which are used for file names without slashes. If exec.LookPath's -// PATH lookup would have returned an executable from the current directory, -// LookPath instead returns an error. -func LookPath(file string) (string, error) { - path, err := exec.LookPath(file) - if err != nil && !isGo119ErrDot(err) { - return "", err - } - if filepath.Base(file) == file && !filepath.IsAbs(path) { - return "", relError(file, path) - } - return path, nil -} - -func fixCmd(name string, cmd *exec.Cmd) { - if filepath.Base(name) == name && !filepath.IsAbs(cmd.Path) && !isGo119ErrFieldSet(cmd) { - // exec.Command was called with a bare binary name and - // exec.LookPath returned a path which is not absolute. - // Set cmd.lookPathErr and clear cmd.Path so that it - // cannot be run. - lookPathErr := (*error)(unsafe.Pointer(reflect.ValueOf(cmd).Elem().FieldByName("lookPathErr").Addr().Pointer())) - if *lookPathErr == nil { - *lookPathErr = relError(name, cmd.Path) - } - cmd.Path = "" - } -} - -// CommandContext is like Command but includes a context. -// -// The provided context is used to kill the process (by calling os.Process.Kill) -// if the context becomes done before the command completes on its own. -func CommandContext(ctx context.Context, name string, arg ...string) *exec.Cmd { - cmd := exec.CommandContext(ctx, name, arg...) - fixCmd(name, cmd) - return cmd - -} - -// Command returns the Cmd struct to execute the named program with the given arguments. -// See exec.Command for most details. -// -// Command differs from exec.Command in its handling of PATH lookups, -// which are used when the program name contains no slashes. -// If exec.Command would have returned an exec.Cmd configured to run an -// executable from the current directory, Command instead -// returns an exec.Cmd that will return an error from Start or Run. -func Command(name string, arg ...string) *exec.Cmd { - cmd := exec.Command(name, arg...) - fixCmd(name, cmd) - return cmd -} diff --git a/vendor/golang.org/x/sys/execabs/execabs_go118.go b/vendor/golang.org/x/sys/execabs/execabs_go118.go deleted file mode 100644 index 5627d70..0000000 --- a/vendor/golang.org/x/sys/execabs/execabs_go118.go +++ /dev/null @@ -1,17 +0,0 @@ -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.19 - -package execabs - -import "os/exec" - -func isGo119ErrDot(err error) bool { - return false -} - -func isGo119ErrFieldSet(cmd *exec.Cmd) bool { - return false -} diff --git a/vendor/golang.org/x/sys/execabs/execabs_go119.go b/vendor/golang.org/x/sys/execabs/execabs_go119.go deleted file mode 100644 index d60ab1b..0000000 --- a/vendor/golang.org/x/sys/execabs/execabs_go119.go +++ /dev/null @@ -1,20 +0,0 @@ -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.19 - -package execabs - -import ( - "errors" - "os/exec" -) - -func isGo119ErrDot(err error) bool { - return errors.Is(err, exec.ErrDot) -} - -func isGo119ErrFieldSet(cmd *exec.Cmd) bool { - return cmd.Err != nil -} diff --git a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s index 2f67ba8..813dfad 100644 --- a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s @@ -9,9 +9,11 @@ #define PSALAA 1208(R0) #define GTAB64(x) 80(x) #define LCA64(x) 88(x) +#define SAVSTACK_ASYNC(x) 336(x) // in the LCA #define CAA(x) 8(x) -#define EDCHPXV(x) 1016(x) // in the CAA -#define SAVSTACK_ASYNC(x) 336(x) // in the LCA +#define CEECAATHDID(x) 976(x) // in the CAA +#define EDCHPXV(x) 1016(x) // in the CAA +#define GOCB(x) 1104(x) // in the CAA // SS_*, where x=SAVSTACK_ASYNC #define SS_LE(x) 0(x) @@ -19,405 +21,362 @@ #define SS_ERRNO(x) 16(x) #define SS_ERRNOJR(x) 20(x) -#define LE_CALL BYTE $0x0D; BYTE $0x76; // BL R7, R6 +// Function Descriptor Offsets +#define __errno 0x156*16 +#define __err2ad 0x16C*16 -TEXT Β·clearErrno(SB),NOSPLIT,$0-0 - BL addrerrno<>(SB) - MOVD $0, 0(R3) +// Call Instructions +#define LE_CALL BYTE $0x0D; BYTE $0x76 // BL R7, R6 +#define SVC_LOAD BYTE $0x0A; BYTE $0x08 // SVC 08 LOAD +#define SVC_DELETE BYTE $0x0A; BYTE $0x09 // SVC 09 DELETE + +DATA zosLibVec<>(SB)/8, $0 +GLOBL zosLibVec<>(SB), NOPTR, $8 + +TEXT Β·initZosLibVec(SB), NOSPLIT|NOFRAME, $0-0 + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 + MOVD CAA(R8), R8 + MOVD EDCHPXV(R8), R8 + MOVD R8, zosLibVec<>(SB) + RET + +TEXT Β·GetZosLibVec(SB), NOSPLIT|NOFRAME, $0-0 + MOVD zosLibVec<>(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·clearErrno(SB), NOSPLIT, $0-0 + BL addrerrno<>(SB) + MOVD $0, 0(R3) RET // Returns the address of errno in R3. -TEXT addrerrno<>(SB),NOSPLIT|NOFRAME,$0-0 +TEXT addrerrno<>(SB), NOSPLIT|NOFRAME, $0-0 // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 // Get __errno FuncDesc. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - ADD $(0x156*16), R9 - LMG 0(R9), R5, R6 + MOVD CAA(R8), R9 + MOVD EDCHPXV(R9), R9 + ADD $(__errno), R9 + LMG 0(R9), R5, R6 // Switch to saved LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) + MOVD SAVSTACK_ASYNC(R8), R9 + MOVD 0(R9), R4 + MOVD $0, 0(R9) // Call __errno function. LE_CALL NOPH // Switch back to Go stack. - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. + XOR R0, R0 // Restore R0 to $0. + MOVD R4, 0(R9) // Save stack pointer. RET -TEXT Β·syscall_syscall(SB),NOSPLIT,$0-56 - BL runtimeΒ·entersyscall(SB) - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 +// func svcCall(fnptr unsafe.Pointer, argv *unsafe.Pointer, dsa *uint64) +TEXT Β·svcCall(SB), NOSPLIT, $0 + BL runtimeΒ·save_g(SB) // Save g and stack pointer + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 + MOVD SAVSTACK_ASYNC(R8), R9 + MOVD R15, 0(R9) - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 + MOVD argv+8(FP), R1 // Move function arguments into registers + MOVD dsa+16(FP), g + MOVD fnptr+0(FP), R15 - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 + BYTE $0x0D // Branch to function + BYTE $0xEF - // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) + BL runtimeΒ·load_g(SB) // Restore g and stack pointer + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 + MOVD SAVSTACK_ASYNC(R8), R9 + MOVD 0(R9), R15 - // Call function. - LE_CALL - NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+32(FP) - MOVD R0, r2+40(FP) - MOVD R0, err+48(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL addrerrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+48(FP) -done: - BL runtimeΒ·exitsyscall(SB) RET -TEXT Β·syscall_rawsyscall(SB),NOSPLIT,$0-56 - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 - - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 +// func svcLoad(name *byte) unsafe.Pointer +TEXT Β·svcLoad(SB), NOSPLIT, $0 + MOVD R15, R2 // Save go stack pointer + MOVD name+0(FP), R0 // Move SVC args into registers + MOVD $0x80000000, R1 + MOVD $0, R15 + SVC_LOAD + MOVW R15, R3 // Save return code from SVC + MOVD R2, R15 // Restore go stack pointer + CMP R3, $0 // Check SVC return code + BNE error + + MOVD $-2, R3 // Reset last bit of entry point to zero + AND R0, R3 + MOVD R3, ret+8(FP) // Return entry point returned by SVC + CMP R0, R3 // Check if last bit of entry point was set + BNE done + + MOVD R15, R2 // Save go stack pointer + MOVD $0, R15 // Move SVC args into registers (entry point still in r0 from SVC 08) + SVC_DELETE + MOVD R2, R15 // Restore go stack pointer - // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) +error: + MOVD $0, ret+8(FP) // Return 0 on failure - // Call function. - LE_CALL - NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+32(FP) - MOVD R0, r2+40(FP) - MOVD R0, err+48(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL addrerrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+48(FP) done: + XOR R0, R0 // Reset r0 to 0 RET -TEXT Β·syscall_syscall6(SB),NOSPLIT,$0-80 - BL runtimeΒ·entersyscall(SB) - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 +// func svcUnload(name *byte, fnptr unsafe.Pointer) int64 +TEXT Β·svcUnload(SB), NOSPLIT, $0 + MOVD R15, R2 // Save go stack pointer + MOVD name+0(FP), R0 // Move SVC args into registers + MOVD fnptr+8(FP), R15 + SVC_DELETE + XOR R0, R0 // Reset r0 to 0 + MOVD R15, R1 // Save SVC return code + MOVD R2, R15 // Restore go stack pointer + MOVD R1, ret+16(FP) // Return SVC return code + RET +// func gettid() uint64 +TEXT Β·gettid(SB), NOSPLIT, $0 // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 + // Get CEECAATHDID + MOVD CAA(R8), R9 + MOVD CEECAATHDID(R9), R9 + MOVD R9, ret+0(FP) - // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) - - // Fill in parameter list. - MOVD a4+32(FP), R12 - MOVD R12, (2176+24)(R4) - MOVD a5+40(FP), R12 - MOVD R12, (2176+32)(R4) - MOVD a6+48(FP), R12 - MOVD R12, (2176+40)(R4) - - // Call function. - LE_CALL - NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+56(FP) - MOVD R0, r2+64(FP) - MOVD R0, err+72(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL addrerrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+72(FP) -done: - BL runtimeΒ·exitsyscall(SB) RET -TEXT Β·syscall_rawsyscall6(SB),NOSPLIT,$0-80 - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 - - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 +// +// Call LE function, if the return is -1 +// errno and errno2 is retrieved +// +TEXT Β·CallLeFuncWithErr(SB), NOSPLIT, $0 + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 + MOVD CAA(R8), R9 + MOVD g, GOCB(R9) // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) - - // Fill in parameter list. - MOVD a4+32(FP), R12 - MOVD R12, (2176+24)(R4) - MOVD a5+40(FP), R12 - MOVD R12, (2176+32)(R4) - MOVD a6+48(FP), R12 - MOVD R12, (2176+40)(R4) - - // Call function. - LE_CALL + MOVD SAVSTACK_ASYNC(R8), R9 // R9-> LE stack frame saving address + MOVD 0(R9), R4 // R4-> restore previously saved stack frame pointer + + MOVD parms_base+8(FP), R7 // R7 -> argument array + MOVD parms_len+16(FP), R8 // R8 number of arguments + + // arg 1 ---> R1 + CMP R8, $0 + BEQ docall + SUB $1, R8 + MOVD 0(R7), R1 + + // arg 2 ---> R2 + CMP R8, $0 + BEQ docall + SUB $1, R8 + ADD $8, R7 + MOVD 0(R7), R2 + + // arg 3 --> R3 + CMP R8, $0 + BEQ docall + SUB $1, R8 + ADD $8, R7 + MOVD 0(R7), R3 + + CMP R8, $0 + BEQ docall + MOVD $2176+16, R6 // starting LE stack address-8 to store 4th argument + +repeat: + ADD $8, R7 + MOVD 0(R7), R0 // advance arg pointer by 8 byte + ADD $8, R6 // advance LE argument address by 8 byte + MOVD R0, (R4)(R6*1) // copy argument from go-slice to le-frame + SUB $1, R8 + CMP R8, $0 + BNE repeat + +docall: + MOVD funcdesc+0(FP), R8 // R8-> function descriptor + LMG 0(R8), R5, R6 + MOVD $0, 0(R9) // R9 address of SAVSTACK_ASYNC + LE_CALL // balr R7, R6 (return #1) + NOPH + MOVD R3, ret+32(FP) + CMP R3, $-1 // compare result to -1 + BNE done + + // retrieve errno and errno2 + MOVD zosLibVec<>(SB), R8 + ADD $(__errno), R8 + LMG 0(R8), R5, R6 + LE_CALL // balr R7, R6 __errno (return #3) NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+56(FP) - MOVD R0, r2+64(FP) - MOVD R0, err+72(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL Β·rrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+72(FP) + MOVWZ 0(R3), R3 + MOVD R3, err+48(FP) + MOVD zosLibVec<>(SB), R8 + ADD $(__err2ad), R8 + LMG 0(R8), R5, R6 + LE_CALL // balr R7, R6 __err2ad (return #2) + NOPH + MOVW (R3), R2 // retrieve errno2 + MOVD R2, errno2+40(FP) // store in return area + done: + MOVD R4, 0(R9) // Save stack pointer. RET -TEXT Β·syscall_syscall9(SB),NOSPLIT,$0 - BL runtimeΒ·entersyscall(SB) - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 - - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 +// +// Call LE function, if the return is 0 +// errno and errno2 is retrieved +// +TEXT Β·CallLeFuncWithPtrReturn(SB), NOSPLIT, $0 + MOVW PSALAA, R8 + MOVD LCA64(R8), R8 + MOVD CAA(R8), R9 + MOVD g, GOCB(R9) // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) - - // Fill in parameter list. - MOVD a4+32(FP), R12 - MOVD R12, (2176+24)(R4) - MOVD a5+40(FP), R12 - MOVD R12, (2176+32)(R4) - MOVD a6+48(FP), R12 - MOVD R12, (2176+40)(R4) - MOVD a7+56(FP), R12 - MOVD R12, (2176+48)(R4) - MOVD a8+64(FP), R12 - MOVD R12, (2176+56)(R4) - MOVD a9+72(FP), R12 - MOVD R12, (2176+64)(R4) - - // Call function. - LE_CALL + MOVD SAVSTACK_ASYNC(R8), R9 // R9-> LE stack frame saving address + MOVD 0(R9), R4 // R4-> restore previously saved stack frame pointer + + MOVD parms_base+8(FP), R7 // R7 -> argument array + MOVD parms_len+16(FP), R8 // R8 number of arguments + + // arg 1 ---> R1 + CMP R8, $0 + BEQ docall + SUB $1, R8 + MOVD 0(R7), R1 + + // arg 2 ---> R2 + CMP R8, $0 + BEQ docall + SUB $1, R8 + ADD $8, R7 + MOVD 0(R7), R2 + + // arg 3 --> R3 + CMP R8, $0 + BEQ docall + SUB $1, R8 + ADD $8, R7 + MOVD 0(R7), R3 + + CMP R8, $0 + BEQ docall + MOVD $2176+16, R6 // starting LE stack address-8 to store 4th argument + +repeat: + ADD $8, R7 + MOVD 0(R7), R0 // advance arg pointer by 8 byte + ADD $8, R6 // advance LE argument address by 8 byte + MOVD R0, (R4)(R6*1) // copy argument from go-slice to le-frame + SUB $1, R8 + CMP R8, $0 + BNE repeat + +docall: + MOVD funcdesc+0(FP), R8 // R8-> function descriptor + LMG 0(R8), R5, R6 + MOVD $0, 0(R9) // R9 address of SAVSTACK_ASYNC + LE_CALL // balr R7, R6 (return #1) NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+80(FP) - MOVD R0, r2+88(FP) - MOVD R0, err+96(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL addrerrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+96(FP) -done: - BL runtimeΒ·exitsyscall(SB) - RET - -TEXT Β·syscall_rawsyscall9(SB),NOSPLIT,$0 - MOVD a1+8(FP), R1 - MOVD a2+16(FP), R2 - MOVD a3+24(FP), R3 - - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - - // Get function. - MOVD CAA(R8), R9 - MOVD EDCHPXV(R9), R9 - MOVD trap+0(FP), R5 - SLD $4, R5 - ADD R5, R9 - LMG 0(R9), R5, R6 - - // Restore LE stack. - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R4 - MOVD $0, 0(R9) - - // Fill in parameter list. - MOVD a4+32(FP), R12 - MOVD R12, (2176+24)(R4) - MOVD a5+40(FP), R12 - MOVD R12, (2176+32)(R4) - MOVD a6+48(FP), R12 - MOVD R12, (2176+40)(R4) - MOVD a7+56(FP), R12 - MOVD R12, (2176+48)(R4) - MOVD a8+64(FP), R12 - MOVD R12, (2176+56)(R4) - MOVD a9+72(FP), R12 - MOVD R12, (2176+64)(R4) - - // Call function. - LE_CALL + MOVD R3, ret+32(FP) + CMP R3, $0 // compare result to 0 + BNE done + + // retrieve errno and errno2 + MOVD zosLibVec<>(SB), R8 + ADD $(__errno), R8 + LMG 0(R8), R5, R6 + LE_CALL // balr R7, R6 __errno (return #3) NOPH - XOR R0, R0 // Restore R0 to $0. - MOVD R4, 0(R9) // Save stack pointer. - - MOVD R3, r1+80(FP) - MOVD R0, r2+88(FP) - MOVD R0, err+96(FP) - MOVW R3, R4 - CMP R4, $-1 - BNE done - BL addrerrno<>(SB) - MOVWZ 0(R3), R3 - MOVD R3, err+96(FP) -done: - RET - -// func svcCall(fnptr unsafe.Pointer, argv *unsafe.Pointer, dsa *uint64) -TEXT Β·svcCall(SB),NOSPLIT,$0 - BL runtimeΒ·save_g(SB) // Save g and stack pointer - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD R15, 0(R9) - - MOVD argv+8(FP), R1 // Move function arguments into registers - MOVD dsa+16(FP), g - MOVD fnptr+0(FP), R15 - - BYTE $0x0D // Branch to function - BYTE $0xEF - - BL runtimeΒ·load_g(SB) // Restore g and stack pointer - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - MOVD SAVSTACK_ASYNC(R8), R9 - MOVD 0(R9), R15 - - RET - -// func svcLoad(name *byte) unsafe.Pointer -TEXT Β·svcLoad(SB),NOSPLIT,$0 - MOVD R15, R2 // Save go stack pointer - MOVD name+0(FP), R0 // Move SVC args into registers - MOVD $0x80000000, R1 - MOVD $0, R15 - BYTE $0x0A // SVC 08 LOAD - BYTE $0x08 - MOVW R15, R3 // Save return code from SVC - MOVD R2, R15 // Restore go stack pointer - CMP R3, $0 // Check SVC return code - BNE error - - MOVD $-2, R3 // Reset last bit of entry point to zero - AND R0, R3 - MOVD R3, addr+8(FP) // Return entry point returned by SVC - CMP R0, R3 // Check if last bit of entry point was set - BNE done - - MOVD R15, R2 // Save go stack pointer - MOVD $0, R15 // Move SVC args into registers (entry point still in r0 from SVC 08) - BYTE $0x0A // SVC 09 DELETE - BYTE $0x09 - MOVD R2, R15 // Restore go stack pointer + MOVWZ 0(R3), R3 + MOVD R3, err+48(FP) + MOVD zosLibVec<>(SB), R8 + ADD $(__err2ad), R8 + LMG 0(R8), R5, R6 + LE_CALL // balr R7, R6 __err2ad (return #2) + NOPH + MOVW (R3), R2 // retrieve errno2 + MOVD R2, errno2+40(FP) // store in return area + XOR R2, R2 + MOVWZ R2, (R3) // clear errno2 -error: - MOVD $0, addr+8(FP) // Return 0 on failure done: - XOR R0, R0 // Reset r0 to 0 + MOVD R4, 0(R9) // Save stack pointer. RET -// func svcUnload(name *byte, fnptr unsafe.Pointer) int64 -TEXT Β·svcUnload(SB),NOSPLIT,$0 - MOVD R15, R2 // Save go stack pointer - MOVD name+0(FP), R0 // Move SVC args into registers - MOVD addr+8(FP), R15 - BYTE $0x0A // SVC 09 - BYTE $0x09 - XOR R0, R0 // Reset r0 to 0 - MOVD R15, R1 // Save SVC return code - MOVD R2, R15 // Restore go stack pointer - MOVD R1, rc+0(FP) // Return SVC return code +// +// function to test if a pointer can be safely dereferenced (content read) +// return 0 for succces +// +TEXT Β·ptrtest(SB), NOSPLIT, $0-16 + MOVD arg+0(FP), R10 // test pointer in R10 + + // set up R2 to point to CEECAADMC + BYTE $0xE3; BYTE $0x20; BYTE $0x04; BYTE $0xB8; BYTE $0x00; BYTE $0x17 // llgt 2,1208 + BYTE $0xB9; BYTE $0x17; BYTE $0x00; BYTE $0x22 // llgtr 2,2 + BYTE $0xA5; BYTE $0x26; BYTE $0x7F; BYTE $0xFF // nilh 2,32767 + BYTE $0xE3; BYTE $0x22; BYTE $0x00; BYTE $0x58; BYTE $0x00; BYTE $0x04 // lg 2,88(2) + BYTE $0xE3; BYTE $0x22; BYTE $0x00; BYTE $0x08; BYTE $0x00; BYTE $0x04 // lg 2,8(2) + BYTE $0x41; BYTE $0x22; BYTE $0x03; BYTE $0x68 // la 2,872(2) + + // set up R5 to point to the "shunt" path which set 1 to R3 (failure) + BYTE $0xB9; BYTE $0x82; BYTE $0x00; BYTE $0x33 // xgr 3,3 + BYTE $0xA7; BYTE $0x55; BYTE $0x00; BYTE $0x04 // bras 5,lbl1 + BYTE $0xA7; BYTE $0x39; BYTE $0x00; BYTE $0x01 // lghi 3,1 + + // if r3 is not zero (failed) then branch to finish + BYTE $0xB9; BYTE $0x02; BYTE $0x00; BYTE $0x33 // lbl1 ltgr 3,3 + BYTE $0xA7; BYTE $0x74; BYTE $0x00; BYTE $0x08 // brc b'0111',lbl2 + + // stomic store shunt address in R5 into CEECAADMC + BYTE $0xE3; BYTE $0x52; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x24 // stg 5,0(2) + + // now try reading from the test pointer in R10, if it fails it branches to the "lghi" instruction above + BYTE $0xE3; BYTE $0x9A; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x04 // lg 9,0(10) + + // finish here, restore 0 into CEECAADMC + BYTE $0xB9; BYTE $0x82; BYTE $0x00; BYTE $0x99 // lbl2 xgr 9,9 + BYTE $0xE3; BYTE $0x92; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x24 // stg 9,0(2) + MOVD R3, ret+8(FP) // result in R3 RET -// func gettid() uint64 -TEXT Β·gettid(SB), NOSPLIT, $0 - // Get library control area (LCA). - MOVW PSALAA, R8 - MOVD LCA64(R8), R8 - - // Get CEECAATHDID - MOVD CAA(R8), R9 - MOVD 0x3D0(R9), R9 - MOVD R9, ret+0(FP) - +// +// function to test if a untptr can be loaded from a pointer +// return 1: the 8-byte content +// 2: 0 for success, 1 for failure +// +// func safeload(ptr uintptr) ( value uintptr, error uintptr) +TEXT Β·safeload(SB), NOSPLIT, $0-24 + MOVD ptr+0(FP), R10 // test pointer in R10 + MOVD $0x0, R6 + BYTE $0xE3; BYTE $0x20; BYTE $0x04; BYTE $0xB8; BYTE $0x00; BYTE $0x17 // llgt 2,1208 + BYTE $0xB9; BYTE $0x17; BYTE $0x00; BYTE $0x22 // llgtr 2,2 + BYTE $0xA5; BYTE $0x26; BYTE $0x7F; BYTE $0xFF // nilh 2,32767 + BYTE $0xE3; BYTE $0x22; BYTE $0x00; BYTE $0x58; BYTE $0x00; BYTE $0x04 // lg 2,88(2) + BYTE $0xE3; BYTE $0x22; BYTE $0x00; BYTE $0x08; BYTE $0x00; BYTE $0x04 // lg 2,8(2) + BYTE $0x41; BYTE $0x22; BYTE $0x03; BYTE $0x68 // la 2,872(2) + BYTE $0xB9; BYTE $0x82; BYTE $0x00; BYTE $0x33 // xgr 3,3 + BYTE $0xA7; BYTE $0x55; BYTE $0x00; BYTE $0x04 // bras 5,lbl1 + BYTE $0xA7; BYTE $0x39; BYTE $0x00; BYTE $0x01 // lghi 3,1 + BYTE $0xB9; BYTE $0x02; BYTE $0x00; BYTE $0x33 // lbl1 ltgr 3,3 + BYTE $0xA7; BYTE $0x74; BYTE $0x00; BYTE $0x08 // brc b'0111',lbl2 + BYTE $0xE3; BYTE $0x52; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x24 // stg 5,0(2) + BYTE $0xE3; BYTE $0x6A; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x04 // lg 6,0(10) + BYTE $0xB9; BYTE $0x82; BYTE $0x00; BYTE $0x99 // lbl2 xgr 9,9 + BYTE $0xE3; BYTE $0x92; BYTE $0x00; BYTE $0x00; BYTE $0x00; BYTE $0x24 // stg 9,0(2) + MOVD R6, value+8(FP) // result in R6 + MOVD R3, error+16(FP) // error in R3 RET diff --git a/vendor/golang.org/x/sys/unix/bpxsvc_zos.go b/vendor/golang.org/x/sys/unix/bpxsvc_zos.go new file mode 100644 index 0000000..39d647d --- /dev/null +++ b/vendor/golang.org/x/sys/unix/bpxsvc_zos.go @@ -0,0 +1,657 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build zos + +package unix + +import ( + "bytes" + "fmt" + "unsafe" +) + +//go:noescape +func bpxcall(plist []unsafe.Pointer, bpx_offset int64) + +//go:noescape +func A2e([]byte) + +//go:noescape +func E2a([]byte) + +const ( + BPX4STA = 192 // stat + BPX4FST = 104 // fstat + BPX4LST = 132 // lstat + BPX4OPN = 156 // open + BPX4CLO = 72 // close + BPX4CHR = 500 // chattr + BPX4FCR = 504 // fchattr + BPX4LCR = 1180 // lchattr + BPX4CTW = 492 // cond_timed_wait + BPX4GTH = 1056 // __getthent + BPX4PTQ = 412 // pthread_quiesc + BPX4PTR = 320 // ptrace +) + +const ( + //options + //byte1 + BPX_OPNFHIGH = 0x80 + //byte2 + BPX_OPNFEXEC = 0x80 + //byte3 + BPX_O_NOLARGEFILE = 0x08 + BPX_O_LARGEFILE = 0x04 + BPX_O_ASYNCSIG = 0x02 + BPX_O_SYNC = 0x01 + //byte4 + BPX_O_CREXCL = 0xc0 + BPX_O_CREAT = 0x80 + BPX_O_EXCL = 0x40 + BPX_O_NOCTTY = 0x20 + BPX_O_TRUNC = 0x10 + BPX_O_APPEND = 0x08 + BPX_O_NONBLOCK = 0x04 + BPX_FNDELAY = 0x04 + BPX_O_RDWR = 0x03 + BPX_O_RDONLY = 0x02 + BPX_O_WRONLY = 0x01 + BPX_O_ACCMODE = 0x03 + BPX_O_GETFL = 0x0f + + //mode + // byte1 (file type) + BPX_FT_DIR = 1 + BPX_FT_CHARSPEC = 2 + BPX_FT_REGFILE = 3 + BPX_FT_FIFO = 4 + BPX_FT_SYMLINK = 5 + BPX_FT_SOCKET = 6 + //byte3 + BPX_S_ISUID = 0x08 + BPX_S_ISGID = 0x04 + BPX_S_ISVTX = 0x02 + BPX_S_IRWXU1 = 0x01 + BPX_S_IRUSR = 0x01 + //byte4 + BPX_S_IRWXU2 = 0xc0 + BPX_S_IWUSR = 0x80 + BPX_S_IXUSR = 0x40 + BPX_S_IRWXG = 0x38 + BPX_S_IRGRP = 0x20 + BPX_S_IWGRP = 0x10 + BPX_S_IXGRP = 0x08 + BPX_S_IRWXOX = 0x07 + BPX_S_IROTH = 0x04 + BPX_S_IWOTH = 0x02 + BPX_S_IXOTH = 0x01 + + CW_INTRPT = 1 + CW_CONDVAR = 32 + CW_TIMEOUT = 64 + + PGTHA_NEXT = 2 + PGTHA_CURRENT = 1 + PGTHA_FIRST = 0 + PGTHA_LAST = 3 + PGTHA_PROCESS = 0x80 + PGTHA_CONTTY = 0x40 + PGTHA_PATH = 0x20 + PGTHA_COMMAND = 0x10 + PGTHA_FILEDATA = 0x08 + PGTHA_THREAD = 0x04 + PGTHA_PTAG = 0x02 + PGTHA_COMMANDLONG = 0x01 + PGTHA_THREADFAST = 0x80 + PGTHA_FILEPATH = 0x40 + PGTHA_THDSIGMASK = 0x20 + // thread quiece mode + QUIESCE_TERM int32 = 1 + QUIESCE_FORCE int32 = 2 + QUIESCE_QUERY int32 = 3 + QUIESCE_FREEZE int32 = 4 + QUIESCE_UNFREEZE int32 = 5 + FREEZE_THIS_THREAD int32 = 6 + FREEZE_EXIT int32 = 8 + QUIESCE_SRB int32 = 9 +) + +type Pgtha struct { + Pid uint32 // 0 + Tid0 uint32 // 4 + Tid1 uint32 + Accesspid byte // C + Accesstid byte // D + Accessasid uint16 // E + Loginname [8]byte // 10 + Flag1 byte // 18 + Flag1b2 byte // 19 +} + +type Bpxystat_t struct { // DSECT BPXYSTAT + St_id [4]uint8 // 0 + St_length uint16 // 0x4 + St_version uint16 // 0x6 + St_mode uint32 // 0x8 + St_ino uint32 // 0xc + St_dev uint32 // 0x10 + St_nlink uint32 // 0x14 + St_uid uint32 // 0x18 + St_gid uint32 // 0x1c + St_size uint64 // 0x20 + St_atime uint32 // 0x28 + St_mtime uint32 // 0x2c + St_ctime uint32 // 0x30 + St_rdev uint32 // 0x34 + St_auditoraudit uint32 // 0x38 + St_useraudit uint32 // 0x3c + St_blksize uint32 // 0x40 + St_createtime uint32 // 0x44 + St_auditid [4]uint32 // 0x48 + St_res01 uint32 // 0x58 + Ft_ccsid uint16 // 0x5c + Ft_flags uint16 // 0x5e + St_res01a [2]uint32 // 0x60 + St_res02 uint32 // 0x68 + St_blocks uint32 // 0x6c + St_opaque [3]uint8 // 0x70 + St_visible uint8 // 0x73 + St_reftime uint32 // 0x74 + St_fid uint64 // 0x78 + St_filefmt uint8 // 0x80 + St_fspflag2 uint8 // 0x81 + St_res03 [2]uint8 // 0x82 + St_ctimemsec uint32 // 0x84 + St_seclabel [8]uint8 // 0x88 + St_res04 [4]uint8 // 0x90 + // end of version 1 + _ uint32 // 0x94 + St_atime64 uint64 // 0x98 + St_mtime64 uint64 // 0xa0 + St_ctime64 uint64 // 0xa8 + St_createtime64 uint64 // 0xb0 + St_reftime64 uint64 // 0xb8 + _ uint64 // 0xc0 + St_res05 [16]uint8 // 0xc8 + // end of version 2 +} + +type BpxFilestatus struct { + Oflag1 byte + Oflag2 byte + Oflag3 byte + Oflag4 byte +} + +type BpxMode struct { + Ftype byte + Mode1 byte + Mode2 byte + Mode3 byte +} + +// Thr attribute structure for extended attributes +type Bpxyatt_t struct { // DSECT BPXYATT + Att_id [4]uint8 + Att_version uint16 + Att_res01 [2]uint8 + Att_setflags1 uint8 + Att_setflags2 uint8 + Att_setflags3 uint8 + Att_setflags4 uint8 + Att_mode uint32 + Att_uid uint32 + Att_gid uint32 + Att_opaquemask [3]uint8 + Att_visblmaskres uint8 + Att_opaque [3]uint8 + Att_visibleres uint8 + Att_size_h uint32 + Att_size_l uint32 + Att_atime uint32 + Att_mtime uint32 + Att_auditoraudit uint32 + Att_useraudit uint32 + Att_ctime uint32 + Att_reftime uint32 + // end of version 1 + Att_filefmt uint8 + Att_res02 [3]uint8 + Att_filetag uint32 + Att_res03 [8]uint8 + // end of version 2 + Att_atime64 uint64 + Att_mtime64 uint64 + Att_ctime64 uint64 + Att_reftime64 uint64 + Att_seclabel [8]uint8 + Att_ver3res02 [8]uint8 + // end of version 3 +} + +func BpxOpen(name string, options *BpxFilestatus, mode *BpxMode) (rv int32, rc int32, rn int32) { + if len(name) < 1024 { + var namebuf [1024]byte + sz := int32(copy(namebuf[:], name)) + A2e(namebuf[:sz]) + var parms [7]unsafe.Pointer + parms[0] = unsafe.Pointer(&sz) + parms[1] = unsafe.Pointer(&namebuf[0]) + parms[2] = unsafe.Pointer(options) + parms[3] = unsafe.Pointer(mode) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4OPN) + return rv, rc, rn + } + return -1, -1, -1 +} + +func BpxClose(fd int32) (rv int32, rc int32, rn int32) { + var parms [4]unsafe.Pointer + parms[0] = unsafe.Pointer(&fd) + parms[1] = unsafe.Pointer(&rv) + parms[2] = unsafe.Pointer(&rc) + parms[3] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4CLO) + return rv, rc, rn +} + +func BpxFileFStat(fd int32, st *Bpxystat_t) (rv int32, rc int32, rn int32) { + st.St_id = [4]uint8{0xe2, 0xe3, 0xc1, 0xe3} + st.St_version = 2 + stat_sz := uint32(unsafe.Sizeof(*st)) + var parms [6]unsafe.Pointer + parms[0] = unsafe.Pointer(&fd) + parms[1] = unsafe.Pointer(&stat_sz) + parms[2] = unsafe.Pointer(st) + parms[3] = unsafe.Pointer(&rv) + parms[4] = unsafe.Pointer(&rc) + parms[5] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4FST) + return rv, rc, rn +} + +func BpxFileStat(name string, st *Bpxystat_t) (rv int32, rc int32, rn int32) { + if len(name) < 1024 { + var namebuf [1024]byte + sz := int32(copy(namebuf[:], name)) + A2e(namebuf[:sz]) + st.St_id = [4]uint8{0xe2, 0xe3, 0xc1, 0xe3} + st.St_version = 2 + stat_sz := uint32(unsafe.Sizeof(*st)) + var parms [7]unsafe.Pointer + parms[0] = unsafe.Pointer(&sz) + parms[1] = unsafe.Pointer(&namebuf[0]) + parms[2] = unsafe.Pointer(&stat_sz) + parms[3] = unsafe.Pointer(st) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4STA) + return rv, rc, rn + } + return -1, -1, -1 +} + +func BpxFileLStat(name string, st *Bpxystat_t) (rv int32, rc int32, rn int32) { + if len(name) < 1024 { + var namebuf [1024]byte + sz := int32(copy(namebuf[:], name)) + A2e(namebuf[:sz]) + st.St_id = [4]uint8{0xe2, 0xe3, 0xc1, 0xe3} + st.St_version = 2 + stat_sz := uint32(unsafe.Sizeof(*st)) + var parms [7]unsafe.Pointer + parms[0] = unsafe.Pointer(&sz) + parms[1] = unsafe.Pointer(&namebuf[0]) + parms[2] = unsafe.Pointer(&stat_sz) + parms[3] = unsafe.Pointer(st) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4LST) + return rv, rc, rn + } + return -1, -1, -1 +} + +func BpxChattr(path string, attr *Bpxyatt_t) (rv int32, rc int32, rn int32) { + if len(path) >= 1024 { + return -1, -1, -1 + } + var namebuf [1024]byte + sz := int32(copy(namebuf[:], path)) + A2e(namebuf[:sz]) + attr_sz := uint32(unsafe.Sizeof(*attr)) + var parms [7]unsafe.Pointer + parms[0] = unsafe.Pointer(&sz) + parms[1] = unsafe.Pointer(&namebuf[0]) + parms[2] = unsafe.Pointer(&attr_sz) + parms[3] = unsafe.Pointer(attr) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4CHR) + return rv, rc, rn +} + +func BpxLchattr(path string, attr *Bpxyatt_t) (rv int32, rc int32, rn int32) { + if len(path) >= 1024 { + return -1, -1, -1 + } + var namebuf [1024]byte + sz := int32(copy(namebuf[:], path)) + A2e(namebuf[:sz]) + attr_sz := uint32(unsafe.Sizeof(*attr)) + var parms [7]unsafe.Pointer + parms[0] = unsafe.Pointer(&sz) + parms[1] = unsafe.Pointer(&namebuf[0]) + parms[2] = unsafe.Pointer(&attr_sz) + parms[3] = unsafe.Pointer(attr) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4LCR) + return rv, rc, rn +} + +func BpxFchattr(fd int32, attr *Bpxyatt_t) (rv int32, rc int32, rn int32) { + attr_sz := uint32(unsafe.Sizeof(*attr)) + var parms [6]unsafe.Pointer + parms[0] = unsafe.Pointer(&fd) + parms[1] = unsafe.Pointer(&attr_sz) + parms[2] = unsafe.Pointer(attr) + parms[3] = unsafe.Pointer(&rv) + parms[4] = unsafe.Pointer(&rc) + parms[5] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4FCR) + return rv, rc, rn +} + +func BpxCondTimedWait(sec uint32, nsec uint32, events uint32, secrem *uint32, nsecrem *uint32) (rv int32, rc int32, rn int32) { + var parms [8]unsafe.Pointer + parms[0] = unsafe.Pointer(&sec) + parms[1] = unsafe.Pointer(&nsec) + parms[2] = unsafe.Pointer(&events) + parms[3] = unsafe.Pointer(secrem) + parms[4] = unsafe.Pointer(nsecrem) + parms[5] = unsafe.Pointer(&rv) + parms[6] = unsafe.Pointer(&rc) + parms[7] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4CTW) + return rv, rc, rn +} +func BpxGetthent(in *Pgtha, outlen *uint32, out unsafe.Pointer) (rv int32, rc int32, rn int32) { + var parms [7]unsafe.Pointer + inlen := uint32(26) // nothing else will work. Go says Pgtha is 28-byte because of alignment, but Pgtha is "packed" and must be 26-byte + parms[0] = unsafe.Pointer(&inlen) + parms[1] = unsafe.Pointer(&in) + parms[2] = unsafe.Pointer(outlen) + parms[3] = unsafe.Pointer(&out) + parms[4] = unsafe.Pointer(&rv) + parms[5] = unsafe.Pointer(&rc) + parms[6] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4GTH) + return rv, rc, rn +} +func ZosJobname() (jobname string, err error) { + var pgtha Pgtha + pgtha.Pid = uint32(Getpid()) + pgtha.Accesspid = PGTHA_CURRENT + pgtha.Flag1 = PGTHA_PROCESS + var out [256]byte + var outlen uint32 + outlen = 256 + rv, rc, rn := BpxGetthent(&pgtha, &outlen, unsafe.Pointer(&out[0])) + if rv == 0 { + gthc := []byte{0x87, 0xa3, 0x88, 0x83} // 'gthc' in ebcdic + ix := bytes.Index(out[:], gthc) + if ix == -1 { + err = fmt.Errorf("BPX4GTH: gthc return data not found") + return + } + jn := out[ix+80 : ix+88] // we didn't declare Pgthc, but jobname is 8-byte at offset 80 + E2a(jn) + jobname = string(bytes.TrimRight(jn, " ")) + + } else { + err = fmt.Errorf("BPX4GTH: rc=%d errno=%d reason=code=0x%x", rv, rc, rn) + } + return +} +func Bpx4ptq(code int32, data string) (rv int32, rc int32, rn int32) { + var userdata [8]byte + var parms [5]unsafe.Pointer + copy(userdata[:], data+" ") + A2e(userdata[:]) + parms[0] = unsafe.Pointer(&code) + parms[1] = unsafe.Pointer(&userdata[0]) + parms[2] = unsafe.Pointer(&rv) + parms[3] = unsafe.Pointer(&rc) + parms[4] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4PTQ) + return rv, rc, rn +} + +const ( + PT_TRACE_ME = 0 // Debug this process + PT_READ_I = 1 // Read a full word + PT_READ_D = 2 // Read a full word + PT_READ_U = 3 // Read control info + PT_WRITE_I = 4 //Write a full word + PT_WRITE_D = 5 //Write a full word + PT_CONTINUE = 7 //Continue the process + PT_KILL = 8 //Terminate the process + PT_READ_GPR = 11 // Read GPR, CR, PSW + PT_READ_FPR = 12 // Read FPR + PT_READ_VR = 13 // Read VR + PT_WRITE_GPR = 14 // Write GPR, CR, PSW + PT_WRITE_FPR = 15 // Write FPR + PT_WRITE_VR = 16 // Write VR + PT_READ_BLOCK = 17 // Read storage + PT_WRITE_BLOCK = 19 // Write storage + PT_READ_GPRH = 20 // Read GPRH + PT_WRITE_GPRH = 21 // Write GPRH + PT_REGHSET = 22 // Read all GPRHs + PT_ATTACH = 30 // Attach to a process + PT_DETACH = 31 // Detach from a process + PT_REGSET = 32 // Read all GPRs + PT_REATTACH = 33 // Reattach to a process + PT_LDINFO = 34 // Read loader info + PT_MULTI = 35 // Multi process mode + PT_LD64INFO = 36 // RMODE64 Info Area + PT_BLOCKREQ = 40 // Block request + PT_THREAD_INFO = 60 // Read thread info + PT_THREAD_MODIFY = 61 + PT_THREAD_READ_FOCUS = 62 + PT_THREAD_WRITE_FOCUS = 63 + PT_THREAD_HOLD = 64 + PT_THREAD_SIGNAL = 65 + PT_EXPLAIN = 66 + PT_EVENTS = 67 + PT_THREAD_INFO_EXTENDED = 68 + PT_REATTACH2 = 71 + PT_CAPTURE = 72 + PT_UNCAPTURE = 73 + PT_GET_THREAD_TCB = 74 + PT_GET_ALET = 75 + PT_SWAPIN = 76 + PT_EXTENDED_EVENT = 98 + PT_RECOVER = 99 // Debug a program check + PT_GPR0 = 0 // General purpose register 0 + PT_GPR1 = 1 // General purpose register 1 + PT_GPR2 = 2 // General purpose register 2 + PT_GPR3 = 3 // General purpose register 3 + PT_GPR4 = 4 // General purpose register 4 + PT_GPR5 = 5 // General purpose register 5 + PT_GPR6 = 6 // General purpose register 6 + PT_GPR7 = 7 // General purpose register 7 + PT_GPR8 = 8 // General purpose register 8 + PT_GPR9 = 9 // General purpose register 9 + PT_GPR10 = 10 // General purpose register 10 + PT_GPR11 = 11 // General purpose register 11 + PT_GPR12 = 12 // General purpose register 12 + PT_GPR13 = 13 // General purpose register 13 + PT_GPR14 = 14 // General purpose register 14 + PT_GPR15 = 15 // General purpose register 15 + PT_FPR0 = 16 // Floating point register 0 + PT_FPR1 = 17 // Floating point register 1 + PT_FPR2 = 18 // Floating point register 2 + PT_FPR3 = 19 // Floating point register 3 + PT_FPR4 = 20 // Floating point register 4 + PT_FPR5 = 21 // Floating point register 5 + PT_FPR6 = 22 // Floating point register 6 + PT_FPR7 = 23 // Floating point register 7 + PT_FPR8 = 24 // Floating point register 8 + PT_FPR9 = 25 // Floating point register 9 + PT_FPR10 = 26 // Floating point register 10 + PT_FPR11 = 27 // Floating point register 11 + PT_FPR12 = 28 // Floating point register 12 + PT_FPR13 = 29 // Floating point register 13 + PT_FPR14 = 30 // Floating point register 14 + PT_FPR15 = 31 // Floating point register 15 + PT_FPC = 32 // Floating point control register + PT_PSW = 40 // PSW + PT_PSW0 = 40 // Left half of the PSW + PT_PSW1 = 41 // Right half of the PSW + PT_CR0 = 42 // Control register 0 + PT_CR1 = 43 // Control register 1 + PT_CR2 = 44 // Control register 2 + PT_CR3 = 45 // Control register 3 + PT_CR4 = 46 // Control register 4 + PT_CR5 = 47 // Control register 5 + PT_CR6 = 48 // Control register 6 + PT_CR7 = 49 // Control register 7 + PT_CR8 = 50 // Control register 8 + PT_CR9 = 51 // Control register 9 + PT_CR10 = 52 // Control register 10 + PT_CR11 = 53 // Control register 11 + PT_CR12 = 54 // Control register 12 + PT_CR13 = 55 // Control register 13 + PT_CR14 = 56 // Control register 14 + PT_CR15 = 57 // Control register 15 + PT_GPRH0 = 58 // GP High register 0 + PT_GPRH1 = 59 // GP High register 1 + PT_GPRH2 = 60 // GP High register 2 + PT_GPRH3 = 61 // GP High register 3 + PT_GPRH4 = 62 // GP High register 4 + PT_GPRH5 = 63 // GP High register 5 + PT_GPRH6 = 64 // GP High register 6 + PT_GPRH7 = 65 // GP High register 7 + PT_GPRH8 = 66 // GP High register 8 + PT_GPRH9 = 67 // GP High register 9 + PT_GPRH10 = 68 // GP High register 10 + PT_GPRH11 = 69 // GP High register 11 + PT_GPRH12 = 70 // GP High register 12 + PT_GPRH13 = 71 // GP High register 13 + PT_GPRH14 = 72 // GP High register 14 + PT_GPRH15 = 73 // GP High register 15 + PT_VR0 = 74 // Vector register 0 + PT_VR1 = 75 // Vector register 1 + PT_VR2 = 76 // Vector register 2 + PT_VR3 = 77 // Vector register 3 + PT_VR4 = 78 // Vector register 4 + PT_VR5 = 79 // Vector register 5 + PT_VR6 = 80 // Vector register 6 + PT_VR7 = 81 // Vector register 7 + PT_VR8 = 82 // Vector register 8 + PT_VR9 = 83 // Vector register 9 + PT_VR10 = 84 // Vector register 10 + PT_VR11 = 85 // Vector register 11 + PT_VR12 = 86 // Vector register 12 + PT_VR13 = 87 // Vector register 13 + PT_VR14 = 88 // Vector register 14 + PT_VR15 = 89 // Vector register 15 + PT_VR16 = 90 // Vector register 16 + PT_VR17 = 91 // Vector register 17 + PT_VR18 = 92 // Vector register 18 + PT_VR19 = 93 // Vector register 19 + PT_VR20 = 94 // Vector register 20 + PT_VR21 = 95 // Vector register 21 + PT_VR22 = 96 // Vector register 22 + PT_VR23 = 97 // Vector register 23 + PT_VR24 = 98 // Vector register 24 + PT_VR25 = 99 // Vector register 25 + PT_VR26 = 100 // Vector register 26 + PT_VR27 = 101 // Vector register 27 + PT_VR28 = 102 // Vector register 28 + PT_VR29 = 103 // Vector register 29 + PT_VR30 = 104 // Vector register 30 + PT_VR31 = 105 // Vector register 31 + PT_PSWG = 106 // PSWG + PT_PSWG0 = 106 // Bytes 0-3 + PT_PSWG1 = 107 // Bytes 4-7 + PT_PSWG2 = 108 // Bytes 8-11 (IA high word) + PT_PSWG3 = 109 // Bytes 12-15 (IA low word) +) + +func Bpx4ptr(request int32, pid int32, addr unsafe.Pointer, data unsafe.Pointer, buffer unsafe.Pointer) (rv int32, rc int32, rn int32) { + var parms [8]unsafe.Pointer + parms[0] = unsafe.Pointer(&request) + parms[1] = unsafe.Pointer(&pid) + parms[2] = unsafe.Pointer(&addr) + parms[3] = unsafe.Pointer(&data) + parms[4] = unsafe.Pointer(&buffer) + parms[5] = unsafe.Pointer(&rv) + parms[6] = unsafe.Pointer(&rc) + parms[7] = unsafe.Pointer(&rn) + bpxcall(parms[:], BPX4PTR) + return rv, rc, rn +} + +func copyU8(val uint8, dest []uint8) int { + if len(dest) < 1 { + return 0 + } + dest[0] = val + return 1 +} + +func copyU8Arr(src, dest []uint8) int { + if len(dest) < len(src) { + return 0 + } + for i, v := range src { + dest[i] = v + } + return len(src) +} + +func copyU16(val uint16, dest []uint16) int { + if len(dest) < 1 { + return 0 + } + dest[0] = val + return 1 +} + +func copyU32(val uint32, dest []uint32) int { + if len(dest) < 1 { + return 0 + } + dest[0] = val + return 1 +} + +func copyU32Arr(src, dest []uint32) int { + if len(dest) < len(src) { + return 0 + } + for i, v := range src { + dest[i] = v + } + return len(src) +} + +func copyU64(val uint64, dest []uint64) int { + if len(dest) < 1 { + return 0 + } + dest[0] = val + return 1 +} diff --git a/vendor/golang.org/x/sys/unix/bpxsvc_zos.s b/vendor/golang.org/x/sys/unix/bpxsvc_zos.s new file mode 100644 index 0000000..4bd4a17 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/bpxsvc_zos.s @@ -0,0 +1,192 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "go_asm.h" +#include "textflag.h" + +// function to call USS assembly language services +// +// doc: https://www.ibm.com/support/knowledgecenter/en/SSLTBW_3.1.0/com.ibm.zos.v3r1.bpxb100/bit64env.htm +// +// arg1 unsafe.Pointer array that ressembles an OS PLIST +// +// arg2 function offset as in +// doc: https://www.ibm.com/support/knowledgecenter/en/SSLTBW_3.1.0/com.ibm.zos.v3r1.bpxb100/bpx2cr_List_of_offsets.htm +// +// func bpxcall(plist []unsafe.Pointer, bpx_offset int64) + +TEXT Β·bpxcall(SB), NOSPLIT|NOFRAME, $0 + MOVD plist_base+0(FP), R1 // r1 points to plist + MOVD bpx_offset+24(FP), R2 // r2 offset to BPX vector table + MOVD R14, R7 // save r14 + MOVD R15, R8 // save r15 + MOVWZ 16(R0), R9 + MOVWZ 544(R9), R9 + MOVWZ 24(R9), R9 // call vector in r9 + ADD R2, R9 // add offset to vector table + MOVWZ (R9), R9 // r9 points to entry point + BYTE $0x0D // BL R14,R9 --> basr r14,r9 + BYTE $0xE9 // clobbers 0,1,14,15 + MOVD R8, R15 // restore 15 + JMP R7 // return via saved return address + +// func A2e(arr [] byte) +// code page conversion from 819 to 1047 +TEXT Β·A2e(SB), NOSPLIT|NOFRAME, $0 + MOVD arg_base+0(FP), R2 // pointer to arry of characters + MOVD arg_len+8(FP), R3 // count + XOR R0, R0 + XOR R1, R1 + BYTE $0xA7; BYTE $0x15; BYTE $0x00; BYTE $0x82 // BRAS 1,(2+(256/2)) + + // ASCII -> EBCDIC conversion table: + BYTE $0x00; BYTE $0x01; BYTE $0x02; BYTE $0x03 + BYTE $0x37; BYTE $0x2d; BYTE $0x2e; BYTE $0x2f + BYTE $0x16; BYTE $0x05; BYTE $0x15; BYTE $0x0b + BYTE $0x0c; BYTE $0x0d; BYTE $0x0e; BYTE $0x0f + BYTE $0x10; BYTE $0x11; BYTE $0x12; BYTE $0x13 + BYTE $0x3c; BYTE $0x3d; BYTE $0x32; BYTE $0x26 + BYTE $0x18; BYTE $0x19; BYTE $0x3f; BYTE $0x27 + BYTE $0x1c; BYTE $0x1d; BYTE $0x1e; BYTE $0x1f + BYTE $0x40; BYTE $0x5a; BYTE $0x7f; BYTE $0x7b + BYTE $0x5b; BYTE $0x6c; BYTE $0x50; BYTE $0x7d + BYTE $0x4d; BYTE $0x5d; BYTE $0x5c; BYTE $0x4e + BYTE $0x6b; BYTE $0x60; BYTE $0x4b; BYTE $0x61 + BYTE $0xf0; BYTE $0xf1; BYTE $0xf2; BYTE $0xf3 + BYTE $0xf4; BYTE $0xf5; BYTE $0xf6; BYTE $0xf7 + BYTE $0xf8; BYTE $0xf9; BYTE $0x7a; BYTE $0x5e + BYTE $0x4c; BYTE $0x7e; BYTE $0x6e; BYTE $0x6f + BYTE $0x7c; BYTE $0xc1; BYTE $0xc2; BYTE $0xc3 + BYTE $0xc4; BYTE $0xc5; BYTE $0xc6; BYTE $0xc7 + BYTE $0xc8; BYTE $0xc9; BYTE $0xd1; BYTE $0xd2 + BYTE $0xd3; BYTE $0xd4; BYTE $0xd5; BYTE $0xd6 + BYTE $0xd7; BYTE $0xd8; BYTE $0xd9; BYTE $0xe2 + BYTE $0xe3; BYTE $0xe4; BYTE $0xe5; BYTE $0xe6 + BYTE $0xe7; BYTE $0xe8; BYTE $0xe9; BYTE $0xad + BYTE $0xe0; BYTE $0xbd; BYTE $0x5f; BYTE $0x6d + BYTE $0x79; BYTE $0x81; BYTE $0x82; BYTE $0x83 + BYTE $0x84; BYTE $0x85; BYTE $0x86; BYTE $0x87 + BYTE $0x88; BYTE $0x89; BYTE $0x91; BYTE $0x92 + BYTE $0x93; BYTE $0x94; BYTE $0x95; BYTE $0x96 + BYTE $0x97; BYTE $0x98; BYTE $0x99; BYTE $0xa2 + BYTE $0xa3; BYTE $0xa4; BYTE $0xa5; BYTE $0xa6 + BYTE $0xa7; BYTE $0xa8; BYTE $0xa9; BYTE $0xc0 + BYTE $0x4f; BYTE $0xd0; BYTE $0xa1; BYTE $0x07 + BYTE $0x20; BYTE $0x21; BYTE $0x22; BYTE $0x23 + BYTE $0x24; BYTE $0x25; BYTE $0x06; BYTE $0x17 + BYTE $0x28; BYTE $0x29; BYTE $0x2a; BYTE $0x2b + BYTE $0x2c; BYTE $0x09; BYTE $0x0a; BYTE $0x1b + BYTE $0x30; BYTE $0x31; BYTE $0x1a; BYTE $0x33 + BYTE $0x34; BYTE $0x35; BYTE $0x36; BYTE $0x08 + BYTE $0x38; BYTE $0x39; BYTE $0x3a; BYTE $0x3b + BYTE $0x04; BYTE $0x14; BYTE $0x3e; BYTE $0xff + BYTE $0x41; BYTE $0xaa; BYTE $0x4a; BYTE $0xb1 + BYTE $0x9f; BYTE $0xb2; BYTE $0x6a; BYTE $0xb5 + BYTE $0xbb; BYTE $0xb4; BYTE $0x9a; BYTE $0x8a + BYTE $0xb0; BYTE $0xca; BYTE $0xaf; BYTE $0xbc + BYTE $0x90; BYTE $0x8f; BYTE $0xea; BYTE $0xfa + BYTE $0xbe; BYTE $0xa0; BYTE $0xb6; BYTE $0xb3 + BYTE $0x9d; BYTE $0xda; BYTE $0x9b; BYTE $0x8b + BYTE $0xb7; BYTE $0xb8; BYTE $0xb9; BYTE $0xab + BYTE $0x64; BYTE $0x65; BYTE $0x62; BYTE $0x66 + BYTE $0x63; BYTE $0x67; BYTE $0x9e; BYTE $0x68 + BYTE $0x74; BYTE $0x71; BYTE $0x72; BYTE $0x73 + BYTE $0x78; BYTE $0x75; BYTE $0x76; BYTE $0x77 + BYTE $0xac; BYTE $0x69; BYTE $0xed; BYTE $0xee + BYTE $0xeb; BYTE $0xef; BYTE $0xec; BYTE $0xbf + BYTE $0x80; BYTE $0xfd; BYTE $0xfe; BYTE $0xfb + BYTE $0xfc; BYTE $0xba; BYTE $0xae; BYTE $0x59 + BYTE $0x44; BYTE $0x45; BYTE $0x42; BYTE $0x46 + BYTE $0x43; BYTE $0x47; BYTE $0x9c; BYTE $0x48 + BYTE $0x54; BYTE $0x51; BYTE $0x52; BYTE $0x53 + BYTE $0x58; BYTE $0x55; BYTE $0x56; BYTE $0x57 + BYTE $0x8c; BYTE $0x49; BYTE $0xcd; BYTE $0xce + BYTE $0xcb; BYTE $0xcf; BYTE $0xcc; BYTE $0xe1 + BYTE $0x70; BYTE $0xdd; BYTE $0xde; BYTE $0xdb + BYTE $0xdc; BYTE $0x8d; BYTE $0x8e; BYTE $0xdf + +retry: + WORD $0xB9931022 // TROO 2,2,b'0001' + BVS retry + RET + +// func e2a(arr [] byte) +// code page conversion from 1047 to 819 +TEXT Β·E2a(SB), NOSPLIT|NOFRAME, $0 + MOVD arg_base+0(FP), R2 // pointer to arry of characters + MOVD arg_len+8(FP), R3 // count + XOR R0, R0 + XOR R1, R1 + BYTE $0xA7; BYTE $0x15; BYTE $0x00; BYTE $0x82 // BRAS 1,(2+(256/2)) + + // EBCDIC -> ASCII conversion table: + BYTE $0x00; BYTE $0x01; BYTE $0x02; BYTE $0x03 + BYTE $0x9c; BYTE $0x09; BYTE $0x86; BYTE $0x7f + BYTE $0x97; BYTE $0x8d; BYTE $0x8e; BYTE $0x0b + BYTE $0x0c; BYTE $0x0d; BYTE $0x0e; BYTE $0x0f + BYTE $0x10; BYTE $0x11; BYTE $0x12; BYTE $0x13 + BYTE $0x9d; BYTE $0x0a; BYTE $0x08; BYTE $0x87 + BYTE $0x18; BYTE $0x19; BYTE $0x92; BYTE $0x8f + BYTE $0x1c; BYTE $0x1d; BYTE $0x1e; BYTE $0x1f + BYTE $0x80; BYTE $0x81; BYTE $0x82; BYTE $0x83 + BYTE $0x84; BYTE $0x85; BYTE $0x17; BYTE $0x1b + BYTE $0x88; BYTE $0x89; BYTE $0x8a; BYTE $0x8b + BYTE $0x8c; BYTE $0x05; BYTE $0x06; BYTE $0x07 + BYTE $0x90; BYTE $0x91; BYTE $0x16; BYTE $0x93 + BYTE $0x94; BYTE $0x95; BYTE $0x96; BYTE $0x04 + BYTE $0x98; BYTE $0x99; BYTE $0x9a; BYTE $0x9b + BYTE $0x14; BYTE $0x15; BYTE $0x9e; BYTE $0x1a + BYTE $0x20; BYTE $0xa0; BYTE $0xe2; BYTE $0xe4 + BYTE $0xe0; BYTE $0xe1; BYTE $0xe3; BYTE $0xe5 + BYTE $0xe7; BYTE $0xf1; BYTE $0xa2; BYTE $0x2e + BYTE $0x3c; BYTE $0x28; BYTE $0x2b; BYTE $0x7c + BYTE $0x26; BYTE $0xe9; BYTE $0xea; BYTE $0xeb + BYTE $0xe8; BYTE $0xed; BYTE $0xee; BYTE $0xef + BYTE $0xec; BYTE $0xdf; BYTE $0x21; BYTE $0x24 + BYTE $0x2a; BYTE $0x29; BYTE $0x3b; BYTE $0x5e + BYTE $0x2d; BYTE $0x2f; BYTE $0xc2; BYTE $0xc4 + BYTE $0xc0; BYTE $0xc1; BYTE $0xc3; BYTE $0xc5 + BYTE $0xc7; BYTE $0xd1; BYTE $0xa6; BYTE $0x2c + BYTE $0x25; BYTE $0x5f; BYTE $0x3e; BYTE $0x3f + BYTE $0xf8; BYTE $0xc9; BYTE $0xca; BYTE $0xcb + BYTE $0xc8; BYTE $0xcd; BYTE $0xce; BYTE $0xcf + BYTE $0xcc; BYTE $0x60; BYTE $0x3a; BYTE $0x23 + BYTE $0x40; BYTE $0x27; BYTE $0x3d; BYTE $0x22 + BYTE $0xd8; BYTE $0x61; BYTE $0x62; BYTE $0x63 + BYTE $0x64; BYTE $0x65; BYTE $0x66; BYTE $0x67 + BYTE $0x68; BYTE $0x69; BYTE $0xab; BYTE $0xbb + BYTE $0xf0; BYTE $0xfd; BYTE $0xfe; BYTE $0xb1 + BYTE $0xb0; BYTE $0x6a; BYTE $0x6b; BYTE $0x6c + BYTE $0x6d; BYTE $0x6e; BYTE $0x6f; BYTE $0x70 + BYTE $0x71; BYTE $0x72; BYTE $0xaa; BYTE $0xba + BYTE $0xe6; BYTE $0xb8; BYTE $0xc6; BYTE $0xa4 + BYTE $0xb5; BYTE $0x7e; BYTE $0x73; BYTE $0x74 + BYTE $0x75; BYTE $0x76; BYTE $0x77; BYTE $0x78 + BYTE $0x79; BYTE $0x7a; BYTE $0xa1; BYTE $0xbf + BYTE $0xd0; BYTE $0x5b; BYTE $0xde; BYTE $0xae + BYTE $0xac; BYTE $0xa3; BYTE $0xa5; BYTE $0xb7 + BYTE $0xa9; BYTE $0xa7; BYTE $0xb6; BYTE $0xbc + BYTE $0xbd; BYTE $0xbe; BYTE $0xdd; BYTE $0xa8 + BYTE $0xaf; BYTE $0x5d; BYTE $0xb4; BYTE $0xd7 + BYTE $0x7b; BYTE $0x41; BYTE $0x42; BYTE $0x43 + BYTE $0x44; BYTE $0x45; BYTE $0x46; BYTE $0x47 + BYTE $0x48; BYTE $0x49; BYTE $0xad; BYTE $0xf4 + BYTE $0xf6; BYTE $0xf2; BYTE $0xf3; BYTE $0xf5 + BYTE $0x7d; BYTE $0x4a; BYTE $0x4b; BYTE $0x4c + BYTE $0x4d; BYTE $0x4e; BYTE $0x4f; BYTE $0x50 + BYTE $0x51; BYTE $0x52; BYTE $0xb9; BYTE $0xfb + BYTE $0xfc; BYTE $0xf9; BYTE $0xfa; BYTE $0xff + BYTE $0x5c; BYTE $0xf7; BYTE $0x53; BYTE $0x54 + BYTE $0x55; BYTE $0x56; BYTE $0x57; BYTE $0x58 + BYTE $0x59; BYTE $0x5a; BYTE $0xb2; BYTE $0xd4 + BYTE $0xd6; BYTE $0xd2; BYTE $0xd3; BYTE $0xd5 + BYTE $0x30; BYTE $0x31; BYTE $0x32; BYTE $0x33 + BYTE $0x34; BYTE $0x35; BYTE $0x36; BYTE $0x37 + BYTE $0x38; BYTE $0x39; BYTE $0xb3; BYTE $0xdb + BYTE $0xdc; BYTE $0xd9; BYTE $0xda; BYTE $0x9f + +retry: + WORD $0xB9931022 // TROO 2,2,b'0001' + BVS retry + RET diff --git a/vendor/golang.org/x/sys/unix/epoll_zos.go b/vendor/golang.org/x/sys/unix/epoll_zos.go deleted file mode 100644 index 7753fdd..0000000 --- a/vendor/golang.org/x/sys/unix/epoll_zos.go +++ /dev/null @@ -1,220 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build zos && s390x - -package unix - -import ( - "sync" -) - -// This file simulates epoll on z/OS using poll. - -// Analogous to epoll_event on Linux. -// TODO(neeilan): Pad is because the Linux kernel expects a 96-bit struct. We never pass this to the kernel; remove? -type EpollEvent struct { - Events uint32 - Fd int32 - Pad int32 -} - -const ( - EPOLLERR = 0x8 - EPOLLHUP = 0x10 - EPOLLIN = 0x1 - EPOLLMSG = 0x400 - EPOLLOUT = 0x4 - EPOLLPRI = 0x2 - EPOLLRDBAND = 0x80 - EPOLLRDNORM = 0x40 - EPOLLWRBAND = 0x200 - EPOLLWRNORM = 0x100 - EPOLL_CTL_ADD = 0x1 - EPOLL_CTL_DEL = 0x2 - EPOLL_CTL_MOD = 0x3 - // The following constants are part of the epoll API, but represent - // currently unsupported functionality on z/OS. - // EPOLL_CLOEXEC = 0x80000 - // EPOLLET = 0x80000000 - // EPOLLONESHOT = 0x40000000 - // EPOLLRDHUP = 0x2000 // Typically used with edge-triggered notis - // EPOLLEXCLUSIVE = 0x10000000 // Exclusive wake-up mode - // EPOLLWAKEUP = 0x20000000 // Relies on Linux's BLOCK_SUSPEND capability -) - -// TODO(neeilan): We can eliminate these epToPoll / pToEpoll calls by using identical mask values for POLL/EPOLL -// constants where possible The lower 16 bits of epoll events (uint32) can fit any system poll event (int16). - -// epToPollEvt converts epoll event field to poll equivalent. -// In epoll, Events is a 32-bit field, while poll uses 16 bits. -func epToPollEvt(events uint32) int16 { - var ep2p = map[uint32]int16{ - EPOLLIN: POLLIN, - EPOLLOUT: POLLOUT, - EPOLLHUP: POLLHUP, - EPOLLPRI: POLLPRI, - EPOLLERR: POLLERR, - } - - var pollEvts int16 = 0 - for epEvt, pEvt := range ep2p { - if (events & epEvt) != 0 { - pollEvts |= pEvt - } - } - - return pollEvts -} - -// pToEpollEvt converts 16 bit poll event bitfields to 32-bit epoll event fields. -func pToEpollEvt(revents int16) uint32 { - var p2ep = map[int16]uint32{ - POLLIN: EPOLLIN, - POLLOUT: EPOLLOUT, - POLLHUP: EPOLLHUP, - POLLPRI: EPOLLPRI, - POLLERR: EPOLLERR, - } - - var epollEvts uint32 = 0 - for pEvt, epEvt := range p2ep { - if (revents & pEvt) != 0 { - epollEvts |= epEvt - } - } - - return epollEvts -} - -// Per-process epoll implementation. -type epollImpl struct { - mu sync.Mutex - epfd2ep map[int]*eventPoll - nextEpfd int -} - -// eventPoll holds a set of file descriptors being watched by the process. A process can have multiple epoll instances. -// On Linux, this is an in-kernel data structure accessed through a fd. -type eventPoll struct { - mu sync.Mutex - fds map[int]*EpollEvent -} - -// epoll impl for this process. -var impl epollImpl = epollImpl{ - epfd2ep: make(map[int]*eventPoll), - nextEpfd: 0, -} - -func (e *epollImpl) epollcreate(size int) (epfd int, err error) { - e.mu.Lock() - defer e.mu.Unlock() - epfd = e.nextEpfd - e.nextEpfd++ - - e.epfd2ep[epfd] = &eventPoll{ - fds: make(map[int]*EpollEvent), - } - return epfd, nil -} - -func (e *epollImpl) epollcreate1(flag int) (fd int, err error) { - return e.epollcreate(4) -} - -func (e *epollImpl) epollctl(epfd int, op int, fd int, event *EpollEvent) (err error) { - e.mu.Lock() - defer e.mu.Unlock() - - ep, ok := e.epfd2ep[epfd] - if !ok { - - return EBADF - } - - switch op { - case EPOLL_CTL_ADD: - // TODO(neeilan): When we make epfds and fds disjoint, detect epoll - // loops here (instances watching each other) and return ELOOP. - if _, ok := ep.fds[fd]; ok { - return EEXIST - } - ep.fds[fd] = event - case EPOLL_CTL_MOD: - if _, ok := ep.fds[fd]; !ok { - return ENOENT - } - ep.fds[fd] = event - case EPOLL_CTL_DEL: - if _, ok := ep.fds[fd]; !ok { - return ENOENT - } - delete(ep.fds, fd) - - } - return nil -} - -// Must be called while holding ep.mu -func (ep *eventPoll) getFds() []int { - fds := make([]int, len(ep.fds)) - for fd := range ep.fds { - fds = append(fds, fd) - } - return fds -} - -func (e *epollImpl) epollwait(epfd int, events []EpollEvent, msec int) (n int, err error) { - e.mu.Lock() // in [rare] case of concurrent epollcreate + epollwait - ep, ok := e.epfd2ep[epfd] - - if !ok { - e.mu.Unlock() - return 0, EBADF - } - - pollfds := make([]PollFd, 4) - for fd, epollevt := range ep.fds { - pollfds = append(pollfds, PollFd{Fd: int32(fd), Events: epToPollEvt(epollevt.Events)}) - } - e.mu.Unlock() - - n, err = Poll(pollfds, msec) - if err != nil { - return n, err - } - - i := 0 - for _, pFd := range pollfds { - if pFd.Revents != 0 { - events[i] = EpollEvent{Fd: pFd.Fd, Events: pToEpollEvt(pFd.Revents)} - i++ - } - - if i == n { - break - } - } - - return n, nil -} - -func EpollCreate(size int) (fd int, err error) { - return impl.epollcreate(size) -} - -func EpollCreate1(flag int) (fd int, err error) { - return impl.epollcreate1(flag) -} - -func EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) { - return impl.epollctl(epfd, op, fd, event) -} - -// Because EpollWait mutates events, the caller is expected to coordinate -// concurrent access if calling with the same epfd from multiple goroutines. -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - return impl.epollwait(epfd, events, msec) -} diff --git a/vendor/golang.org/x/sys/unix/fstatfs_zos.go b/vendor/golang.org/x/sys/unix/fstatfs_zos.go deleted file mode 100644 index c8bde60..0000000 --- a/vendor/golang.org/x/sys/unix/fstatfs_zos.go +++ /dev/null @@ -1,163 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build zos && s390x - -package unix - -import ( - "unsafe" -) - -// This file simulates fstatfs on z/OS using fstatvfs and w_getmntent. - -func Fstatfs(fd int, stat *Statfs_t) (err error) { - var stat_v Statvfs_t - err = Fstatvfs(fd, &stat_v) - if err == nil { - // populate stat - stat.Type = 0 - stat.Bsize = stat_v.Bsize - stat.Blocks = stat_v.Blocks - stat.Bfree = stat_v.Bfree - stat.Bavail = stat_v.Bavail - stat.Files = stat_v.Files - stat.Ffree = stat_v.Ffree - stat.Fsid = stat_v.Fsid - stat.Namelen = stat_v.Namemax - stat.Frsize = stat_v.Frsize - stat.Flags = stat_v.Flag - for passn := 0; passn < 5; passn++ { - switch passn { - case 0: - err = tryGetmntent64(stat) - break - case 1: - err = tryGetmntent128(stat) - break - case 2: - err = tryGetmntent256(stat) - break - case 3: - err = tryGetmntent512(stat) - break - case 4: - err = tryGetmntent1024(stat) - break - default: - break - } - //proceed to return if: err is nil (found), err is nonnil but not ERANGE (another error occurred) - if err == nil || err != nil && err != ERANGE { - break - } - } - } - return err -} - -func tryGetmntent64(stat *Statfs_t) (err error) { - var mnt_ent_buffer struct { - header W_Mnth - filesys_info [64]W_Mntent - } - var buffer_size int = int(unsafe.Sizeof(mnt_ent_buffer)) - fs_count, err := W_Getmntent((*byte)(unsafe.Pointer(&mnt_ent_buffer)), buffer_size) - if err != nil { - return err - } - err = ERANGE //return ERANGE if no match is found in this batch - for i := 0; i < fs_count; i++ { - if stat.Fsid == uint64(mnt_ent_buffer.filesys_info[i].Dev) { - stat.Type = uint32(mnt_ent_buffer.filesys_info[i].Fstname[0]) - err = nil - break - } - } - return err -} - -func tryGetmntent128(stat *Statfs_t) (err error) { - var mnt_ent_buffer struct { - header W_Mnth - filesys_info [128]W_Mntent - } - var buffer_size int = int(unsafe.Sizeof(mnt_ent_buffer)) - fs_count, err := W_Getmntent((*byte)(unsafe.Pointer(&mnt_ent_buffer)), buffer_size) - if err != nil { - return err - } - err = ERANGE //return ERANGE if no match is found in this batch - for i := 0; i < fs_count; i++ { - if stat.Fsid == uint64(mnt_ent_buffer.filesys_info[i].Dev) { - stat.Type = uint32(mnt_ent_buffer.filesys_info[i].Fstname[0]) - err = nil - break - } - } - return err -} - -func tryGetmntent256(stat *Statfs_t) (err error) { - var mnt_ent_buffer struct { - header W_Mnth - filesys_info [256]W_Mntent - } - var buffer_size int = int(unsafe.Sizeof(mnt_ent_buffer)) - fs_count, err := W_Getmntent((*byte)(unsafe.Pointer(&mnt_ent_buffer)), buffer_size) - if err != nil { - return err - } - err = ERANGE //return ERANGE if no match is found in this batch - for i := 0; i < fs_count; i++ { - if stat.Fsid == uint64(mnt_ent_buffer.filesys_info[i].Dev) { - stat.Type = uint32(mnt_ent_buffer.filesys_info[i].Fstname[0]) - err = nil - break - } - } - return err -} - -func tryGetmntent512(stat *Statfs_t) (err error) { - var mnt_ent_buffer struct { - header W_Mnth - filesys_info [512]W_Mntent - } - var buffer_size int = int(unsafe.Sizeof(mnt_ent_buffer)) - fs_count, err := W_Getmntent((*byte)(unsafe.Pointer(&mnt_ent_buffer)), buffer_size) - if err != nil { - return err - } - err = ERANGE //return ERANGE if no match is found in this batch - for i := 0; i < fs_count; i++ { - if stat.Fsid == uint64(mnt_ent_buffer.filesys_info[i].Dev) { - stat.Type = uint32(mnt_ent_buffer.filesys_info[i].Fstname[0]) - err = nil - break - } - } - return err -} - -func tryGetmntent1024(stat *Statfs_t) (err error) { - var mnt_ent_buffer struct { - header W_Mnth - filesys_info [1024]W_Mntent - } - var buffer_size int = int(unsafe.Sizeof(mnt_ent_buffer)) - fs_count, err := W_Getmntent((*byte)(unsafe.Pointer(&mnt_ent_buffer)), buffer_size) - if err != nil { - return err - } - err = ERANGE //return ERANGE if no match is found in this batch - for i := 0; i < fs_count; i++ { - if stat.Fsid == uint64(mnt_ent_buffer.filesys_info[i].Dev) { - stat.Type = uint32(mnt_ent_buffer.filesys_info[i].Fstname[0]) - err = nil - break - } - } - return err -} diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go index 4b68e59..7f602ff 100644 --- a/vendor/golang.org/x/sys/unix/mmap_nomremap.go +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris || zos package unix diff --git a/vendor/golang.org/x/sys/unix/pagesize_unix.go b/vendor/golang.org/x/sys/unix/pagesize_unix.go index 4d0a343..0482408 100644 --- a/vendor/golang.org/x/sys/unix/pagesize_unix.go +++ b/vendor/golang.org/x/sys/unix/pagesize_unix.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris +//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos // For Unix, get the pagesize from the runtime. diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go index 130398b..b903c00 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build darwin +//go:build darwin || zos package unix diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_zos.go b/vendor/golang.org/x/sys/unix/sockcmsg_zos.go new file mode 100644 index 0000000..3e53dbc --- /dev/null +++ b/vendor/golang.org/x/sys/unix/sockcmsg_zos.go @@ -0,0 +1,58 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Socket control messages + +package unix + +import "unsafe" + +// UnixCredentials encodes credentials into a socket control message +// for sending to another process. This can be used for +// authentication. +func UnixCredentials(ucred *Ucred) []byte { + b := make([]byte, CmsgSpace(SizeofUcred)) + h := (*Cmsghdr)(unsafe.Pointer(&b[0])) + h.Level = SOL_SOCKET + h.Type = SCM_CREDENTIALS + h.SetLen(CmsgLen(SizeofUcred)) + *(*Ucred)(h.data(0)) = *ucred + return b +} + +// ParseUnixCredentials decodes a socket control message that contains +// credentials in a Ucred structure. To receive such a message, the +// SO_PASSCRED option must be enabled on the socket. +func ParseUnixCredentials(m *SocketControlMessage) (*Ucred, error) { + if m.Header.Level != SOL_SOCKET { + return nil, EINVAL + } + if m.Header.Type != SCM_CREDENTIALS { + return nil, EINVAL + } + ucred := *(*Ucred)(unsafe.Pointer(&m.Data[0])) + return &ucred, nil +} + +// PktInfo4 encodes Inet4Pktinfo into a socket control message of type IP_PKTINFO. +func PktInfo4(info *Inet4Pktinfo) []byte { + b := make([]byte, CmsgSpace(SizeofInet4Pktinfo)) + h := (*Cmsghdr)(unsafe.Pointer(&b[0])) + h.Level = SOL_IP + h.Type = IP_PKTINFO + h.SetLen(CmsgLen(SizeofInet4Pktinfo)) + *(*Inet4Pktinfo)(h.data(0)) = *info + return b +} + +// PktInfo6 encodes Inet6Pktinfo into a socket control message of type IPV6_PKTINFO. +func PktInfo6(info *Inet6Pktinfo) []byte { + b := make([]byte, CmsgSpace(SizeofInet6Pktinfo)) + h := (*Cmsghdr)(unsafe.Pointer(&b[0])) + h.Level = SOL_IPV6 + h.Type = IPV6_PKTINFO + h.SetLen(CmsgLen(SizeofInet6Pktinfo)) + *(*Inet6Pktinfo)(h.data(0)) = *info + return b +} diff --git a/vendor/golang.org/x/sys/unix/symaddr_zos_s390x.s b/vendor/golang.org/x/sys/unix/symaddr_zos_s390x.s new file mode 100644 index 0000000..3c4f33c --- /dev/null +++ b/vendor/golang.org/x/sys/unix/symaddr_zos_s390x.s @@ -0,0 +1,75 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build zos && s390x && gc + +#include "textflag.h" + +// provide the address of function variable to be fixed up. + +TEXT Β·getPipe2Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Pipe2(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_FlockAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Flock(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_GetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Getxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_NanosleepAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Nanosleep(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_SetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Setxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_Wait4Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Wait4(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_MountAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Mount(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_UnmountAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Unmount(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_UtimesNanoAtAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·UtimesNanoAt(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_UtimesNanoAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·UtimesNano(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_MkfifoatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Mkfifoat(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_ChtagAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Chtag(SB), R8 + MOVD R8, ret+0(FP) + RET + +TEXT Β·get_ReadlinkatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Readlinkat(SB), R8 + MOVD R8, ret+0(FP) + RET + diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index b473038..312ae6a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -4,11 +4,21 @@ //go:build zos && s390x +// Many of the following syscalls are not available on all versions of z/OS. +// Some missing calls have legacy implementations/simulations but others +// will be missing completely. To achieve consistent failing behaviour on +// legacy systems, we first test the function pointer via a safeloading +// mechanism to see if the function exists on a given system. Then execution +// is branched to either continue the function call, or return an error. + package unix import ( "bytes" "fmt" + "os" + "reflect" + "regexp" "runtime" "sort" "strings" @@ -17,17 +27,205 @@ import ( "unsafe" ) +//go:noescape +func initZosLibVec() + +//go:noescape +func GetZosLibVec() uintptr + +func init() { + initZosLibVec() + r0, _, _ := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS_____GETENV_A<<4, uintptr(unsafe.Pointer(&([]byte("__ZOS_XSYSTRACE\x00"))[0]))) + if r0 != 0 { + n, _, _ := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___ATOI_A<<4, r0) + ZosTraceLevel = int(n) + r0, _, _ := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS_____GETENV_A<<4, uintptr(unsafe.Pointer(&([]byte("__ZOS_XSYSTRACEFD\x00"))[0]))) + if r0 != 0 { + fd, _, _ := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___ATOI_A<<4, r0) + f := os.NewFile(fd, "zostracefile") + if f != nil { + ZosTracefile = f + } + } + + } +} + +//go:noescape +func CallLeFuncWithErr(funcdesc uintptr, parms ...uintptr) (ret, errno2 uintptr, err Errno) + +//go:noescape +func CallLeFuncWithPtrReturn(funcdesc uintptr, parms ...uintptr) (ret, errno2 uintptr, err Errno) + +// ------------------------------- +// pointer validity test +// good pointer returns 0 +// bad pointer returns 1 +// +//go:nosplit +func ptrtest(uintptr) uint64 + +// Load memory at ptr location with error handling if the location is invalid +// +//go:noescape +func safeload(ptr uintptr) (value uintptr, error uintptr) + const ( - O_CLOEXEC = 0 // Dummy value (not supported). - AF_LOCAL = AF_UNIX // AF_LOCAL is an alias for AF_UNIX + entrypointLocationOffset = 8 // From function descriptor + + xplinkEyecatcher = 0x00c300c500c500f1 // ".C.E.E.1" + eyecatcherOffset = 16 // From function entrypoint (negative) + ppa1LocationOffset = 8 // From function entrypoint (negative) + + nameLenOffset = 0x14 // From PPA1 start + nameOffset = 0x16 // From PPA1 start ) -func syscall_syscall(trap, a1, a2, a3 uintptr) (r1, r2 uintptr, err Errno) -func syscall_rawsyscall(trap, a1, a2, a3 uintptr) (r1, r2 uintptr, err Errno) -func syscall_syscall6(trap, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) -func syscall_rawsyscall6(trap, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) -func syscall_syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err Errno) -func syscall_rawsyscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err Errno) +func getPpaOffset(funcptr uintptr) int64 { + entrypoint, err := safeload(funcptr + entrypointLocationOffset) + if err != 0 { + return -1 + } + + // XPLink functions have ".C.E.E.1" as the first 8 bytes (EBCDIC) + val, err := safeload(entrypoint - eyecatcherOffset) + if err != 0 { + return -1 + } + if val != xplinkEyecatcher { + return -1 + } + + ppaoff, err := safeload(entrypoint - ppa1LocationOffset) + if err != 0 { + return -1 + } + + ppaoff >>= 32 + return int64(ppaoff) +} + +//------------------------------- +// function descriptor pointer validity test +// good pointer returns 0 +// bad pointer returns 1 + +// TODO: currently mksyscall_zos_s390x.go generate empty string for funcName +// have correct funcName pass to the funcptrtest function +func funcptrtest(funcptr uintptr, funcName string) uint64 { + entrypoint, err := safeload(funcptr + entrypointLocationOffset) + if err != 0 { + return 1 + } + + ppaoff := getPpaOffset(funcptr) + if ppaoff == -1 { + return 1 + } + + // PPA1 offset value is from the start of the entire function block, not the entrypoint + ppa1 := (entrypoint - eyecatcherOffset) + uintptr(ppaoff) + + nameLen, err := safeload(ppa1 + nameLenOffset) + if err != 0 { + return 1 + } + + nameLen >>= 48 + if nameLen > 128 { + return 1 + } + + // no function name input to argument end here + if funcName == "" { + return 0 + } + + var funcname [128]byte + for i := 0; i < int(nameLen); i += 8 { + v, err := safeload(ppa1 + nameOffset + uintptr(i)) + if err != 0 { + return 1 + } + funcname[i] = byte(v >> 56) + funcname[i+1] = byte(v >> 48) + funcname[i+2] = byte(v >> 40) + funcname[i+3] = byte(v >> 32) + funcname[i+4] = byte(v >> 24) + funcname[i+5] = byte(v >> 16) + funcname[i+6] = byte(v >> 8) + funcname[i+7] = byte(v) + } + + runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, // __e2a_l + []uintptr{uintptr(unsafe.Pointer(&funcname[0])), nameLen}) + + name := string(funcname[:nameLen]) + if name != funcName { + return 1 + } + + return 0 +} + +// For detection of capabilities on a system. +// Is function descriptor f a valid function? +func isValidLeFunc(f uintptr) error { + ret := funcptrtest(f, "") + if ret != 0 { + return fmt.Errorf("Bad pointer, not an LE function ") + } + return nil +} + +// Retrieve function name from descriptor +func getLeFuncName(f uintptr) (string, error) { + // assume it has been checked, only check ppa1 validity here + entry := ((*[2]uintptr)(unsafe.Pointer(f)))[1] + preamp := ((*[4]uint32)(unsafe.Pointer(entry - eyecatcherOffset))) + + offsetPpa1 := preamp[2] + if offsetPpa1 > 0x0ffff { + return "", fmt.Errorf("PPA1 offset seems too big 0x%x\n", offsetPpa1) + } + + ppa1 := uintptr(unsafe.Pointer(preamp)) + uintptr(offsetPpa1) + res := ptrtest(ppa1) + if res != 0 { + return "", fmt.Errorf("PPA1 address not valid") + } + + size := *(*uint16)(unsafe.Pointer(ppa1 + nameLenOffset)) + if size > 128 { + return "", fmt.Errorf("Function name seems too long, length=%d\n", size) + } + + var name [128]byte + funcname := (*[128]byte)(unsafe.Pointer(ppa1 + nameOffset)) + copy(name[0:size], funcname[0:size]) + + runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, // __e2a_l + []uintptr{uintptr(unsafe.Pointer(&name[0])), uintptr(size)}) + + return string(name[:size]), nil +} + +// Check z/OS version +func zosLeVersion() (version, release uint32) { + p1 := (*(*uintptr)(unsafe.Pointer(uintptr(1208)))) >> 32 + p1 = *(*uintptr)(unsafe.Pointer(uintptr(p1 + 88))) + p1 = *(*uintptr)(unsafe.Pointer(uintptr(p1 + 8))) + p1 = *(*uintptr)(unsafe.Pointer(uintptr(p1 + 984))) + vrm := *(*uint32)(unsafe.Pointer(p1 + 80)) + version = (vrm & 0x00ff0000) >> 16 + release = (vrm & 0x0000ff00) >> 8 + return +} + +// returns a zos C FILE * for stdio fd 0, 1, 2 +func ZosStdioFilep(fd int32) uintptr { + return uintptr(*(*uint64)(unsafe.Pointer(uintptr(*(*uint64)(unsafe.Pointer(uintptr(*(*uint64)(unsafe.Pointer(uintptr(uint64(*(*uint32)(unsafe.Pointer(uintptr(1208)))) + 80))) + uint64((fd+2)<<3)))))))) +} func copyStat(stat *Stat_t, statLE *Stat_LE_t) { stat.Dev = uint64(statLE.Dev) @@ -65,6 +263,21 @@ func (d *Dirent) NameString() string { } } +func DecodeData(dest []byte, sz int, val uint64) { + for i := 0; i < sz; i++ { + dest[sz-1-i] = byte((val >> (uint64(i * 8))) & 0xff) + } +} + +func EncodeData(data []byte) uint64 { + var value uint64 + sz := len(data) + for i := 0; i < sz; i++ { + value |= uint64(data[i]) << uint64(((sz - i - 1) * 8)) + } + return value +} + func (sa *SockaddrInet4) sockaddr() (unsafe.Pointer, _Socklen, error) { if sa.Port < 0 || sa.Port > 0xFFFF { return nil, 0, EINVAL @@ -74,7 +287,9 @@ func (sa *SockaddrInet4) sockaddr() (unsafe.Pointer, _Socklen, error) { p := (*[2]byte)(unsafe.Pointer(&sa.raw.Port)) p[0] = byte(sa.Port >> 8) p[1] = byte(sa.Port) - sa.raw.Addr = sa.Addr + for i := 0; i < len(sa.Addr); i++ { + sa.raw.Addr[i] = sa.Addr[i] + } return unsafe.Pointer(&sa.raw), _Socklen(sa.raw.Len), nil } @@ -88,7 +303,9 @@ func (sa *SockaddrInet6) sockaddr() (unsafe.Pointer, _Socklen, error) { p[0] = byte(sa.Port >> 8) p[1] = byte(sa.Port) sa.raw.Scope_id = sa.ZoneId - sa.raw.Addr = sa.Addr + for i := 0; i < len(sa.Addr); i++ { + sa.raw.Addr[i] = sa.Addr[i] + } return unsafe.Pointer(&sa.raw), _Socklen(sa.raw.Len), nil } @@ -146,7 +363,9 @@ func anyToSockaddr(_ int, rsa *RawSockaddrAny) (Sockaddr, error) { sa := new(SockaddrInet4) p := (*[2]byte)(unsafe.Pointer(&pp.Port)) sa.Port = int(p[0])<<8 + int(p[1]) - sa.Addr = pp.Addr + for i := 0; i < len(sa.Addr); i++ { + sa.Addr[i] = pp.Addr[i] + } return sa, nil case AF_INET6: @@ -155,7 +374,9 @@ func anyToSockaddr(_ int, rsa *RawSockaddrAny) (Sockaddr, error) { p := (*[2]byte)(unsafe.Pointer(&pp.Port)) sa.Port = int(p[0])<<8 + int(p[1]) sa.ZoneId = pp.Scope_id - sa.Addr = pp.Addr + for i := 0; i < len(sa.Addr); i++ { + sa.Addr[i] = pp.Addr[i] + } return sa, nil } return nil, EAFNOSUPPORT @@ -177,6 +398,43 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { return } +func Accept4(fd int, flags int) (nfd int, sa Sockaddr, err error) { + var rsa RawSockaddrAny + var len _Socklen = SizeofSockaddrAny + nfd, err = accept4(fd, &rsa, &len, flags) + if err != nil { + return + } + if len > SizeofSockaddrAny { + panic("RawSockaddrAny too small") + } + // TODO(neeilan): Remove 0 in call + sa, err = anyToSockaddr(0, &rsa) + if err != nil { + Close(nfd) + nfd = 0 + } + return +} + +func Ctermid() (tty string, err error) { + var termdev [1025]byte + runtime.EnterSyscall() + r0, err2, err1 := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___CTERMID_A<<4, uintptr(unsafe.Pointer(&termdev[0]))) + runtime.ExitSyscall() + if r0 == 0 { + return "", fmt.Errorf("%s (errno2=0x%x)\n", err1.Error(), err2) + } + s := string(termdev[:]) + idx := strings.Index(s, string(rune(0))) + if idx == -1 { + tty = s + } else { + tty = s[:idx] + } + return +} + func (iov *Iovec) SetLen(length int) { iov.Len = uint64(length) } @@ -190,10 +448,16 @@ func (cmsg *Cmsghdr) SetLen(length int) { } //sys fcntl(fd int, cmd int, arg int) (val int, err error) +//sys Flistxattr(fd int, dest []byte) (sz int, err error) = SYS___FLISTXATTR_A +//sys Fremovexattr(fd int, attr string) (err error) = SYS___FREMOVEXATTR_A //sys read(fd int, p []byte) (n int, err error) //sys write(fd int, p []byte) (n int, err error) +//sys Fgetxattr(fd int, attr string, dest []byte) (sz int, err error) = SYS___FGETXATTR_A +//sys Fsetxattr(fd int, attr string, data []byte, flag int) (err error) = SYS___FSETXATTR_A + //sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A +//sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) = SYS___ACCEPT4_A //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) = SYS___BIND_A //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) = SYS___CONNECT_A //sysnb getgroups(n int, list *_Gid_t) (nn int, err error) @@ -204,6 +468,7 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sysnb socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) //sysnb getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) = SYS___GETPEERNAME_A //sysnb getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) = SYS___GETSOCKNAME_A +//sys Removexattr(path string, attr string) (err error) = SYS___REMOVEXATTR_A //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = SYS___RECVFROM_A //sys sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) = SYS___SENDTO_A //sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___RECVMSG_A @@ -212,6 +477,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP //sys ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL //sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL +//sys shmat(id int, addr uintptr, flag int) (ret uintptr, err error) = SYS_SHMAT +//sys shmctl(id int, cmd int, buf *SysvShmDesc) (result int, err error) = SYS_SHMCTL64 +//sys shmdt(addr uintptr) (err error) = SYS_SHMDT +//sys shmget(key int, size int, flag int) (id int, err error) = SYS_SHMGET //sys Access(path string, mode uint32) (err error) = SYS___ACCESS_A //sys Chdir(path string) (err error) = SYS___CHDIR_A @@ -220,14 +489,31 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys Creat(path string, mode uint32) (fd int, err error) = SYS___CREAT_A //sys Dup(oldfd int) (fd int, err error) //sys Dup2(oldfd int, newfd int) (err error) +//sys Dup3(oldfd int, newfd int, flags int) (err error) = SYS_DUP3 +//sys Dirfd(dirp uintptr) (fd int, err error) = SYS_DIRFD +//sys EpollCreate(size int) (fd int, err error) = SYS_EPOLL_CREATE +//sys EpollCreate1(flags int) (fd int, err error) = SYS_EPOLL_CREATE1 +//sys EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) = SYS_EPOLL_CTL +//sys EpollPwait(epfd int, events []EpollEvent, msec int, sigmask *int) (n int, err error) = SYS_EPOLL_PWAIT +//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_WAIT //sys Errno2() (er2 int) = SYS___ERRNO2 -//sys Err2ad() (eadd *int) = SYS___ERR2AD +//sys Eventfd(initval uint, flags int) (fd int, err error) = SYS_EVENTFD //sys Exit(code int) +//sys Faccessat(dirfd int, path string, mode uint32, flags int) (err error) = SYS___FACCESSAT_A + +func Faccessat2(dirfd int, path string, mode uint32, flags int) (err error) { + return Faccessat(dirfd, path, mode, flags) +} + //sys Fchdir(fd int) (err error) //sys Fchmod(fd int, mode uint32) (err error) +//sys Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) = SYS___FCHMODAT_A //sys Fchown(fd int, uid int, gid int) (err error) +//sys Fchownat(fd int, path string, uid int, gid int, flags int) (err error) = SYS___FCHOWNAT_A //sys FcntlInt(fd uintptr, cmd int, arg int) (retval int, err error) = SYS_FCNTL +//sys Fdatasync(fd int) (err error) = SYS_FDATASYNC //sys fstat(fd int, stat *Stat_LE_t) (err error) +//sys fstatat(dirfd int, path string, stat *Stat_LE_t, flags int) (err error) = SYS___FSTATAT_A func Fstat(fd int, stat *Stat_t) (err error) { var statLE Stat_LE_t @@ -236,28 +522,208 @@ func Fstat(fd int, stat *Stat_t) (err error) { return } +func Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) { + var statLE Stat_LE_t + err = fstatat(dirfd, path, &statLE, flags) + copyStat(stat, &statLE) + return +} + +func impl_Getxattr(path string, attr string, dest []byte) (sz int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p2 unsafe.Pointer + if len(dest) > 0 { + _p2 = unsafe.Pointer(&dest[0]) + } else { + _p2 = unsafe.Pointer(&_zero) + } + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___GETXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(_p2), uintptr(len(dest))) + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_GetxattrAddr() *(func(path string, attr string, dest []byte) (sz int, err error)) + +var Getxattr = enter_Getxattr + +func enter_Getxattr(path string, attr string, dest []byte) (sz int, err error) { + funcref := get_GetxattrAddr() + if validGetxattr() { + *funcref = impl_Getxattr + } else { + *funcref = error_Getxattr + } + return (*funcref)(path, attr, dest) +} + +func error_Getxattr(path string, attr string, dest []byte) (sz int, err error) { + return -1, ENOSYS +} + +func validGetxattr() bool { + if funcptrtest(GetZosLibVec()+SYS___GETXATTR_A<<4, "") == 0 { + if name, err := getLeFuncName(GetZosLibVec() + SYS___GETXATTR_A<<4); err == nil { + return name == "__getxattr_a" + } + } + return false +} + +//sys Lgetxattr(link string, attr string, dest []byte) (sz int, err error) = SYS___LGETXATTR_A +//sys Lsetxattr(path string, attr string, data []byte, flags int) (err error) = SYS___LSETXATTR_A + +func impl_Setxattr(path string, attr string, data []byte, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p2 unsafe.Pointer + if len(data) > 0 { + _p2 = unsafe.Pointer(&data[0]) + } else { + _p2 = unsafe.Pointer(&_zero) + } + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SETXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(_p2), uintptr(len(data)), uintptr(flags)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_SetxattrAddr() *(func(path string, attr string, data []byte, flags int) (err error)) + +var Setxattr = enter_Setxattr + +func enter_Setxattr(path string, attr string, data []byte, flags int) (err error) { + funcref := get_SetxattrAddr() + if validSetxattr() { + *funcref = impl_Setxattr + } else { + *funcref = error_Setxattr + } + return (*funcref)(path, attr, data, flags) +} + +func error_Setxattr(path string, attr string, data []byte, flags int) (err error) { + return ENOSYS +} + +func validSetxattr() bool { + if funcptrtest(GetZosLibVec()+SYS___SETXATTR_A<<4, "") == 0 { + if name, err := getLeFuncName(GetZosLibVec() + SYS___SETXATTR_A<<4); err == nil { + return name == "__setxattr_a" + } + } + return false +} + +//sys Fstatfs(fd int, buf *Statfs_t) (err error) = SYS_FSTATFS //sys Fstatvfs(fd int, stat *Statvfs_t) (err error) = SYS_FSTATVFS //sys Fsync(fd int) (err error) +//sys Futimes(fd int, tv []Timeval) (err error) = SYS_FUTIMES +//sys Futimesat(dirfd int, path string, tv []Timeval) (err error) = SYS___FUTIMESAT_A //sys Ftruncate(fd int, length int64) (err error) -//sys Getpagesize() (pgsize int) = SYS_GETPAGESIZE +//sys Getrandom(buf []byte, flags int) (n int, err error) = SYS_GETRANDOM +//sys InotifyInit() (fd int, err error) = SYS_INOTIFY_INIT +//sys InotifyInit1(flags int) (fd int, err error) = SYS_INOTIFY_INIT1 +//sys InotifyAddWatch(fd int, pathname string, mask uint32) (watchdesc int, err error) = SYS___INOTIFY_ADD_WATCH_A +//sys InotifyRmWatch(fd int, watchdesc uint32) (success int, err error) = SYS_INOTIFY_RM_WATCH +//sys Listxattr(path string, dest []byte) (sz int, err error) = SYS___LISTXATTR_A +//sys Llistxattr(path string, dest []byte) (sz int, err error) = SYS___LLISTXATTR_A +//sys Lremovexattr(path string, attr string) (err error) = SYS___LREMOVEXATTR_A +//sys Lutimes(path string, tv []Timeval) (err error) = SYS___LUTIMES_A //sys Mprotect(b []byte, prot int) (err error) = SYS_MPROTECT //sys Msync(b []byte, flags int) (err error) = SYS_MSYNC +//sys Console2(cmsg *ConsMsg2, modstr *byte, concmd *uint32) (err error) = SYS___CONSOLE2 + +// Pipe2 begin + +//go:nosplit +func getPipe2Addr() *(func([]int, int) error) + +var Pipe2 = pipe2Enter + +func pipe2Enter(p []int, flags int) (err error) { + if funcptrtest(GetZosLibVec()+SYS_PIPE2<<4, "") == 0 { + *getPipe2Addr() = pipe2Impl + } else { + *getPipe2Addr() = pipe2Error + } + return (*getPipe2Addr())(p, flags) +} + +func pipe2Impl(p []int, flags int) (err error) { + var pp [2]_C_int + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_PIPE2<<4, uintptr(unsafe.Pointer(&pp[0])), uintptr(flags)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } else { + p[0] = int(pp[0]) + p[1] = int(pp[1]) + } + return +} +func pipe2Error(p []int, flags int) (err error) { + return fmt.Errorf("Pipe2 is not available on this system") +} + +// Pipe2 end + //sys Poll(fds []PollFd, timeout int) (n int, err error) = SYS_POLL + +func Readdir(dir uintptr) (dirent *Dirent, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___READDIR_A<<4, uintptr(dir)) + runtime.ExitSyscall() + dirent = (*Dirent)(unsafe.Pointer(r0)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//sys Readdir_r(dirp uintptr, entry *direntLE, result **direntLE) (err error) = SYS___READDIR_R_A +//sys Statfs(path string, buf *Statfs_t) (err error) = SYS___STATFS_A +//sys Syncfs(fd int) (err error) = SYS_SYNCFS //sys Times(tms *Tms) (ticks uintptr, err error) = SYS_TIMES //sys W_Getmntent(buff *byte, size int) (lastsys int, err error) = SYS_W_GETMNTENT //sys W_Getmntent_A(buff *byte, size int) (lastsys int, err error) = SYS___W_GETMNTENT_A //sys mount_LE(path string, filesystem string, fstype string, mtm uint32, parmlen int32, parm string) (err error) = SYS___MOUNT_A -//sys unmount(filesystem string, mtm int) (err error) = SYS___UMOUNT_A +//sys unmount_LE(filesystem string, mtm int) (err error) = SYS___UMOUNT_A //sys Chroot(path string) (err error) = SYS___CHROOT_A //sys Select(nmsgsfds int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (ret int, err error) = SYS_SELECT -//sysnb Uname(buf *Utsname) (err error) = SYS___UNAME_A +//sysnb Uname(buf *Utsname) (err error) = SYS_____OSNAME_A +//sys Unshare(flags int) (err error) = SYS_UNSHARE func Ptsname(fd int) (name string, err error) { - r0, _, e1 := syscall_syscall(SYS___PTSNAME_A, uintptr(fd), 0, 0) - name = u2s(unsafe.Pointer(r0)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___PTSNAME_A<<4, uintptr(fd)) + runtime.ExitSyscall() + if r0 == 0 { + err = errnoErr2(e1, e2) + } else { + name = u2s(unsafe.Pointer(r0)) } return } @@ -272,13 +738,19 @@ func u2s(cstr unsafe.Pointer) string { } func Close(fd int) (err error) { - _, _, e1 := syscall_syscall(SYS_CLOSE, uintptr(fd), 0, 0) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_CLOSE<<4, uintptr(fd)) + runtime.ExitSyscall() for i := 0; e1 == EAGAIN && i < 10; i++ { - _, _, _ = syscall_syscall(SYS_USLEEP, uintptr(10), 0, 0) - _, _, e1 = syscall_syscall(SYS_CLOSE, uintptr(fd), 0, 0) + runtime.EnterSyscall() + CallLeFuncWithErr(GetZosLibVec()+SYS_USLEEP<<4, uintptr(10)) + runtime.ExitSyscall() + runtime.EnterSyscall() + r0, e2, e1 = CallLeFuncWithErr(GetZosLibVec()+SYS_CLOSE<<4, uintptr(fd)) + runtime.ExitSyscall() } - if e1 != 0 { - err = errnoErr(e1) + if r0 != 0 { + err = errnoErr2(e1, e2) } return } @@ -288,9 +760,15 @@ func Madvise(b []byte, advice int) (err error) { return } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A -//sysnb Getegid() (egid int) -//sysnb Geteuid() (uid int) //sysnb Getgid() (gid int) //sysnb Getpid() (pid int) //sysnb Getpgid(pid int) (pgid int, err error) = SYS_GETPGID @@ -317,11 +795,14 @@ func Getrusage(who int, rusage *Rusage) (err error) { return } +//sys Getegid() (egid int) = SYS_GETEGID +//sys Geteuid() (euid int) = SYS_GETEUID //sysnb Getsid(pid int) (sid int, err error) = SYS_GETSID //sysnb Getuid() (uid int) //sysnb Kill(pid int, sig Signal) (err error) //sys Lchown(path string, uid int, gid int) (err error) = SYS___LCHOWN_A //sys Link(path string, link string) (err error) = SYS___LINK_A +//sys Linkat(oldDirFd int, oldPath string, newDirFd int, newPath string, flags int) (err error) = SYS___LINKAT_A //sys Listen(s int, n int) (err error) //sys lstat(path string, stat *Stat_LE_t) (err error) = SYS___LSTAT_A @@ -332,15 +813,150 @@ func Lstat(path string, stat *Stat_t) (err error) { return } +// for checking symlinks begins with $VERSION/ $SYSNAME/ $SYSSYMR/ $SYSSYMA/ +func isSpecialPath(path []byte) (v bool) { + var special = [4][8]byte{ + [8]byte{'V', 'E', 'R', 'S', 'I', 'O', 'N', '/'}, + [8]byte{'S', 'Y', 'S', 'N', 'A', 'M', 'E', '/'}, + [8]byte{'S', 'Y', 'S', 'S', 'Y', 'M', 'R', '/'}, + [8]byte{'S', 'Y', 'S', 'S', 'Y', 'M', 'A', '/'}} + + var i, j int + for i = 0; i < len(special); i++ { + for j = 0; j < len(special[i]); j++ { + if path[j] != special[i][j] { + break + } + } + if j == len(special[i]) { + return true + } + } + return false +} + +func realpath(srcpath string, abspath []byte) (pathlen int, errno int) { + var source [1024]byte + copy(source[:], srcpath) + source[len(srcpath)] = 0 + ret := runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___REALPATH_A<<4, //__realpath_a() + []uintptr{uintptr(unsafe.Pointer(&source[0])), + uintptr(unsafe.Pointer(&abspath[0]))}) + if ret != 0 { + index := bytes.IndexByte(abspath[:], byte(0)) + if index != -1 { + return index, 0 + } + } else { + errptr := (*int)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, []uintptr{}))) //__errno() + return 0, *errptr + } + return 0, 245 // EBADDATA 245 +} + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + n = int(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___READLINK_A<<4, + []uintptr{uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))})) + runtime.KeepAlive(unsafe.Pointer(_p0)) + if n == -1 { + value := *(*int32)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, []uintptr{}))) + err = errnoErr(Errno(value)) + } else { + if buf[0] == '$' { + if isSpecialPath(buf[1:9]) { + cnt, err1 := realpath(path, buf) + if err1 == 0 { + n = cnt + } + } + } + } + return +} + +func impl_Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___READLINKAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + return n, err + } else { + if buf[0] == '$' { + if isSpecialPath(buf[1:9]) { + cnt, err1 := realpath(path, buf) + if err1 == 0 { + n = cnt + } + } + } + } + return +} + +//go:nosplit +func get_ReadlinkatAddr() *(func(dirfd int, path string, buf []byte) (n int, err error)) + +var Readlinkat = enter_Readlinkat + +func enter_Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + funcref := get_ReadlinkatAddr() + if funcptrtest(GetZosLibVec()+SYS___READLINKAT_A<<4, "") == 0 { + *funcref = impl_Readlinkat + } else { + *funcref = error_Readlinkat + } + return (*funcref)(dirfd, path, buf) +} + +func error_Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + n = -1 + err = ENOSYS + return +} + //sys Mkdir(path string, mode uint32) (err error) = SYS___MKDIR_A +//sys Mkdirat(dirfd int, path string, mode uint32) (err error) = SYS___MKDIRAT_A //sys Mkfifo(path string, mode uint32) (err error) = SYS___MKFIFO_A //sys Mknod(path string, mode uint32, dev int) (err error) = SYS___MKNOD_A +//sys Mknodat(dirfd int, path string, mode uint32, dev int) (err error) = SYS___MKNODAT_A +//sys PivotRoot(newroot string, oldroot string) (err error) = SYS___PIVOT_ROOT_A //sys Pread(fd int, p []byte, offset int64) (n int, err error) //sys Pwrite(fd int, p []byte, offset int64) (n int, err error) -//sys Readlink(path string, buf []byte) (n int, err error) = SYS___READLINK_A +//sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) = SYS___PRCTL_A +//sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT //sys Rename(from string, to string) (err error) = SYS___RENAME_A +//sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) = SYS___RENAMEAT_A +//sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) = SYS___RENAMEAT2_A //sys Rmdir(path string) (err error) = SYS___RMDIR_A //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK +//sys Setegid(egid int) (err error) = SYS_SETEGID +//sys Seteuid(euid int) (err error) = SYS_SETEUID +//sys Sethostname(p []byte) (err error) = SYS___SETHOSTNAME_A +//sys Setns(fd int, nstype int) (err error) = SYS_SETNS //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setpgid(pid int, pgid int) (err error) = SYS_SETPGID //sysnb Setrlimit(resource int, lim *Rlimit) (err error) @@ -360,32 +976,57 @@ func Stat(path string, sta *Stat_t) (err error) { } //sys Symlink(path string, link string) (err error) = SYS___SYMLINK_A +//sys Symlinkat(oldPath string, dirfd int, newPath string) (err error) = SYS___SYMLINKAT_A //sys Sync() = SYS_SYNC //sys Truncate(path string, length int64) (err error) = SYS___TRUNCATE_A //sys Tcgetattr(fildes int, termptr *Termios) (err error) = SYS_TCGETATTR //sys Tcsetattr(fildes int, when int, termptr *Termios) (err error) = SYS_TCSETATTR //sys Umask(mask int) (oldmask int) //sys Unlink(path string) (err error) = SYS___UNLINK_A +//sys Unlinkat(dirfd int, path string, flags int) (err error) = SYS___UNLINKAT_A //sys Utime(path string, utim *Utimbuf) (err error) = SYS___UTIME_A //sys open(path string, mode int, perm uint32) (fd int, err error) = SYS___OPEN_A func Open(path string, mode int, perm uint32) (fd int, err error) { + if mode&O_ACCMODE == 0 { + mode |= O_RDONLY + } return open(path, mode, perm) } -func Mkfifoat(dirfd int, path string, mode uint32) (err error) { - wd, err := Getwd() - if err != nil { - return err +//sys openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) = SYS___OPENAT_A + +func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) { + if flags&O_ACCMODE == 0 { + flags |= O_RDONLY } + return openat(dirfd, path, flags, mode) +} - if err := Fchdir(dirfd); err != nil { - return err +//sys openat2(dirfd int, path string, open_how *OpenHow, size int) (fd int, err error) = SYS___OPENAT2_A + +func Openat2(dirfd int, path string, how *OpenHow) (fd int, err error) { + if how.Flags&O_ACCMODE == 0 { + how.Flags |= O_RDONLY } - defer Chdir(wd) + return openat2(dirfd, path, how, SizeofOpenHow) +} - return Mkfifo(path, mode) +func ZosFdToPath(dirfd int) (path string, err error) { + var buffer [1024]byte + runtime.EnterSyscall() + ret, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_W_IOCTL<<4, uintptr(dirfd), 17, 1024, uintptr(unsafe.Pointer(&buffer[0]))) + runtime.ExitSyscall() + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + CallLeFuncWithErr(GetZosLibVec()+SYS___E2A_L<<4, uintptr(unsafe.Pointer(&buffer[0])), uintptr(zb)) + return string(buffer[:zb]), nil + } + return "", errnoErr2(e1, e2) } //sys remove(path string) (err error) @@ -403,10 +1044,12 @@ func Getcwd(buf []byte) (n int, err error) { } else { p = unsafe.Pointer(&_zero) } - _, _, e := syscall_syscall(SYS___GETCWD_A, uintptr(p), uintptr(len(buf)), 0) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___GETCWD_A<<4, uintptr(p), uintptr(len(buf))) + runtime.ExitSyscall() n = clen(buf) + 1 - if e != 0 { - err = errnoErr(e) + if r0 == 0 { + err = errnoErr2(e1, e2) } return } @@ -520,9 +1163,41 @@ func (w WaitStatus) StopSignal() Signal { func (w WaitStatus) TrapCause() int { return -1 } +//sys waitid(idType int, id int, info *Siginfo, options int) (err error) + +func Waitid(idType int, id int, info *Siginfo, options int, rusage *Rusage) (err error) { + return waitid(idType, id, info, options) +} + //sys waitpid(pid int, wstatus *_C_int, options int) (wpid int, err error) -func Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) { +func impl_Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_WAIT4<<4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage))) + runtime.ExitSyscall() + wpid = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_Wait4Addr() *(func(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error)) + +var Wait4 = enter_Wait4 + +func enter_Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) { + funcref := get_Wait4Addr() + if funcptrtest(GetZosLibVec()+SYS_WAIT4<<4, "") == 0 { + *funcref = impl_Wait4 + } else { + *funcref = legacyWait4 + } + return (*funcref)(pid, wstatus, options, rusage) +} + +func legacyWait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) { // TODO(mundaym): z/OS doesn't have wait4. I don't think getrusage does what we want. // At the moment rusage will not be touched. var status _C_int @@ -571,23 +1246,62 @@ func Pipe(p []int) (err error) { } var pp [2]_C_int err = pipe(&pp) - if err == nil { - p[0] = int(pp[0]) - p[1] = int(pp[1]) - } + p[0] = int(pp[0]) + p[1] = int(pp[1]) return } //sys utimes(path string, timeval *[2]Timeval) (err error) = SYS___UTIMES_A func Utimes(path string, tv []Timeval) (err error) { + if tv == nil { + return utimes(path, nil) + } if len(tv) != 2 { return EINVAL } return utimes(path, (*[2]Timeval)(unsafe.Pointer(&tv[0]))) } -func UtimesNano(path string, ts []Timespec) error { +//sys utimensat(dirfd int, path string, ts *[2]Timespec, flags int) (err error) = SYS___UTIMENSAT_A + +func validUtimensat() bool { + if funcptrtest(GetZosLibVec()+SYS___UTIMENSAT_A<<4, "") == 0 { + if name, err := getLeFuncName(GetZosLibVec() + SYS___UTIMENSAT_A<<4); err == nil { + return name == "__utimensat_a" + } + } + return false +} + +// Begin UtimesNano + +//go:nosplit +func get_UtimesNanoAddr() *(func(path string, ts []Timespec) (err error)) + +var UtimesNano = enter_UtimesNano + +func enter_UtimesNano(path string, ts []Timespec) (err error) { + funcref := get_UtimesNanoAddr() + if validUtimensat() { + *funcref = utimesNanoImpl + } else { + *funcref = legacyUtimesNano + } + return (*funcref)(path, ts) +} + +func utimesNanoImpl(path string, ts []Timespec) (err error) { + if ts == nil { + return utimensat(AT_FDCWD, path, nil, 0) + } + if len(ts) != 2 { + return EINVAL + } + return utimensat(AT_FDCWD, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), 0) +} + +func legacyUtimesNano(path string, ts []Timespec) (err error) { if len(ts) != 2 { return EINVAL } @@ -600,6 +1314,70 @@ func UtimesNano(path string, ts []Timespec) error { return utimes(path, (*[2]Timeval)(unsafe.Pointer(&tv[0]))) } +// End UtimesNano + +// Begin UtimesNanoAt + +//go:nosplit +func get_UtimesNanoAtAddr() *(func(dirfd int, path string, ts []Timespec, flags int) (err error)) + +var UtimesNanoAt = enter_UtimesNanoAt + +func enter_UtimesNanoAt(dirfd int, path string, ts []Timespec, flags int) (err error) { + funcref := get_UtimesNanoAtAddr() + if validUtimensat() { + *funcref = utimesNanoAtImpl + } else { + *funcref = legacyUtimesNanoAt + } + return (*funcref)(dirfd, path, ts, flags) +} + +func utimesNanoAtImpl(dirfd int, path string, ts []Timespec, flags int) (err error) { + if ts == nil { + return utimensat(dirfd, path, nil, flags) + } + if len(ts) != 2 { + return EINVAL + } + return utimensat(dirfd, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), flags) +} + +func legacyUtimesNanoAt(dirfd int, path string, ts []Timespec, flags int) (err error) { + if path[0] != '/' { + dirPath, err := ZosFdToPath(dirfd) + if err != nil { + return err + } + path = dirPath + "/" + path + } + if flags == AT_SYMLINK_NOFOLLOW { + if len(ts) != 2 { + return EINVAL + } + + if ts[0].Nsec >= 5e8 { + ts[0].Sec++ + } + ts[0].Nsec = 0 + if ts[1].Nsec >= 5e8 { + ts[1].Sec++ + } + ts[1].Nsec = 0 + + // Not as efficient as it could be because Timespec and + // Timeval have different types in the different OSes + tv := []Timeval{ + NsecToTimeval(TimespecToNsec(ts[0])), + NsecToTimeval(TimespecToNsec(ts[1])), + } + return Lutimes(path, tv) + } + return UtimesNano(path, ts) +} + +// End UtimesNanoAt + func Getsockname(fd int) (sa Sockaddr, err error) { var rsa RawSockaddrAny var len _Socklen = SizeofSockaddrAny @@ -1186,67 +1964,46 @@ func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) return n, nil } -func Opendir(name string) (uintptr, error) { - p, err := BytePtrFromString(name) - if err != nil { - return 0, err - } - dir, _, e := syscall_syscall(SYS___OPENDIR_A, uintptr(unsafe.Pointer(p)), 0, 0) - runtime.KeepAlive(unsafe.Pointer(p)) - if e != 0 { - err = errnoErr(e) - } - return dir, err -} - -// clearsyscall.Errno resets the errno value to 0. -func clearErrno() - -func Readdir(dir uintptr) (*Dirent, error) { - var ent Dirent - var res uintptr - // __readdir_r_a returns errno at the end of the directory stream, rather than 0. - // Therefore to avoid false positives we clear errno before calling it. - - // TODO(neeilan): Commented this out to get sys/unix compiling on z/OS. Uncomment and fix. Error: "undefined: clearsyscall" - //clearsyscall.Errno() // TODO(mundaym): check pre-emption rules. - - e, _, _ := syscall_syscall(SYS___READDIR_R_A, dir, uintptr(unsafe.Pointer(&ent)), uintptr(unsafe.Pointer(&res))) - var err error - if e != 0 { - err = errnoErr(Errno(e)) - } - if res == 0 { - return nil, err - } - return &ent, err -} - -func readdir_r(dirp uintptr, entry *direntLE, result **direntLE) (err error) { - r0, _, e1 := syscall_syscall(SYS___READDIR_R_A, dirp, uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) - if int64(r0) == -1 { - err = errnoErr(Errno(e1)) +func Opendir(name string) (uintptr, error) { + p, err := BytePtrFromString(name) + if err != nil { + return 0, err } - return + err = nil + runtime.EnterSyscall() + dir, e2, e1 := CallLeFuncWithPtrReturn(GetZosLibVec()+SYS___OPENDIR_A<<4, uintptr(unsafe.Pointer(p))) + runtime.ExitSyscall() + runtime.KeepAlive(unsafe.Pointer(p)) + if dir == 0 { + err = errnoErr2(e1, e2) + } + return dir, err } +// clearsyscall.Errno resets the errno value to 0. +func clearErrno() + func Closedir(dir uintptr) error { - _, _, e := syscall_syscall(SYS_CLOSEDIR, dir, 0, 0) - if e != 0 { - return errnoErr(e) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_CLOSEDIR<<4, dir) + runtime.ExitSyscall() + if r0 != 0 { + return errnoErr2(e1, e2) } return nil } func Seekdir(dir uintptr, pos int) { - _, _, _ = syscall_syscall(SYS_SEEKDIR, dir, uintptr(pos), 0) + runtime.EnterSyscall() + CallLeFuncWithErr(GetZosLibVec()+SYS_SEEKDIR<<4, dir, uintptr(pos)) + runtime.ExitSyscall() } func Telldir(dir uintptr) (int, error) { - p, _, e := syscall_syscall(SYS_TELLDIR, dir, 0, 0) + p, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_TELLDIR<<4, dir) pos := int(p) - if pos == -1 { - return pos, errnoErr(e) + if int64(p) == -1 { + return pos, errnoErr2(e1, e2) } return pos, nil } @@ -1261,19 +2018,55 @@ func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error { *(*int64)(unsafe.Pointer(&flock[4])) = lk.Start *(*int64)(unsafe.Pointer(&flock[12])) = lk.Len *(*int32)(unsafe.Pointer(&flock[20])) = lk.Pid - _, _, errno := syscall_syscall(SYS_FCNTL, fd, uintptr(cmd), uintptr(unsafe.Pointer(&flock))) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCNTL<<4, fd, uintptr(cmd), uintptr(unsafe.Pointer(&flock))) + runtime.ExitSyscall() lk.Type = *(*int16)(unsafe.Pointer(&flock[0])) lk.Whence = *(*int16)(unsafe.Pointer(&flock[2])) lk.Start = *(*int64)(unsafe.Pointer(&flock[4])) lk.Len = *(*int64)(unsafe.Pointer(&flock[12])) lk.Pid = *(*int32)(unsafe.Pointer(&flock[20])) - if errno == 0 { + if r0 == 0 { return nil } - return errno + return errnoErr2(e1, e2) +} + +func impl_Flock(fd int, how int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FLOCK<<4, uintptr(fd), uintptr(how)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FlockAddr() *(func(fd int, how int) (err error)) + +var Flock = enter_Flock + +func validFlock(fp uintptr) bool { + if funcptrtest(GetZosLibVec()+SYS_FLOCK<<4, "") == 0 { + if name, err := getLeFuncName(GetZosLibVec() + SYS_FLOCK<<4); err == nil { + return name == "flock" + } + } + return false +} + +func enter_Flock(fd int, how int) (err error) { + funcref := get_FlockAddr() + if validFlock(GetZosLibVec() + SYS_FLOCK<<4) { + *funcref = impl_Flock + } else { + *funcref = legacyFlock + } + return (*funcref)(fd, how) } -func Flock(fd int, how int) error { +func legacyFlock(fd int, how int) error { var flock_type int16 var fcntl_cmd int @@ -1307,41 +2100,51 @@ func Flock(fd int, how int) error { } func Mlock(b []byte) (err error) { - _, _, e1 := syscall_syscall(SYS___MLOCKALL, _BPX_NONSWAP, 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MLOCKALL<<4, _BPX_NONSWAP) + runtime.ExitSyscall() + if r0 != 0 { + err = errnoErr2(e1, e2) } return } func Mlock2(b []byte, flags int) (err error) { - _, _, e1 := syscall_syscall(SYS___MLOCKALL, _BPX_NONSWAP, 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MLOCKALL<<4, _BPX_NONSWAP) + runtime.ExitSyscall() + if r0 != 0 { + err = errnoErr2(e1, e2) } return } func Mlockall(flags int) (err error) { - _, _, e1 := syscall_syscall(SYS___MLOCKALL, _BPX_NONSWAP, 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MLOCKALL<<4, _BPX_NONSWAP) + runtime.ExitSyscall() + if r0 != 0 { + err = errnoErr2(e1, e2) } return } func Munlock(b []byte) (err error) { - _, _, e1 := syscall_syscall(SYS___MLOCKALL, _BPX_SWAP, 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MLOCKALL<<4, _BPX_SWAP) + runtime.ExitSyscall() + if r0 != 0 { + err = errnoErr2(e1, e2) } return } func Munlockall() (err error) { - _, _, e1 := syscall_syscall(SYS___MLOCKALL, _BPX_SWAP, 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MLOCKALL<<4, _BPX_SWAP) + runtime.ExitSyscall() + if r0 != 0 { + err = errnoErr2(e1, e2) } return } @@ -1372,15 +2175,104 @@ func ClockGettime(clockid int32, ts *Timespec) error { return nil } -func Statfs(path string, stat *Statfs_t) (err error) { - fd, err := open(path, O_RDONLY, 0) - defer Close(fd) - if err != nil { - return err +// Chtag + +//go:nosplit +func get_ChtagAddr() *(func(path string, ccsid uint64, textbit uint64) error) + +var Chtag = enter_Chtag + +func enter_Chtag(path string, ccsid uint64, textbit uint64) error { + funcref := get_ChtagAddr() + if validSetxattr() { + *funcref = impl_Chtag + } else { + *funcref = legacy_Chtag + } + return (*funcref)(path, ccsid, textbit) +} + +func legacy_Chtag(path string, ccsid uint64, textbit uint64) error { + tag := ccsid<<16 | textbit<<15 + var tag_buff [8]byte + DecodeData(tag_buff[:], 8, tag) + return Setxattr(path, "filetag", tag_buff[:], XATTR_REPLACE) +} + +func impl_Chtag(path string, ccsid uint64, textbit uint64) error { + tag := ccsid<<16 | textbit<<15 + var tag_buff [4]byte + DecodeData(tag_buff[:], 4, tag) + return Setxattr(path, "system.filetag", tag_buff[:], XATTR_REPLACE) +} + +// End of Chtag + +// Nanosleep + +//go:nosplit +func get_NanosleepAddr() *(func(time *Timespec, leftover *Timespec) error) + +var Nanosleep = enter_Nanosleep + +func enter_Nanosleep(time *Timespec, leftover *Timespec) error { + funcref := get_NanosleepAddr() + if funcptrtest(GetZosLibVec()+SYS_NANOSLEEP<<4, "") == 0 { + *funcref = impl_Nanosleep + } else { + *funcref = legacyNanosleep + } + return (*funcref)(time, leftover) +} + +func impl_Nanosleep(time *Timespec, leftover *Timespec) error { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_NANOSLEEP<<4, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover))) + runtime.ExitSyscall() + if int64(r0) == -1 { + return errnoErr2(e1, e2) + } + return nil +} + +func legacyNanosleep(time *Timespec, leftover *Timespec) error { + t0 := runtime.Nanotime1() + var secrem uint32 + var nsecrem uint32 + total := time.Sec*1000000000 + time.Nsec + elapsed := runtime.Nanotime1() - t0 + var rv int32 + var rc int32 + var err error + // repeatedly sleep for 1 second until less than 1 second left + for total-elapsed > 1000000000 { + rv, rc, _ = BpxCondTimedWait(uint32(1), uint32(0), uint32(CW_CONDVAR), &secrem, &nsecrem) + if rv != 0 && rc != 112 { // 112 is EAGAIN + if leftover != nil && rc == 120 { // 120 is EINTR + leftover.Sec = int64(secrem) + leftover.Nsec = int64(nsecrem) + } + err = Errno(rc) + return err + } + elapsed = runtime.Nanotime1() - t0 } - return Fstatfs(fd, stat) + // sleep the remainder + if total > elapsed { + rv, rc, _ = BpxCondTimedWait(uint32(0), uint32(total-elapsed), uint32(CW_CONDVAR), &secrem, &nsecrem) + } + if leftover != nil && rc == 120 { + leftover.Sec = int64(secrem) + leftover.Nsec = int64(nsecrem) + } + if rv != 0 && rc != 112 { + err = Errno(rc) + } + return err } +// End of Nanosleep + var ( Stdin = 0 Stdout = 1 @@ -1395,6 +2287,9 @@ var ( errENOENT error = syscall.ENOENT ) +var ZosTraceLevel int +var ZosTracefile *os.File + var ( signalNameMapOnce sync.Once signalNameMap map[string]syscall.Signal @@ -1416,6 +2311,56 @@ func errnoErr(e Errno) error { return e } +var reg *regexp.Regexp + +// enhanced with zos specific errno2 +func errnoErr2(e Errno, e2 uintptr) error { + switch e { + case 0: + return nil + case EAGAIN: + return errEAGAIN + /* + Allow the retrieval of errno2 for EINVAL and ENOENT on zos + case EINVAL: + return errEINVAL + case ENOENT: + return errENOENT + */ + } + if ZosTraceLevel > 0 { + var name string + if reg == nil { + reg = regexp.MustCompile("(^unix\\.[^/]+$|.*\\/unix\\.[^/]+$)") + } + i := 1 + pc, file, line, ok := runtime.Caller(i) + if ok { + name = runtime.FuncForPC(pc).Name() + } + for ok && reg.MatchString(runtime.FuncForPC(pc).Name()) { + i += 1 + pc, file, line, ok = runtime.Caller(i) + } + if ok { + if ZosTracefile == nil { + ZosConsolePrintf("From %s:%d\n", file, line) + ZosConsolePrintf("%s: %s (errno2=0x%x)\n", name, e.Error(), e2) + } else { + fmt.Fprintf(ZosTracefile, "From %s:%d\n", file, line) + fmt.Fprintf(ZosTracefile, "%s: %s (errno2=0x%x)\n", name, e.Error(), e2) + } + } else { + if ZosTracefile == nil { + ZosConsolePrintf("%s (errno2=0x%x)\n", e.Error(), e2) + } else { + fmt.Fprintf(ZosTracefile, "%s (errno2=0x%x)\n", e.Error(), e2) + } + } + } + return e +} + // ErrnoName returns the error name for error number e. func ErrnoName(e Errno) string { i := sort.Search(len(errorList), func(i int) bool { @@ -1474,6 +2419,9 @@ func (m *mmapper) Mmap(fd int, offset int64, length int, prot int, flags int) (d return nil, EINVAL } + // Set __MAP_64 by default + flags |= __MAP_64 + // Map the requested memory. addr, errno := m.mmap(0, uintptr(length), prot, flags, fd, offset) if errno != nil { @@ -1778,83 +2726,170 @@ func Exec(argv0 string, argv []string, envv []string) error { return syscall.Exec(argv0, argv, envv) } -func Mount(source string, target string, fstype string, flags uintptr, data string) (err error) { +func Getag(path string) (ccsid uint16, flag uint16, err error) { + var val [8]byte + sz, err := Getxattr(path, "ccsid", val[:]) + if err != nil { + return + } + ccsid = uint16(EncodeData(val[0:sz])) + sz, err = Getxattr(path, "flags", val[:]) + if err != nil { + return + } + flag = uint16(EncodeData(val[0:sz]) >> 15) + return +} + +// Mount begin +func impl_Mount(source string, target string, fstype string, flags uintptr, data string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(source) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(target) + if err != nil { + return + } + var _p2 *byte + _p2, err = BytePtrFromString(fstype) + if err != nil { + return + } + var _p3 *byte + _p3, err = BytePtrFromString(data) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MOUNT1_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(unsafe.Pointer(_p2)), uintptr(flags), uintptr(unsafe.Pointer(_p3))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_MountAddr() *(func(source string, target string, fstype string, flags uintptr, data string) (err error)) + +var Mount = enter_Mount + +func enter_Mount(source string, target string, fstype string, flags uintptr, data string) (err error) { + funcref := get_MountAddr() + if validMount() { + *funcref = impl_Mount + } else { + *funcref = legacyMount + } + return (*funcref)(source, target, fstype, flags, data) +} + +func legacyMount(source string, target string, fstype string, flags uintptr, data string) (err error) { if needspace := 8 - len(fstype); needspace <= 0 { - fstype = fstype[:8] + fstype = fstype[0:8] } else { - fstype += " "[:needspace] + fstype += " "[0:needspace] } return mount_LE(target, source, fstype, uint32(flags), int32(len(data)), data) } -func Unmount(name string, mtm int) (err error) { +func validMount() bool { + if funcptrtest(GetZosLibVec()+SYS___MOUNT1_A<<4, "") == 0 { + if name, err := getLeFuncName(GetZosLibVec() + SYS___MOUNT1_A<<4); err == nil { + return name == "__mount1_a" + } + } + return false +} + +// Mount end + +// Unmount begin +func impl_Unmount(target string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(target) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UMOUNT2_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_UnmountAddr() *(func(target string, flags int) (err error)) + +var Unmount = enter_Unmount + +func enter_Unmount(target string, flags int) (err error) { + funcref := get_UnmountAddr() + if funcptrtest(GetZosLibVec()+SYS___UMOUNT2_A<<4, "") == 0 { + *funcref = impl_Unmount + } else { + *funcref = legacyUnmount + } + return (*funcref)(target, flags) +} + +func legacyUnmount(name string, mtm int) (err error) { // mountpoint is always a full path and starts with a '/' // check if input string is not a mountpoint but a filesystem name if name[0] != '/' { - return unmount(name, mtm) + return unmount_LE(name, mtm) } // treat name as mountpoint b2s := func(arr []byte) string { - nulli := bytes.IndexByte(arr, 0) - if nulli == -1 { - return string(arr) - } else { - return string(arr[:nulli]) + var str string + for i := 0; i < len(arr); i++ { + if arr[i] == 0 { + str = string(arr[:i]) + break + } } + return str } var buffer struct { header W_Mnth fsinfo [64]W_Mntent } - fsCount, err := W_Getmntent_A((*byte)(unsafe.Pointer(&buffer)), int(unsafe.Sizeof(buffer))) - if err != nil { - return err - } - if fsCount == 0 { - return EINVAL - } - for i := 0; i < fsCount; i++ { - if b2s(buffer.fsinfo[i].Mountpoint[:]) == name { - err = unmount(b2s(buffer.fsinfo[i].Fsname[:]), mtm) - break + fs_count, err := W_Getmntent_A((*byte)(unsafe.Pointer(&buffer)), int(unsafe.Sizeof(buffer))) + if err == nil { + err = EINVAL + for i := 0; i < fs_count; i++ { + if b2s(buffer.fsinfo[i].Mountpoint[:]) == name { + err = unmount_LE(b2s(buffer.fsinfo[i].Fsname[:]), mtm) + break + } } + } else if fs_count == 0 { + err = EINVAL } return err } -func fdToPath(dirfd int) (path string, err error) { - var buffer [1024]byte - // w_ctrl() - ret := runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_W_IOCTL<<4, - []uintptr{uintptr(dirfd), 17, 1024, uintptr(unsafe.Pointer(&buffer[0]))}) - if ret == 0 { - zb := bytes.IndexByte(buffer[:], 0) - if zb == -1 { - zb = len(buffer) - } - // __e2a_l() - runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, - []uintptr{uintptr(unsafe.Pointer(&buffer[0])), uintptr(zb)}) - return string(buffer[:zb]), nil - } - // __errno() - errno := int(*(*int32)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, - []uintptr{})))) - // __errno2() - errno2 := int(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO2<<4, - []uintptr{})) - // strerror_r() - ret = runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_STRERROR_R<<4, - []uintptr{uintptr(errno), uintptr(unsafe.Pointer(&buffer[0])), 1024}) - if ret == 0 { - zb := bytes.IndexByte(buffer[:], 0) - if zb == -1 { - zb = len(buffer) - } - return "", fmt.Errorf("%s (errno2=0x%x)", buffer[:zb], errno2) - } else { - return "", fmt.Errorf("fdToPath errno %d (errno2=0x%x)", errno, errno2) +// Unmount end + +func direntIno(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino)) +} + +func direntReclen(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen)) +} + +func direntNamlen(buf []byte) (uint64, bool) { + reclen, ok := direntReclen(buf) + if !ok { + return 0, false } + return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true } func direntLeToDirentUnix(dirent *direntLE, dir uintptr, path string) (Dirent, error) { @@ -1896,7 +2931,7 @@ func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { } // Get path from fd to avoid unavailable call (fdopendir) - path, err := fdToPath(fd) + path, err := ZosFdToPath(fd) if err != nil { return 0, err } @@ -1910,7 +2945,7 @@ func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { for { var entryLE direntLE var entrypLE *direntLE - e := readdir_r(d, &entryLE, &entrypLE) + e := Readdir_r(d, &entryLE, &entrypLE) if e != nil { return n, e } @@ -1956,23 +2991,127 @@ func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { return n, nil } -func ReadDirent(fd int, buf []byte) (n int, err error) { - var base = (*uintptr)(unsafe.Pointer(new(uint64))) - return Getdirentries(fd, buf, base) +func Err2ad() (eadd *int) { + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS___ERR2AD<<4) + eadd = (*int)(unsafe.Pointer(r0)) + return } -func direntIno(buf []byte) (uint64, bool) { - return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino)) +func ZosConsolePrintf(format string, v ...interface{}) (int, error) { + type __cmsg struct { + _ uint16 + _ [2]uint8 + __msg_length uint32 + __msg uintptr + _ [4]uint8 + } + msg := fmt.Sprintf(format, v...) + strptr := unsafe.Pointer((*reflect.StringHeader)(unsafe.Pointer(&msg)).Data) + len := (*reflect.StringHeader)(unsafe.Pointer(&msg)).Len + cmsg := __cmsg{__msg_length: uint32(len), __msg: uintptr(strptr)} + cmd := uint32(0) + runtime.EnterSyscall() + rc, err2, err1 := CallLeFuncWithErr(GetZosLibVec()+SYS_____CONSOLE_A<<4, uintptr(unsafe.Pointer(&cmsg)), 0, uintptr(unsafe.Pointer(&cmd))) + runtime.ExitSyscall() + if rc != 0 { + return 0, fmt.Errorf("%s (errno2=0x%x)\n", err1.Error(), err2) + } + return 0, nil +} +func ZosStringToEbcdicBytes(str string, nullterm bool) (ebcdicBytes []byte) { + if nullterm { + ebcdicBytes = []byte(str + "\x00") + } else { + ebcdicBytes = []byte(str) + } + A2e(ebcdicBytes) + return +} +func ZosEbcdicBytesToString(b []byte, trimRight bool) (str string) { + res := make([]byte, len(b)) + copy(res, b) + E2a(res) + if trimRight { + str = string(bytes.TrimRight(res, " \x00")) + } else { + str = string(res) + } + return } -func direntReclen(buf []byte) (uint64, bool) { - return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen)) +func fdToPath(dirfd int) (path string, err error) { + var buffer [1024]byte + // w_ctrl() + ret := runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_W_IOCTL<<4, + []uintptr{uintptr(dirfd), 17, 1024, uintptr(unsafe.Pointer(&buffer[0]))}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + // __e2a_l() + runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, + []uintptr{uintptr(unsafe.Pointer(&buffer[0])), uintptr(zb)}) + return string(buffer[:zb]), nil + } + // __errno() + errno := int(*(*int32)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, + []uintptr{})))) + // __errno2() + errno2 := int(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO2<<4, + []uintptr{})) + // strerror_r() + ret = runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_STRERROR_R<<4, + []uintptr{uintptr(errno), uintptr(unsafe.Pointer(&buffer[0])), 1024}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + return "", fmt.Errorf("%s (errno2=0x%x)", buffer[:zb], errno2) + } else { + return "", fmt.Errorf("fdToPath errno %d (errno2=0x%x)", errno, errno2) + } } -func direntNamlen(buf []byte) (uint64, bool) { - reclen, ok := direntReclen(buf) - if !ok { - return 0, false +func impl_Mkfifoat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKFIFOAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_MkfifoatAddr() *(func(dirfd int, path string, mode uint32) (err error)) + +var Mkfifoat = enter_Mkfifoat + +func enter_Mkfifoat(dirfd int, path string, mode uint32) (err error) { + funcref := get_MkfifoatAddr() + if funcptrtest(GetZosLibVec()+SYS___MKFIFOAT_A<<4, "") == 0 { + *funcref = impl_Mkfifoat + } else { + *funcref = legacy_Mkfifoat + } + return (*funcref)(dirfd, path, mode) +} + +func legacy_Mkfifoat(dirfd int, path string, mode uint32) (err error) { + dirname, err := ZosFdToPath(dirfd) + if err != nil { + return err + } + return Mkfifo(dirname+"/"+path, mode) } + +//sys Posix_openpt(oflag int) (fd int, err error) = SYS_POSIX_OPENPT +//sys Grantpt(fildes int) (rc int, err error) = SYS_GRANTPT +//sys Unlockpt(fildes int) (rc int, err error) = SYS_UNLOCKPT diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 79a84f1..672d6b0 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (darwin && !ios) || linux +//go:build (darwin && !ios) || linux || zos package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go index 9eb0db6..8b7977a 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build darwin && !ios +//go:build (darwin && !ios) || zos package unix diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 36bf839..93a38a9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -491,6 +491,7 @@ const ( BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 BPF_F_STRICT_ALIGNMENT = 0x1 + BPF_F_TEST_REG_INVARIANTS = 0x80 BPF_F_TEST_RND_HI32 = 0x4 BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 @@ -1697,6 +1698,7 @@ const ( KEXEC_ARCH_S390 = 0x160000 KEXEC_ARCH_SH = 0x2a0000 KEXEC_ARCH_X86_64 = 0x3e0000 + KEXEC_FILE_DEBUG = 0x8 KEXEC_FILE_NO_INITRAMFS = 0x4 KEXEC_FILE_ON_CRASH = 0x2 KEXEC_FILE_UNLOAD = 0x1 @@ -1898,6 +1900,7 @@ const ( MNT_DETACH = 0x2 MNT_EXPIRE = 0x4 MNT_FORCE = 0x1 + MNT_ID_REQ_SIZE_VER0 = 0x18 MODULE_INIT_COMPRESSED_FILE = 0x4 MODULE_INIT_IGNORE_MODVERSIONS = 0x1 MODULE_INIT_IGNORE_VERMAGIC = 0x2 @@ -2302,6 +2305,7 @@ const ( PERF_AUX_FLAG_PARTIAL = 0x4 PERF_AUX_FLAG_PMU_FORMAT_TYPE_MASK = 0xff00 PERF_AUX_FLAG_TRUNCATED = 0x1 + PERF_BRANCH_ENTRY_INFO_BITS_MAX = 0x21 PERF_BR_ARM64_DEBUG_DATA = 0x7 PERF_BR_ARM64_DEBUG_EXIT = 0x5 PERF_BR_ARM64_DEBUG_HALT = 0x4 @@ -3168,6 +3172,7 @@ const ( STATX_GID = 0x10 STATX_INO = 0x100 STATX_MNT_ID = 0x1000 + STATX_MNT_ID_UNIQUE = 0x4000 STATX_MODE = 0x2 STATX_MTIME = 0x40 STATX_NLINK = 0x4 @@ -3562,12 +3567,16 @@ const ( XDP_RX_RING = 0x2 XDP_SHARED_UMEM = 0x1 XDP_STATISTICS = 0x7 + XDP_TXMD_FLAGS_CHECKSUM = 0x2 + XDP_TXMD_FLAGS_TIMESTAMP = 0x1 + XDP_TX_METADATA = 0x2 XDP_TX_RING = 0x3 XDP_UMEM_COMPLETION_RING = 0x6 XDP_UMEM_FILL_RING = 0x5 XDP_UMEM_PGOFF_COMPLETION_RING = 0x180000000 XDP_UMEM_PGOFF_FILL_RING = 0x100000000 XDP_UMEM_REG = 0x4 + XDP_UMEM_TX_SW_CSUM = 0x2 XDP_UMEM_UNALIGNED_CHUNK_FLAG = 0x1 XDP_USE_NEED_WAKEUP = 0x8 XDP_USE_SG = 0x10 diff --git a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go index 4dfd2e0..da08b2a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go @@ -10,41 +10,99 @@ package unix const ( - BRKINT = 0x0001 - CLOCK_MONOTONIC = 0x1 - CLOCK_PROCESS_CPUTIME_ID = 0x2 - CLOCK_REALTIME = 0x0 - CLOCK_THREAD_CPUTIME_ID = 0x3 - CS8 = 0x0030 - CSIZE = 0x0030 - ECHO = 0x00000008 - ECHONL = 0x00000001 - FD_CLOEXEC = 0x01 - FD_CLOFORK = 0x02 - FNDELAY = 0x04 - F_CLOSFD = 9 - F_CONTROL_CVT = 13 - F_DUPFD = 0 - F_DUPFD2 = 8 - F_GETFD = 1 - F_GETFL = 259 - F_GETLK = 5 - F_GETOWN = 10 - F_OK = 0x0 - F_RDLCK = 1 - F_SETFD = 2 - F_SETFL = 4 - F_SETLK = 6 - F_SETLKW = 7 - F_SETOWN = 11 - F_SETTAG = 12 - F_UNLCK = 3 - F_WRLCK = 2 - FSTYPE_ZFS = 0xe9 //"Z" - FSTYPE_HFS = 0xc8 //"H" - FSTYPE_NFS = 0xd5 //"N" - FSTYPE_TFS = 0xe3 //"T" - FSTYPE_AUTOMOUNT = 0xc1 //"A" + BRKINT = 0x0001 + CLOCAL = 0x1 + CLOCK_MONOTONIC = 0x1 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x3 + CLONE_NEWIPC = 0x08000000 + CLONE_NEWNET = 0x40000000 + CLONE_NEWNS = 0x00020000 + CLONE_NEWPID = 0x20000000 + CLONE_NEWUTS = 0x04000000 + CLONE_PARENT = 0x00008000 + CS8 = 0x0030 + CSIZE = 0x0030 + ECHO = 0x00000008 + ECHONL = 0x00000001 + EFD_SEMAPHORE = 0x00002000 + EFD_CLOEXEC = 0x00001000 + EFD_NONBLOCK = 0x00000004 + EPOLL_CLOEXEC = 0x00001000 + EPOLL_CTL_ADD = 0 + EPOLL_CTL_MOD = 1 + EPOLL_CTL_DEL = 2 + EPOLLRDNORM = 0x0001 + EPOLLRDBAND = 0x0002 + EPOLLIN = 0x0003 + EPOLLOUT = 0x0004 + EPOLLWRBAND = 0x0008 + EPOLLPRI = 0x0010 + EPOLLERR = 0x0020 + EPOLLHUP = 0x0040 + EPOLLEXCLUSIVE = 0x20000000 + EPOLLONESHOT = 0x40000000 + FD_CLOEXEC = 0x01 + FD_CLOFORK = 0x02 + FD_SETSIZE = 0x800 + FNDELAY = 0x04 + F_CLOSFD = 9 + F_CONTROL_CVT = 13 + F_DUPFD = 0 + F_DUPFD2 = 8 + F_GETFD = 1 + F_GETFL = 259 + F_GETLK = 5 + F_GETOWN = 10 + F_OK = 0x0 + F_RDLCK = 1 + F_SETFD = 2 + F_SETFL = 4 + F_SETLK = 6 + F_SETLKW = 7 + F_SETOWN = 11 + F_SETTAG = 12 + F_UNLCK = 3 + F_WRLCK = 2 + FSTYPE_ZFS = 0xe9 //"Z" + FSTYPE_HFS = 0xc8 //"H" + FSTYPE_NFS = 0xd5 //"N" + FSTYPE_TFS = 0xe3 //"T" + FSTYPE_AUTOMOUNT = 0xc1 //"A" + GRND_NONBLOCK = 1 + GRND_RANDOM = 2 + HUPCL = 0x0100 // Hang up on last close + IN_CLOEXEC = 0x00001000 + IN_NONBLOCK = 0x00000004 + IN_ACCESS = 0x00000001 + IN_MODIFY = 0x00000002 + IN_ATTRIB = 0x00000004 + IN_CLOSE_WRITE = 0x00000008 + IN_CLOSE_NOWRITE = 0x00000010 + IN_OPEN = 0x00000020 + IN_MOVED_FROM = 0x00000040 + IN_MOVED_TO = 0x00000080 + IN_CREATE = 0x00000100 + IN_DELETE = 0x00000200 + IN_DELETE_SELF = 0x00000400 + IN_MOVE_SELF = 0x00000800 + IN_UNMOUNT = 0x00002000 + IN_Q_OVERFLOW = 0x00004000 + IN_IGNORED = 0x00008000 + IN_CLOSE = (IN_CLOSE_WRITE | IN_CLOSE_NOWRITE) + IN_MOVE = (IN_MOVED_FROM | IN_MOVED_TO) + IN_ALL_EVENTS = (IN_ACCESS | IN_MODIFY | IN_ATTRIB | + IN_CLOSE | IN_OPEN | IN_MOVE | + IN_CREATE | IN_DELETE | IN_DELETE_SELF | + IN_MOVE_SELF) + IN_ONLYDIR = 0x01000000 + IN_DONT_FOLLOW = 0x02000000 + IN_EXCL_UNLINK = 0x04000000 + IN_MASK_CREATE = 0x10000000 + IN_MASK_ADD = 0x20000000 + IN_ISDIR = 0x40000000 + IN_ONESHOT = 0x80000000 IP6F_MORE_FRAG = 0x0001 IP6F_OFF_MASK = 0xfff8 IP6F_RESERVED_MASK = 0x0006 @@ -152,10 +210,18 @@ const ( IP_PKTINFO = 101 IP_RECVPKTINFO = 102 IP_TOS = 2 - IP_TTL = 3 + IP_TTL = 14 IP_UNBLOCK_SOURCE = 11 + ICMP6_FILTER = 1 + MCAST_INCLUDE = 0 + MCAST_EXCLUDE = 1 + MCAST_JOIN_GROUP = 40 + MCAST_LEAVE_GROUP = 41 + MCAST_JOIN_SOURCE_GROUP = 42 + MCAST_LEAVE_SOURCE_GROUP = 43 + MCAST_BLOCK_SOURCE = 44 + MCAST_UNBLOCK_SOURCE = 46 ICANON = 0x0010 - ICMP6_FILTER = 0x26 ICRNL = 0x0002 IEXTEN = 0x0020 IGNBRK = 0x0004 @@ -165,10 +231,10 @@ const ( ISTRIP = 0x0080 IXON = 0x0200 IXOFF = 0x0100 - LOCK_SH = 0x1 // Not exist on zOS - LOCK_EX = 0x2 // Not exist on zOS - LOCK_NB = 0x4 // Not exist on zOS - LOCK_UN = 0x8 // Not exist on zOS + LOCK_SH = 0x1 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_UN = 0x8 POLLIN = 0x0003 POLLOUT = 0x0004 POLLPRI = 0x0010 @@ -182,15 +248,29 @@ const ( MAP_PRIVATE = 0x1 // changes are private MAP_SHARED = 0x2 // changes are shared MAP_FIXED = 0x4 // place exactly - MCAST_JOIN_GROUP = 40 - MCAST_LEAVE_GROUP = 41 - MCAST_JOIN_SOURCE_GROUP = 42 - MCAST_LEAVE_SOURCE_GROUP = 43 - MCAST_BLOCK_SOURCE = 44 - MCAST_UNBLOCK_SOURCE = 45 + __MAP_MEGA = 0x8 + __MAP_64 = 0x10 + MAP_ANON = 0x20 + MAP_ANONYMOUS = 0x20 MS_SYNC = 0x1 // msync - synchronous writes MS_ASYNC = 0x2 // asynchronous writes MS_INVALIDATE = 0x4 // invalidate mappings + MS_BIND = 0x00001000 + MS_MOVE = 0x00002000 + MS_NOSUID = 0x00000002 + MS_PRIVATE = 0x00040000 + MS_REC = 0x00004000 + MS_REMOUNT = 0x00008000 + MS_RDONLY = 0x00000001 + MS_UNBINDABLE = 0x00020000 + MNT_DETACH = 0x00000004 + ZOSDSFS_SUPER_MAGIC = 0x44534653 // zOS DSFS + NFS_SUPER_MAGIC = 0x6969 // NFS + NSFS_MAGIC = 0x6e736673 // PROCNS + PROC_SUPER_MAGIC = 0x9fa0 // proc FS + ZOSTFS_SUPER_MAGIC = 0x544653 // zOS TFS + ZOSUFS_SUPER_MAGIC = 0x554653 // zOS UFS + ZOSZFS_SUPER_MAGIC = 0x5A4653 // zOS ZFS MTM_RDONLY = 0x80000000 MTM_RDWR = 0x40000000 MTM_UMOUNT = 0x10000000 @@ -205,13 +285,20 @@ const ( MTM_REMOUNT = 0x00000100 MTM_NOSECURITY = 0x00000080 NFDBITS = 0x20 + ONLRET = 0x0020 // NL performs CR function O_ACCMODE = 0x03 O_APPEND = 0x08 O_ASYNCSIG = 0x0200 O_CREAT = 0x80 + O_DIRECT = 0x00002000 + O_NOFOLLOW = 0x00004000 + O_DIRECTORY = 0x00008000 + O_PATH = 0x00080000 + O_CLOEXEC = 0x00001000 O_EXCL = 0x40 O_GETFL = 0x0F O_LARGEFILE = 0x0400 + O_NDELAY = 0x4 O_NONBLOCK = 0x04 O_RDONLY = 0x02 O_RDWR = 0x03 @@ -248,6 +335,7 @@ const ( AF_IUCV = 17 AF_LAT = 14 AF_LINK = 18 + AF_LOCAL = AF_UNIX // AF_LOCAL is an alias for AF_UNIX AF_MAX = 30 AF_NBS = 7 AF_NDD = 23 @@ -285,15 +373,33 @@ const ( RLIMIT_AS = 5 RLIMIT_NOFILE = 6 RLIMIT_MEMLIMIT = 7 + RLIMIT_MEMLOCK = 0x8 RLIM_INFINITY = 2147483647 + SCHED_FIFO = 0x2 + SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x01 SF_CLOSE = 0x00000002 SF_REUSE = 0x00000001 + SHM_RND = 0x2 + SHM_RDONLY = 0x1 + SHMLBA = 0x1000 + IPC_STAT = 0x3 + IPC_SET = 0x2 + IPC_RMID = 0x1 + IPC_PRIVATE = 0x0 + IPC_CREAT = 0x1000000 + __IPC_MEGA = 0x4000000 + __IPC_SHAREAS = 0x20000000 + __IPC_BELOWBAR = 0x10000000 + IPC_EXCL = 0x2000000 + __IPC_GIGA = 0x8000000 SHUT_RD = 0 SHUT_RDWR = 2 SHUT_WR = 1 + SOCK_CLOEXEC = 0x00001000 SOCK_CONN_DGRAM = 6 SOCK_DGRAM = 2 + SOCK_NONBLOCK = 0x800 SOCK_RAW = 3 SOCK_RDM = 4 SOCK_SEQPACKET = 5 @@ -378,8 +484,6 @@ const ( S_IFMST = 0x00FF0000 TCP_KEEPALIVE = 0x8 TCP_NODELAY = 0x1 - TCP_INFO = 0xb - TCP_USER_TIMEOUT = 0x1 TIOCGWINSZ = 0x4008a368 TIOCSWINSZ = 0x8008a367 TIOCSBRK = 0x2000a77b @@ -427,7 +531,10 @@ const ( VSUSP = 9 VTIME = 10 WCONTINUED = 0x4 + WEXITED = 0x8 WNOHANG = 0x1 + WNOWAIT = 0x20 + WSTOPPED = 0x10 WUNTRACED = 0x2 _BPX_SWAP = 1 _BPX_NONSWAP = 2 @@ -452,8 +559,28 @@ const ( MADV_FREE = 15 // for Linux compatibility -- no zos semantics MADV_WIPEONFORK = 16 // for Linux compatibility -- no zos semantics MADV_KEEPONFORK = 17 // for Linux compatibility -- no zos semantics - AT_SYMLINK_NOFOLLOW = 1 // for Unix compatibility -- no zos semantics - AT_FDCWD = 2 // for Unix compatibility -- no zos semantics + AT_SYMLINK_FOLLOW = 0x400 + AT_SYMLINK_NOFOLLOW = 0x100 + XATTR_CREATE = 0x1 + XATTR_REPLACE = 0x2 + P_PID = 0 + P_PGID = 1 + P_ALL = 2 + PR_SET_NAME = 15 + PR_GET_NAME = 16 + PR_SET_NO_NEW_PRIVS = 38 + PR_GET_NO_NEW_PRIVS = 39 + PR_SET_DUMPABLE = 4 + PR_GET_DUMPABLE = 3 + PR_SET_PDEATHSIG = 1 + PR_GET_PDEATHSIG = 2 + PR_SET_CHILD_SUBREAPER = 36 + PR_GET_CHILD_SUBREAPER = 37 + AT_FDCWD = -100 + AT_EACCESS = 0x200 + AT_EMPTY_PATH = 0x1000 + AT_REMOVEDIR = 0x200 + RENAME_NOREPLACE = 1 << 0 ) const ( @@ -476,6 +603,7 @@ const ( EMLINK = Errno(125) ENAMETOOLONG = Errno(126) ENFILE = Errno(127) + ENOATTR = Errno(265) ENODEV = Errno(128) ENOENT = Errno(129) ENOEXEC = Errno(130) @@ -700,7 +828,7 @@ var errorList = [...]struct { {145, "EDC5145I", "The parameter list is too long, or the message to receive was too large for the buffer."}, {146, "EDC5146I", "Too many levels of symbolic links."}, {147, "EDC5147I", "Illegal byte sequence."}, - {148, "", ""}, + {148, "EDC5148I", "The named attribute or data not available."}, {149, "EDC5149I", "Value Overflow Error."}, {150, "EDC5150I", "UNIX System Services is not active."}, {151, "EDC5151I", "Dynamic allocation error."}, @@ -743,6 +871,7 @@ var errorList = [...]struct { {259, "EDC5259I", "A CUN_RS_NO_CONVERSION error was issued by Unicode Services."}, {260, "EDC5260I", "A CUN_RS_TABLE_NOT_ALIGNED error was issued by Unicode Services."}, {262, "EDC5262I", "An iconv() function encountered an unexpected error while using Unicode Services."}, + {265, "EDC5265I", "The named attribute not available."}, {1000, "EDC8000I", "A bad socket-call constant was found in the IUCV header."}, {1001, "EDC8001I", "An error was found in the IUCV header."}, {1002, "EDC8002I", "A socket descriptor is out of range."}, diff --git a/vendor/golang.org/x/sys/unix/zsymaddr_zos_s390x.s b/vendor/golang.org/x/sys/unix/zsymaddr_zos_s390x.s new file mode 100644 index 0000000..b77ff5d --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsymaddr_zos_s390x.s @@ -0,0 +1,364 @@ +// go run mksyscall_zos_s390x.go -o_sysnum zsysnum_zos_s390x.go -o_syscall zsyscall_zos_s390x.go -i_syscall syscall_zos_s390x.go -o_asm zsymaddr_zos_s390x.s +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build zos && s390x +#include "textflag.h" + +// provide the address of function variable to be fixed up. + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FlistxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Flistxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FremovexattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fremovexattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FgetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fgetxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FsetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fsetxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_accept4Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·accept4(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_RemovexattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Removexattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_Dup3Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Dup3(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_DirfdAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Dirfd(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EpollCreateAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·EpollCreate(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EpollCreate1Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·EpollCreate1(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EpollCtlAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·EpollCtl(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EpollPwaitAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·EpollPwait(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EpollWaitAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·EpollWait(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_EventfdAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Eventfd(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FaccessatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Faccessat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FchmodatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fchmodat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FchownatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fchownat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FdatasyncAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fdatasync(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_fstatatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·fstatat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LgetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Lgetxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LsetxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Lsetxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FstatfsAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Fstatfs(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FutimesAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Futimes(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_FutimesatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Futimesat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_GetrandomAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Getrandom(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_InotifyInitAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·InotifyInit(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_InotifyInit1Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·InotifyInit1(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_InotifyAddWatchAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·InotifyAddWatch(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_InotifyRmWatchAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·InotifyRmWatch(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_ListxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Listxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LlistxattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Llistxattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LremovexattrAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Lremovexattr(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LutimesAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Lutimes(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_StatfsAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Statfs(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_SyncfsAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Syncfs(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_UnshareAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Unshare(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_LinkatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Linkat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_MkdiratAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Mkdirat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_MknodatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Mknodat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_PivotRootAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·PivotRoot(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_PrctlAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Prctl(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_PrlimitAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Prlimit(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_RenameatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Renameat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_Renameat2Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Renameat2(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_SethostnameAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Sethostname(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_SetnsAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Setns(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_SymlinkatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Symlinkat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_UnlinkatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·Unlinkat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_openatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·openat(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_openat2Addr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·openat2(SB), R8 + MOVD R8, ret+0(FP) + RET + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +TEXT Β·get_utimensatAddr(SB), NOSPLIT|NOFRAME, $0-8 + MOVD $Β·utimensat(SB), R8 + MOVD R8, ret+0(FP) + RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index 94f0112..7ccf66b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags zos,s390x syscall_zos_s390x.go +// go run mksyscall_zos_s390x.go -o_sysnum zsysnum_zos_s390x.go -o_syscall zsyscall_zos_s390x.go -i_syscall syscall_zos_s390x.go -o_asm zsymaddr_zos_s390x.s // Code generated by the command above; see README.md. DO NOT EDIT. //go:build zos && s390x @@ -6,17 +6,100 @@ package unix import ( + "runtime" + "syscall" "unsafe" ) +var _ syscall.Errno + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func fcntl(fd int, cmd int, arg int) (val int, err error) { - r0, _, e1 := syscall_syscall(SYS_FCNTL, uintptr(fd), uintptr(cmd), uintptr(arg)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCNTL<<4, uintptr(fd), uintptr(cmd), uintptr(arg)) + runtime.ExitSyscall() val = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Flistxattr(fd int, dest []byte) (sz int, err error) { + var _p0 unsafe.Pointer + if len(dest) > 0 { + _p0 = unsafe.Pointer(&dest[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FLISTXATTR_A<<4, uintptr(fd), uintptr(_p0), uintptr(len(dest))) + runtime.ExitSyscall() + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FlistxattrAddr() *(func(fd int, dest []byte) (sz int, err error)) + +var Flistxattr = enter_Flistxattr + +func enter_Flistxattr(fd int, dest []byte) (sz int, err error) { + funcref := get_FlistxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___FLISTXATTR_A<<4, "") == 0 { + *funcref = impl_Flistxattr + } else { + *funcref = error_Flistxattr + } + return (*funcref)(fd, dest) +} + +func error_Flistxattr(fd int, dest []byte) (sz int, err error) { + sz = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Fremovexattr(fd int, attr string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attr) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FREMOVEXATTR_A<<4, uintptr(fd), uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FremovexattrAddr() *(func(fd int, attr string) (err error)) + +var Fremovexattr = enter_Fremovexattr + +func enter_Fremovexattr(fd int, attr string) (err error) { + funcref := get_FremovexattrAddr() + if funcptrtest(GetZosLibVec()+SYS___FREMOVEXATTR_A<<4, "") == 0 { + *funcref = impl_Fremovexattr + } else { + *funcref = error_Fremovexattr } + return (*funcref)(fd, attr) +} + +func error_Fremovexattr(fd int, attr string) (err error) { + err = ENOSYS return } @@ -29,10 +112,12 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_READ<<4, uintptr(fd), uintptr(_p0), uintptr(len(p))) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -46,31 +131,159 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := syscall_syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_WRITE<<4, uintptr(fd), uintptr(_p0), uintptr(len(p))) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Fgetxattr(fd int, attr string, dest []byte) (sz int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(dest) > 0 { + _p1 = unsafe.Pointer(&dest[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FGETXATTR_A<<4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(dest))) + runtime.ExitSyscall() + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FgetxattrAddr() *(func(fd int, attr string, dest []byte) (sz int, err error)) + +var Fgetxattr = enter_Fgetxattr + +func enter_Fgetxattr(fd int, attr string, dest []byte) (sz int, err error) { + funcref := get_FgetxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___FGETXATTR_A<<4, "") == 0 { + *funcref = impl_Fgetxattr + } else { + *funcref = error_Fgetxattr + } + return (*funcref)(fd, attr, dest) +} + +func error_Fgetxattr(fd int, attr string, dest []byte) (sz int, err error) { + sz = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Fsetxattr(fd int, attr string, data []byte, flag int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(data) > 0 { + _p1 = unsafe.Pointer(&data[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FSETXATTR_A<<4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(data)), uintptr(flag)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FsetxattrAddr() *(func(fd int, attr string, data []byte, flag int) (err error)) + +var Fsetxattr = enter_Fsetxattr + +func enter_Fsetxattr(fd int, attr string, data []byte, flag int) (err error) { + funcref := get_FsetxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___FSETXATTR_A<<4, "") == 0 { + *funcref = impl_Fsetxattr + } else { + *funcref = error_Fsetxattr } + return (*funcref)(fd, attr, data, flag) +} + +func error_Fsetxattr(fd int, attr string, data []byte, flag int) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := syscall_syscall(SYS___ACCEPT_A, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___ACCEPT_A<<4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___ACCEPT4_A<<4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags)) + runtime.ExitSyscall() fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_accept4Addr() *(func(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error)) + +var accept4 = enter_accept4 + +func enter_accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { + funcref := get_accept4Addr() + if funcptrtest(GetZosLibVec()+SYS___ACCEPT4_A<<4, "") == 0 { + *funcref = impl_accept4 + } else { + *funcref = error_accept4 } + return (*funcref)(s, rsa, addrlen, flags) +} + +func error_accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { + fd = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := syscall_syscall(SYS___BIND_A, uintptr(s), uintptr(addr), uintptr(addrlen)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___BIND_A<<4, uintptr(s), uintptr(addr), uintptr(addrlen)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -78,9 +291,11 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := syscall_syscall(SYS___CONNECT_A, uintptr(s), uintptr(addr), uintptr(addrlen)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CONNECT_A<<4, uintptr(s), uintptr(addr), uintptr(addrlen)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -88,10 +303,10 @@ func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(n int, list *_Gid_t) (nn int, err error) { - r0, _, e1 := syscall_rawsyscall(SYS_GETGROUPS, uintptr(n), uintptr(unsafe.Pointer(list)), 0) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETGROUPS<<4, uintptr(n), uintptr(unsafe.Pointer(list))) nn = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -99,9 +314,9 @@ func getgroups(n int, list *_Gid_t) (nn int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(n int, list *_Gid_t) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_SETGROUPS, uintptr(n), uintptr(unsafe.Pointer(list)), 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETGROUPS<<4, uintptr(n), uintptr(unsafe.Pointer(list))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -109,9 +324,11 @@ func setgroups(n int, list *_Gid_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := syscall_syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETSOCKOPT<<4, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -119,9 +336,11 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := syscall_syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETSOCKOPT<<4, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -129,10 +348,10 @@ func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := syscall_rawsyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SOCKET<<4, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -140,9 +359,9 @@ func socket(domain int, typ int, proto int) (fd int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := syscall_rawsyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SOCKETPAIR<<4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -150,9 +369,9 @@ func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := syscall_rawsyscall(SYS___GETPEERNAME_A, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___GETPEERNAME_A<<4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -160,10 +379,52 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := syscall_rawsyscall(SYS___GETSOCKNAME_A, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___GETSOCKNAME_A<<4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Removexattr(path string, attr string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___REMOVEXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_RemovexattrAddr() *(func(path string, attr string) (err error)) + +var Removexattr = enter_Removexattr + +func enter_Removexattr(path string, attr string) (err error) { + funcref := get_RemovexattrAddr() + if funcptrtest(GetZosLibVec()+SYS___REMOVEXATTR_A<<4, "") == 0 { + *funcref = impl_Removexattr + } else { + *funcref = error_Removexattr } + return (*funcref)(path, attr) +} + +func error_Removexattr(path string, attr string) (err error) { + err = ENOSYS return } @@ -176,10 +437,12 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := syscall_syscall6(SYS___RECVFROM_A, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RECVFROM_A<<4, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -193,9 +456,11 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := syscall_syscall6(SYS___SENDTO_A, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SENDTO_A<<4, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -203,10 +468,12 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS___RECVMSG_A, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RECVMSG_A<<4, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -214,10 +481,12 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS___SENDMSG_A, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SENDMSG_A<<4, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -225,10 +494,12 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := syscall_syscall6(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_MMAP<<4, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + runtime.ExitSyscall() ret = uintptr(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -236,9 +507,11 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := syscall_syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_MUNMAP<<4, uintptr(addr), uintptr(length)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -246,9 +519,11 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req int, arg uintptr) (err error) { - _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_IOCTL<<4, uintptr(fd), uintptr(req), uintptr(arg)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -256,9 +531,62 @@ func ioctl(fd int, req int, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_IOCTL<<4, uintptr(fd), uintptr(req), uintptr(arg)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func shmat(id int, addr uintptr, flag int) (ret uintptr, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SHMAT<<4, uintptr(id), uintptr(addr), uintptr(flag)) + runtime.ExitSyscall() + ret = uintptr(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func shmctl(id int, cmd int, buf *SysvShmDesc) (result int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SHMCTL64<<4, uintptr(id), uintptr(cmd), uintptr(unsafe.Pointer(buf))) + runtime.ExitSyscall() + result = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func shmdt(addr uintptr) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SHMDT<<4, uintptr(addr)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func shmget(key int, size int, flag int) (id int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SHMGET<<4, uintptr(key), uintptr(size), uintptr(flag)) + runtime.ExitSyscall() + id = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -271,9 +599,11 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___ACCESS_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___ACCESS_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -286,9 +616,11 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___CHDIR_A, uintptr(unsafe.Pointer(_p0)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CHDIR_A<<4, uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -301,9 +633,11 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___CHOWN_A, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CHOWN_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -316,9 +650,11 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___CHMOD_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CHMOD_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -331,10 +667,12 @@ func Creat(path string, mode uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := syscall_syscall(SYS___CREAT_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CREAT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -342,10 +680,12 @@ func Creat(path string, mode uint32) (fd int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(oldfd int) (fd int, err error) { - r0, _, e1 := syscall_syscall(SYS_DUP, uintptr(oldfd), 0, 0) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_DUP<<4, uintptr(oldfd)) + runtime.ExitSyscall() fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -353,617 +693,2216 @@ func Dup(oldfd int) (fd int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(oldfd int, newfd int) (err error) { - _, _, e1 := syscall_syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_DUP2<<4, uintptr(oldfd), uintptr(newfd)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Errno2() (er2 int) { - uer2, _, _ := syscall_syscall(SYS___ERRNO2, 0, 0, 0) - er2 = int(uer2) +func impl_Dup3(oldfd int, newfd int, flags int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_DUP3<<4, uintptr(oldfd), uintptr(newfd), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_Dup3Addr() *(func(oldfd int, newfd int, flags int) (err error)) -func Err2ad() (eadd *int) { - ueadd, _, _ := syscall_syscall(SYS___ERR2AD, 0, 0, 0) - eadd = (*int)(unsafe.Pointer(ueadd)) - return -} +var Dup3 = enter_Dup3 -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func enter_Dup3(oldfd int, newfd int, flags int) (err error) { + funcref := get_Dup3Addr() + if funcptrtest(GetZosLibVec()+SYS_DUP3<<4, "") == 0 { + *funcref = impl_Dup3 + } else { + *funcref = error_Dup3 + } + return (*funcref)(oldfd, newfd, flags) +} -func Exit(code int) { - syscall_syscall(SYS_EXIT, uintptr(code), 0, 0) +func error_Dup3(oldfd int, newfd int, flags int) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Fchdir(fd int) (err error) { - _, _, e1 := syscall_syscall(SYS_FCHDIR, uintptr(fd), 0, 0) - if e1 != 0 { - err = errnoErr(e1) +func impl_Dirfd(dirp uintptr) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_DIRFD<<4, uintptr(dirp)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_DirfdAddr() *(func(dirp uintptr) (fd int, err error)) -func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := syscall_syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) - if e1 != 0 { - err = errnoErr(e1) +var Dirfd = enter_Dirfd + +func enter_Dirfd(dirp uintptr) (fd int, err error) { + funcref := get_DirfdAddr() + if funcptrtest(GetZosLibVec()+SYS_DIRFD<<4, "") == 0 { + *funcref = impl_Dirfd + } else { + *funcref = error_Dirfd } + return (*funcref)(dirp) +} + +func error_Dirfd(dirp uintptr) (fd int, err error) { + fd = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := syscall_syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) - if e1 != 0 { - err = errnoErr(e1) +func impl_EpollCreate(size int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EPOLL_CREATE<<4, uintptr(size)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_EpollCreateAddr() *(func(size int) (fd int, err error)) -func FcntlInt(fd uintptr, cmd int, arg int) (retval int, err error) { - r0, _, e1 := syscall_syscall(SYS_FCNTL, uintptr(fd), uintptr(cmd), uintptr(arg)) - retval = int(r0) - if e1 != 0 { - err = errnoErr(e1) +var EpollCreate = enter_EpollCreate + +func enter_EpollCreate(size int) (fd int, err error) { + funcref := get_EpollCreateAddr() + if funcptrtest(GetZosLibVec()+SYS_EPOLL_CREATE<<4, "") == 0 { + *funcref = impl_EpollCreate + } else { + *funcref = error_EpollCreate } + return (*funcref)(size) +} + +func error_EpollCreate(size int) (fd int, err error) { + fd = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat(fd int, stat *Stat_LE_t) (err error) { - _, _, e1 := syscall_syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) +func impl_EpollCreate1(flags int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EPOLL_CREATE1<<4, uintptr(flags)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_EpollCreate1Addr() *(func(flags int) (fd int, err error)) -func Fstatvfs(fd int, stat *Statvfs_t) (err error) { - _, _, e1 := syscall_syscall(SYS_FSTATVFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) +var EpollCreate1 = enter_EpollCreate1 + +func enter_EpollCreate1(flags int) (fd int, err error) { + funcref := get_EpollCreate1Addr() + if funcptrtest(GetZosLibVec()+SYS_EPOLL_CREATE1<<4, "") == 0 { + *funcref = impl_EpollCreate1 + } else { + *funcref = error_EpollCreate1 } + return (*funcref)(flags) +} + +func error_EpollCreate1(flags int) (fd int, err error) { + fd = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Fsync(fd int) (err error) { - _, _, e1 := syscall_syscall(SYS_FSYNC, uintptr(fd), 0, 0) - if e1 != 0 { - err = errnoErr(e1) +func impl_EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EPOLL_CTL<<4, uintptr(epfd), uintptr(op), uintptr(fd), uintptr(unsafe.Pointer(event))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_EpollCtlAddr() *(func(epfd int, op int, fd int, event *EpollEvent) (err error)) -func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := syscall_syscall(SYS_FTRUNCATE, uintptr(fd), uintptr(length), 0) - if e1 != 0 { - err = errnoErr(e1) +var EpollCtl = enter_EpollCtl + +func enter_EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) { + funcref := get_EpollCtlAddr() + if funcptrtest(GetZosLibVec()+SYS_EPOLL_CTL<<4, "") == 0 { + *funcref = impl_EpollCtl + } else { + *funcref = error_EpollCtl } - return + return (*funcref)(epfd, op, fd, event) } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Getpagesize() (pgsize int) { - r0, _, _ := syscall_syscall(SYS_GETPAGESIZE, 0, 0, 0) - pgsize = int(r0) +func error_EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Mprotect(b []byte, prot int) (err error) { +func impl_EpollPwait(epfd int, events []EpollEvent, msec int, sigmask *int) (n int, err error) { var _p0 unsafe.Pointer - if len(b) > 0 { - _p0 = unsafe.Pointer(&b[0]) + if len(events) > 0 { + _p0 = unsafe.Pointer(&events[0]) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := syscall_syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EPOLL_PWAIT<<4, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), uintptr(unsafe.Pointer(sigmask))) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_EpollPwaitAddr() *(func(epfd int, events []EpollEvent, msec int, sigmask *int) (n int, err error)) -func Msync(b []byte, flags int) (err error) { - var _p0 unsafe.Pointer - if len(b) > 0 { - _p0 = unsafe.Pointer(&b[0]) +var EpollPwait = enter_EpollPwait + +func enter_EpollPwait(epfd int, events []EpollEvent, msec int, sigmask *int) (n int, err error) { + funcref := get_EpollPwaitAddr() + if funcptrtest(GetZosLibVec()+SYS_EPOLL_PWAIT<<4, "") == 0 { + *funcref = impl_EpollPwait } else { - _p0 = unsafe.Pointer(&_zero) - } - _, _, e1 := syscall_syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) - if e1 != 0 { - err = errnoErr(e1) + *funcref = error_EpollPwait } + return (*funcref)(epfd, events, msec, sigmask) +} + +func error_EpollPwait(epfd int, events []EpollEvent, msec int, sigmask *int) (n int, err error) { + n = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Poll(fds []PollFd, timeout int) (n int, err error) { +func impl_EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { var _p0 unsafe.Pointer - if len(fds) > 0 { - _p0 = unsafe.Pointer(&fds[0]) + if len(events) > 0 { + _p0 = unsafe.Pointer(&events[0]) } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := syscall_syscall(SYS_POLL, uintptr(_p0), uintptr(len(fds)), uintptr(timeout)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EPOLL_WAIT<<4, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec)) + runtime.ExitSyscall() n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_EpollWaitAddr() *(func(epfd int, events []EpollEvent, msec int) (n int, err error)) -func Times(tms *Tms) (ticks uintptr, err error) { - r0, _, e1 := syscall_syscall(SYS_TIMES, uintptr(unsafe.Pointer(tms)), 0, 0) - ticks = uintptr(r0) - if e1 != 0 { - err = errnoErr(e1) +var EpollWait = enter_EpollWait + +func enter_EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { + funcref := get_EpollWaitAddr() + if funcptrtest(GetZosLibVec()+SYS_EPOLL_WAIT<<4, "") == 0 { + *funcref = impl_EpollWait + } else { + *funcref = error_EpollWait } + return (*funcref)(epfd, events, msec) +} + +func error_EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { + n = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func W_Getmntent(buff *byte, size int) (lastsys int, err error) { - r0, _, e1 := syscall_syscall(SYS_W_GETMNTENT, uintptr(unsafe.Pointer(buff)), uintptr(size), 0) - lastsys = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } +func Errno2() (er2 int) { + runtime.EnterSyscall() + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS___ERRNO2<<4) + runtime.ExitSyscall() + er2 = int(r0) return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func W_Getmntent_A(buff *byte, size int) (lastsys int, err error) { - r0, _, e1 := syscall_syscall(SYS___W_GETMNTENT_A, uintptr(unsafe.Pointer(buff)), uintptr(size), 0) - lastsys = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func impl_Eventfd(initval uint, flags int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_EVENTFD<<4, uintptr(initval), uintptr(flags)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } +//go:nosplit +func get_EventfdAddr() *(func(initval uint, flags int) (fd int, err error)) + +var Eventfd = enter_Eventfd + +func enter_Eventfd(initval uint, flags int) (fd int, err error) { + funcref := get_EventfdAddr() + if funcptrtest(GetZosLibVec()+SYS_EVENTFD<<4, "") == 0 { + *funcref = impl_Eventfd + } else { + *funcref = error_Eventfd + } + return (*funcref)(initval, flags) +} + +func error_Eventfd(initval uint, flags int) (fd int, err error) { + fd = -1 + err = ENOSYS + return +} + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mount_LE(path string, filesystem string, fstype string, mtm uint32, parmlen int32, parm string) (err error) { +func Exit(code int) { + runtime.EnterSyscall() + CallLeFuncWithErr(GetZosLibVec()+SYS_EXIT<<4, uintptr(code)) + runtime.ExitSyscall() + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { return } - var _p1 *byte - _p1, err = BytePtrFromString(filesystem) - if err != nil { - return - } - var _p2 *byte - _p2, err = BytePtrFromString(fstype) - if err != nil { - return - } - var _p3 *byte - _p3, err = BytePtrFromString(parm) - if err != nil { - return - } - _, _, e1 := syscall_syscall6(SYS___MOUNT_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(unsafe.Pointer(_p2)), uintptr(mtm), uintptr(parmlen), uintptr(unsafe.Pointer(_p3))) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FACCESSAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_FaccessatAddr() *(func(dirfd int, path string, mode uint32, flags int) (err error)) -func unmount(filesystem string, mtm int) (err error) { +var Faccessat = enter_Faccessat + +func enter_Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + funcref := get_FaccessatAddr() + if funcptrtest(GetZosLibVec()+SYS___FACCESSAT_A<<4, "") == 0 { + *funcref = impl_Faccessat + } else { + *funcref = error_Faccessat + } + return (*funcref)(dirfd, path, mode, flags) +} + +func error_Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCHDIR<<4, uintptr(fd)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCHMOD<<4, uintptr(fd), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { var _p0 *byte - _p0, err = BytePtrFromString(filesystem) + _p0, err = BytePtrFromString(path) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___UMOUNT_A, uintptr(unsafe.Pointer(_p0)), uintptr(mtm), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FCHMODAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FchmodatAddr() *(func(dirfd int, path string, mode uint32, flags int) (err error)) + +var Fchmodat = enter_Fchmodat + +func enter_Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + funcref := get_FchmodatAddr() + if funcptrtest(GetZosLibVec()+SYS___FCHMODAT_A<<4, "") == 0 { + *funcref = impl_Fchmodat + } else { + *funcref = error_Fchmodat + } + return (*funcref)(dirfd, path, mode, flags) +} + +func error_Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCHOWN<<4, uintptr(fd), uintptr(uid), uintptr(gid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Chroot(path string) (err error) { +func impl_Fchownat(fd int, path string, uid int, gid int, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___CHROOT_A, uintptr(unsafe.Pointer(_p0)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FCHOWNAT_A<<4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FchownatAddr() *(func(fd int, path string, uid int, gid int, flags int) (err error)) + +var Fchownat = enter_Fchownat + +func enter_Fchownat(fd int, path string, uid int, gid int, flags int) (err error) { + funcref := get_FchownatAddr() + if funcptrtest(GetZosLibVec()+SYS___FCHOWNAT_A<<4, "") == 0 { + *funcref = impl_Fchownat + } else { + *funcref = error_Fchownat } + return (*funcref)(fd, path, uid, gid, flags) +} + +func error_Fchownat(fd int, path string, uid int, gid int, flags int) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Uname(buf *Utsname) (err error) { - _, _, e1 := syscall_rawsyscall(SYS___UNAME_A, uintptr(unsafe.Pointer(buf)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) +func FcntlInt(fd uintptr, cmd int, arg int) (retval int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FCNTL<<4, uintptr(fd), uintptr(cmd), uintptr(arg)) + runtime.ExitSyscall() + retval = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Gethostname(buf []byte) (err error) { +func impl_Fdatasync(fd int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FDATASYNC<<4, uintptr(fd)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FdatasyncAddr() *(func(fd int) (err error)) + +var Fdatasync = enter_Fdatasync + +func enter_Fdatasync(fd int) (err error) { + funcref := get_FdatasyncAddr() + if funcptrtest(GetZosLibVec()+SYS_FDATASYNC<<4, "") == 0 { + *funcref = impl_Fdatasync + } else { + *funcref = error_Fdatasync + } + return (*funcref)(fd) +} + +func error_Fdatasync(fd int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fstat(fd int, stat *Stat_LE_t) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FSTAT<<4, uintptr(fd), uintptr(unsafe.Pointer(stat))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_fstatat(dirfd int, path string, stat *Stat_LE_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FSTATAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_fstatatAddr() *(func(dirfd int, path string, stat *Stat_LE_t, flags int) (err error)) + +var fstatat = enter_fstatat + +func enter_fstatat(dirfd int, path string, stat *Stat_LE_t, flags int) (err error) { + funcref := get_fstatatAddr() + if funcptrtest(GetZosLibVec()+SYS___FSTATAT_A<<4, "") == 0 { + *funcref = impl_fstatat + } else { + *funcref = error_fstatat + } + return (*funcref)(dirfd, path, stat, flags) +} + +func error_fstatat(dirfd int, path string, stat *Stat_LE_t, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Lgetxattr(link string, attr string, dest []byte) (sz int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(link) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p2 unsafe.Pointer + if len(dest) > 0 { + _p2 = unsafe.Pointer(&dest[0]) + } else { + _p2 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LGETXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(_p2), uintptr(len(dest))) + runtime.ExitSyscall() + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LgetxattrAddr() *(func(link string, attr string, dest []byte) (sz int, err error)) + +var Lgetxattr = enter_Lgetxattr + +func enter_Lgetxattr(link string, attr string, dest []byte) (sz int, err error) { + funcref := get_LgetxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___LGETXATTR_A<<4, "") == 0 { + *funcref = impl_Lgetxattr + } else { + *funcref = error_Lgetxattr + } + return (*funcref)(link, attr, dest) +} + +func error_Lgetxattr(link string, attr string, dest []byte) (sz int, err error) { + sz = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Lsetxattr(path string, attr string, data []byte, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + var _p2 unsafe.Pointer + if len(data) > 0 { + _p2 = unsafe.Pointer(&data[0]) + } else { + _p2 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LSETXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(_p2), uintptr(len(data)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LsetxattrAddr() *(func(path string, attr string, data []byte, flags int) (err error)) + +var Lsetxattr = enter_Lsetxattr + +func enter_Lsetxattr(path string, attr string, data []byte, flags int) (err error) { + funcref := get_LsetxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___LSETXATTR_A<<4, "") == 0 { + *funcref = impl_Lsetxattr + } else { + *funcref = error_Lsetxattr + } + return (*funcref)(path, attr, data, flags) +} + +func error_Lsetxattr(path string, attr string, data []byte, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Fstatfs(fd int, buf *Statfs_t) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FSTATFS<<4, uintptr(fd), uintptr(unsafe.Pointer(buf))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FstatfsAddr() *(func(fd int, buf *Statfs_t) (err error)) + +var Fstatfs = enter_Fstatfs + +func enter_Fstatfs(fd int, buf *Statfs_t) (err error) { + funcref := get_FstatfsAddr() + if funcptrtest(GetZosLibVec()+SYS_FSTATFS<<4, "") == 0 { + *funcref = impl_Fstatfs + } else { + *funcref = error_Fstatfs + } + return (*funcref)(fd, buf) +} + +func error_Fstatfs(fd int, buf *Statfs_t) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatvfs(fd int, stat *Statvfs_t) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FSTATVFS<<4, uintptr(fd), uintptr(unsafe.Pointer(stat))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FSYNC<<4, uintptr(fd)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Futimes(fd int, tv []Timeval) (err error) { var _p0 unsafe.Pointer - if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) + if len(tv) > 0 { + _p0 = unsafe.Pointer(&tv[0]) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := syscall_syscall(SYS___GETHOSTNAME_A, uintptr(_p0), uintptr(len(buf)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FUTIMES<<4, uintptr(fd), uintptr(_p0), uintptr(len(tv))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_FutimesAddr() *(func(fd int, tv []Timeval) (err error)) -func Getegid() (egid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETEGID, 0, 0, 0) - egid = int(r0) +var Futimes = enter_Futimes + +func enter_Futimes(fd int, tv []Timeval) (err error) { + funcref := get_FutimesAddr() + if funcptrtest(GetZosLibVec()+SYS_FUTIMES<<4, "") == 0 { + *funcref = impl_Futimes + } else { + *funcref = error_Futimes + } + return (*funcref)(fd, tv) +} + +func error_Futimes(fd int, tv []Timeval) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Geteuid() (uid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETEUID, 0, 0, 0) - uid = int(r0) +func impl_Futimesat(dirfd int, path string, tv []Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(tv) > 0 { + _p1 = unsafe.Pointer(&tv[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___FUTIMESAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(tv))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_FutimesatAddr() *(func(dirfd int, path string, tv []Timeval) (err error)) + +var Futimesat = enter_Futimesat + +func enter_Futimesat(dirfd int, path string, tv []Timeval) (err error) { + funcref := get_FutimesatAddr() + if funcptrtest(GetZosLibVec()+SYS___FUTIMESAT_A<<4, "") == 0 { + *funcref = impl_Futimesat + } else { + *funcref = error_Futimesat + } + return (*funcref)(dirfd, path, tv) +} + +func error_Futimesat(dirfd int, path string, tv []Timeval) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getgid() (gid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETGID, 0, 0, 0) - gid = int(r0) +func Ftruncate(fd int, length int64) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_FTRUNCATE<<4, uintptr(fd), uintptr(length)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getpid() (pid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETPID, 0, 0, 0) - pid = int(r0) +func impl_Getrandom(buf []byte, flags int) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETRANDOM<<4, uintptr(_p0), uintptr(len(buf)), uintptr(flags)) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_GetrandomAddr() *(func(buf []byte, flags int) (n int, err error)) + +var Getrandom = enter_Getrandom + +func enter_Getrandom(buf []byte, flags int) (n int, err error) { + funcref := get_GetrandomAddr() + if funcptrtest(GetZosLibVec()+SYS_GETRANDOM<<4, "") == 0 { + *funcref = impl_Getrandom + } else { + *funcref = error_Getrandom + } + return (*funcref)(buf, flags) +} + +func error_Getrandom(buf []byte, flags int) (n int, err error) { + n = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := syscall_rawsyscall(SYS_GETPGID, uintptr(pid), 0, 0) - pgid = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func impl_InotifyInit() (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec() + SYS_INOTIFY_INIT<<4) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_InotifyInitAddr() *(func() (fd int, err error)) + +var InotifyInit = enter_InotifyInit + +func enter_InotifyInit() (fd int, err error) { + funcref := get_InotifyInitAddr() + if funcptrtest(GetZosLibVec()+SYS_INOTIFY_INIT<<4, "") == 0 { + *funcref = impl_InotifyInit + } else { + *funcref = error_InotifyInit } + return (*funcref)() +} + +func error_InotifyInit() (fd int, err error) { + fd = -1 + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getppid() (pid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETPPID, 0, 0, 0) - pid = int(r0) +func impl_InotifyInit1(flags int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_INOTIFY_INIT1<<4, uintptr(flags)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_InotifyInit1Addr() *(func(flags int) (fd int, err error)) + +var InotifyInit1 = enter_InotifyInit1 + +func enter_InotifyInit1(flags int) (fd int, err error) { + funcref := get_InotifyInit1Addr() + if funcptrtest(GetZosLibVec()+SYS_INOTIFY_INIT1<<4, "") == 0 { + *funcref = impl_InotifyInit1 + } else { + *funcref = error_InotifyInit1 + } + return (*funcref)(flags) +} + +func error_InotifyInit1(flags int) (fd int, err error) { + fd = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_InotifyAddWatch(fd int, pathname string, mask uint32) (watchdesc int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(pathname) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___INOTIFY_ADD_WATCH_A<<4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mask)) + runtime.ExitSyscall() + watchdesc = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_InotifyAddWatchAddr() *(func(fd int, pathname string, mask uint32) (watchdesc int, err error)) + +var InotifyAddWatch = enter_InotifyAddWatch + +func enter_InotifyAddWatch(fd int, pathname string, mask uint32) (watchdesc int, err error) { + funcref := get_InotifyAddWatchAddr() + if funcptrtest(GetZosLibVec()+SYS___INOTIFY_ADD_WATCH_A<<4, "") == 0 { + *funcref = impl_InotifyAddWatch + } else { + *funcref = error_InotifyAddWatch + } + return (*funcref)(fd, pathname, mask) +} + +func error_InotifyAddWatch(fd int, pathname string, mask uint32) (watchdesc int, err error) { + watchdesc = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_InotifyRmWatch(fd int, watchdesc uint32) (success int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_INOTIFY_RM_WATCH<<4, uintptr(fd), uintptr(watchdesc)) + runtime.ExitSyscall() + success = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_InotifyRmWatchAddr() *(func(fd int, watchdesc uint32) (success int, err error)) + +var InotifyRmWatch = enter_InotifyRmWatch + +func enter_InotifyRmWatch(fd int, watchdesc uint32) (success int, err error) { + funcref := get_InotifyRmWatchAddr() + if funcptrtest(GetZosLibVec()+SYS_INOTIFY_RM_WATCH<<4, "") == 0 { + *funcref = impl_InotifyRmWatch + } else { + *funcref = error_InotifyRmWatch + } + return (*funcref)(fd, watchdesc) +} + +func error_InotifyRmWatch(fd int, watchdesc uint32) (success int, err error) { + success = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Listxattr(path string, dest []byte) (sz int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(dest) > 0 { + _p1 = unsafe.Pointer(&dest[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LISTXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(dest))) + runtime.ExitSyscall() + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_ListxattrAddr() *(func(path string, dest []byte) (sz int, err error)) + +var Listxattr = enter_Listxattr + +func enter_Listxattr(path string, dest []byte) (sz int, err error) { + funcref := get_ListxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___LISTXATTR_A<<4, "") == 0 { + *funcref = impl_Listxattr + } else { + *funcref = error_Listxattr + } + return (*funcref)(path, dest) +} + +func error_Listxattr(path string, dest []byte) (sz int, err error) { + sz = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Llistxattr(path string, dest []byte) (sz int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(dest) > 0 { + _p1 = unsafe.Pointer(&dest[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LLISTXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(dest))) + runtime.ExitSyscall() + sz = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LlistxattrAddr() *(func(path string, dest []byte) (sz int, err error)) + +var Llistxattr = enter_Llistxattr + +func enter_Llistxattr(path string, dest []byte) (sz int, err error) { + funcref := get_LlistxattrAddr() + if funcptrtest(GetZosLibVec()+SYS___LLISTXATTR_A<<4, "") == 0 { + *funcref = impl_Llistxattr + } else { + *funcref = error_Llistxattr + } + return (*funcref)(path, dest) +} + +func error_Llistxattr(path string, dest []byte) (sz int, err error) { + sz = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Lremovexattr(path string, attr string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attr) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LREMOVEXATTR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LremovexattrAddr() *(func(path string, attr string) (err error)) + +var Lremovexattr = enter_Lremovexattr + +func enter_Lremovexattr(path string, attr string) (err error) { + funcref := get_LremovexattrAddr() + if funcptrtest(GetZosLibVec()+SYS___LREMOVEXATTR_A<<4, "") == 0 { + *funcref = impl_Lremovexattr + } else { + *funcref = error_Lremovexattr + } + return (*funcref)(path, attr) +} + +func error_Lremovexattr(path string, attr string) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Lutimes(path string, tv []Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(tv) > 0 { + _p1 = unsafe.Pointer(&tv[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LUTIMES_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(tv))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LutimesAddr() *(func(path string, tv []Timeval) (err error)) + +var Lutimes = enter_Lutimes + +func enter_Lutimes(path string, tv []Timeval) (err error) { + funcref := get_LutimesAddr() + if funcptrtest(GetZosLibVec()+SYS___LUTIMES_A<<4, "") == 0 { + *funcref = impl_Lutimes + } else { + *funcref = error_Lutimes + } + return (*funcref)(path, tv) +} + +func error_Lutimes(path string, tv []Timeval) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_MPROTECT<<4, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_MSYNC<<4, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Console2(cmsg *ConsMsg2, modstr *byte, concmd *uint32) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CONSOLE2<<4, uintptr(unsafe.Pointer(cmsg)), uintptr(unsafe.Pointer(modstr)), uintptr(unsafe.Pointer(concmd))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Poll(fds []PollFd, timeout int) (n int, err error) { + var _p0 unsafe.Pointer + if len(fds) > 0 { + _p0 = unsafe.Pointer(&fds[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_POLL<<4, uintptr(_p0), uintptr(len(fds)), uintptr(timeout)) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readdir_r(dirp uintptr, entry *direntLE, result **direntLE) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___READDIR_R_A<<4, uintptr(dirp), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Statfs(path string, buf *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___STATFS_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_StatfsAddr() *(func(path string, buf *Statfs_t) (err error)) + +var Statfs = enter_Statfs + +func enter_Statfs(path string, buf *Statfs_t) (err error) { + funcref := get_StatfsAddr() + if funcptrtest(GetZosLibVec()+SYS___STATFS_A<<4, "") == 0 { + *funcref = impl_Statfs + } else { + *funcref = error_Statfs + } + return (*funcref)(path, buf) +} + +func error_Statfs(path string, buf *Statfs_t) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Syncfs(fd int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SYNCFS<<4, uintptr(fd)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_SyncfsAddr() *(func(fd int) (err error)) + +var Syncfs = enter_Syncfs + +func enter_Syncfs(fd int) (err error) { + funcref := get_SyncfsAddr() + if funcptrtest(GetZosLibVec()+SYS_SYNCFS<<4, "") == 0 { + *funcref = impl_Syncfs + } else { + *funcref = error_Syncfs + } + return (*funcref)(fd) +} + +func error_Syncfs(fd int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Times(tms *Tms) (ticks uintptr, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_TIMES<<4, uintptr(unsafe.Pointer(tms))) + runtime.ExitSyscall() + ticks = uintptr(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func W_Getmntent(buff *byte, size int) (lastsys int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_W_GETMNTENT<<4, uintptr(unsafe.Pointer(buff)), uintptr(size)) + runtime.ExitSyscall() + lastsys = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func W_Getmntent_A(buff *byte, size int) (lastsys int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___W_GETMNTENT_A<<4, uintptr(unsafe.Pointer(buff)), uintptr(size)) + runtime.ExitSyscall() + lastsys = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mount_LE(path string, filesystem string, fstype string, mtm uint32, parmlen int32, parm string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(filesystem) + if err != nil { + return + } + var _p2 *byte + _p2, err = BytePtrFromString(fstype) + if err != nil { + return + } + var _p3 *byte + _p3, err = BytePtrFromString(parm) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MOUNT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(unsafe.Pointer(_p2)), uintptr(mtm), uintptr(parmlen), uintptr(unsafe.Pointer(_p3))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unmount_LE(filesystem string, mtm int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(filesystem) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UMOUNT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mtm)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___CHROOT_A<<4, uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nmsgsfds int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (ret int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SELECT<<4, uintptr(nmsgsfds), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout))) + runtime.ExitSyscall() + ret = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Uname(buf *Utsname) (err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_____OSNAME_A<<4, uintptr(unsafe.Pointer(buf))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Unshare(flags int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_UNSHARE<<4, uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_UnshareAddr() *(func(flags int) (err error)) + +var Unshare = enter_Unshare + +func enter_Unshare(flags int) (err error) { + funcref := get_UnshareAddr() + if funcptrtest(GetZosLibVec()+SYS_UNSHARE<<4, "") == 0 { + *funcref = impl_Unshare + } else { + *funcref = error_Unshare + } + return (*funcref)(flags) +} + +func error_Unshare(flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gethostname(buf []byte) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___GETHOSTNAME_A<<4, uintptr(_p0), uintptr(len(buf))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETGID<<4) + gid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETPID<<4) + pid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETPGID<<4, uintptr(pid)) + pgid = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (pid int) { + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETPPID<<4) + pid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETPRIORITY<<4, uintptr(which), uintptr(who)) + runtime.ExitSyscall() + prio = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(resource int, rlim *Rlimit) (err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETRLIMIT<<4, uintptr(resource), uintptr(unsafe.Pointer(rlim))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getrusage(who int, rusage *rusage_zos) (err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETRUSAGE<<4, uintptr(who), uintptr(unsafe.Pointer(rusage))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + runtime.EnterSyscall() + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETEGID<<4) + runtime.ExitSyscall() + egid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (euid int) { + runtime.EnterSyscall() + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETEUID<<4) + runtime.ExitSyscall() + euid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETSID<<4, uintptr(pid)) + sid = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := CallLeFuncWithErr(GetZosLibVec() + SYS_GETUID<<4) + uid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, sig Signal) (err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_KILL<<4, uintptr(pid), uintptr(sig)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LCHOWN_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LINK_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Linkat(oldDirFd int, oldPath string, newDirFd int, newPath string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldPath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newPath) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LINKAT_A<<4, uintptr(oldDirFd), uintptr(unsafe.Pointer(_p0)), uintptr(newDirFd), uintptr(unsafe.Pointer(_p1)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_LinkatAddr() *(func(oldDirFd int, oldPath string, newDirFd int, newPath string, flags int) (err error)) + +var Linkat = enter_Linkat + +func enter_Linkat(oldDirFd int, oldPath string, newDirFd int, newPath string, flags int) (err error) { + funcref := get_LinkatAddr() + if funcptrtest(GetZosLibVec()+SYS___LINKAT_A<<4, "") == 0 { + *funcref = impl_Linkat + } else { + *funcref = error_Linkat + } + return (*funcref)(oldDirFd, oldPath, newDirFd, newPath, flags) +} + +func error_Linkat(oldDirFd int, oldPath string, newDirFd int, newPath string, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, n int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_LISTEN<<4, uintptr(s), uintptr(n)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func lstat(path string, stat *Stat_LE_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___LSTAT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKDIR_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKDIRAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_MkdiratAddr() *(func(dirfd int, path string, mode uint32) (err error)) + +var Mkdirat = enter_Mkdirat + +func enter_Mkdirat(dirfd int, path string, mode uint32) (err error) { + funcref := get_MkdiratAddr() + if funcptrtest(GetZosLibVec()+SYS___MKDIRAT_A<<4, "") == 0 { + *funcref = impl_Mkdirat + } else { + *funcref = error_Mkdirat + } + return (*funcref)(dirfd, path, mode) +} + +func error_Mkdirat(dirfd int, path string, mode uint32) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKFIFO_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknod(path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKNOD_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___MKNODAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_MknodatAddr() *(func(dirfd int, path string, mode uint32, dev int) (err error)) + +var Mknodat = enter_Mknodat + +func enter_Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + funcref := get_MknodatAddr() + if funcptrtest(GetZosLibVec()+SYS___MKNODAT_A<<4, "") == 0 { + *funcref = impl_Mknodat + } else { + *funcref = error_Mknodat + } + return (*funcref)(dirfd, path, mode, dev) +} + +func error_Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_PivotRoot(newroot string, oldroot string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(newroot) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(oldroot) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___PIVOT_ROOT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_PivotRootAddr() *(func(newroot string, oldroot string) (err error)) + +var PivotRoot = enter_PivotRoot + +func enter_PivotRoot(newroot string, oldroot string) (err error) { + funcref := get_PivotRootAddr() + if funcptrtest(GetZosLibVec()+SYS___PIVOT_ROOT_A<<4, "") == 0 { + *funcref = impl_PivotRoot + } else { + *funcref = error_PivotRoot + } + return (*funcref)(newroot, oldroot) +} + +func error_PivotRoot(newroot string, oldroot string) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_PREAD<<4, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset)) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := syscall_syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) - prio = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func Pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_PWRITE<<4, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset)) + runtime.ExitSyscall() + n = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_GETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) +func impl_Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___PRCTL_A<<4, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_PrctlAddr() *(func(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error)) -func getrusage(who int, rusage *rusage_zos) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) - if e1 != 0 { - err = errnoErr(e1) +var Prctl = enter_Prctl + +func enter_Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { + funcref := get_PrctlAddr() + if funcptrtest(GetZosLibVec()+SYS___PRCTL_A<<4, "") == 0 { + *funcref = impl_Prctl + } else { + *funcref = error_Prctl } - return + return (*funcref)(option, arg2, arg3, arg4, arg5) } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Getsid(pid int) (sid int, err error) { - r0, _, e1 := syscall_rawsyscall(SYS_GETSID, uintptr(pid), 0, 0) - sid = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } +func error_Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Getuid() (uid int) { - r0, _, _ := syscall_rawsyscall(SYS_GETUID, 0, 0, 0) - uid = int(r0) +func impl_Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_PRLIMIT<<4, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_PrlimitAddr() *(func(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error)) -func Kill(pid int, sig Signal) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_KILL, uintptr(pid), uintptr(sig), 0) - if e1 != 0 { - err = errnoErr(e1) +var Prlimit = enter_Prlimit + +func enter_Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { + funcref := get_PrlimitAddr() + if funcptrtest(GetZosLibVec()+SYS_PRLIMIT<<4, "") == 0 { + *funcref = impl_Prlimit + } else { + *funcref = error_Prlimit } + return (*funcref)(pid, resource, newlimit, old) +} + +func error_Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Lchown(path string, uid int, gid int) (err error) { +func Rename(from string, to string) (err error) { var _p0 *byte - _p0, err = BytePtrFromString(path) + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___LCHOWN_A, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RENAME_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Link(path string, link string) (err error) { +func impl_Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) { var _p0 *byte - _p0, err = BytePtrFromString(path) + _p0, err = BytePtrFromString(oldpath) if err != nil { return } var _p1 *byte - _p1, err = BytePtrFromString(link) + _p1, err = BytePtrFromString(newpath) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___LINK_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RENAMEAT_A<<4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_RenameatAddr() *(func(olddirfd int, oldpath string, newdirfd int, newpath string) (err error)) -func Listen(s int, n int) (err error) { - _, _, e1 := syscall_syscall(SYS_LISTEN, uintptr(s), uintptr(n), 0) - if e1 != 0 { - err = errnoErr(e1) +var Renameat = enter_Renameat + +func enter_Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) { + funcref := get_RenameatAddr() + if funcptrtest(GetZosLibVec()+SYS___RENAMEAT_A<<4, "") == 0 { + *funcref = impl_Renameat + } else { + *funcref = error_Renameat } + return (*funcref)(olddirfd, oldpath, newdirfd, newpath) +} + +func error_Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func lstat(path string, stat *Stat_LE_t) (err error) { +func impl_Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) { var _p0 *byte - _p0, err = BytePtrFromString(path) + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___LSTAT_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RENAMEAT2_A<<4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_Renameat2Addr() *(func(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error)) -func Mkdir(path string, mode uint32) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := syscall_syscall(SYS___MKDIR_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) - if e1 != 0 { - err = errnoErr(e1) +var Renameat2 = enter_Renameat2 + +func enter_Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) { + funcref := get_Renameat2Addr() + if funcptrtest(GetZosLibVec()+SYS___RENAMEAT2_A<<4, "") == 0 { + *funcref = impl_Renameat2 + } else { + *funcref = error_Renameat2 } + return (*funcref)(olddirfd, oldpath, newdirfd, newpath, flags) +} + +func error_Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Mkfifo(path string, mode uint32) (err error) { +func Rmdir(path string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { return } - _, _, e1 := syscall_syscall(SYS___MKFIFO_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___RMDIR_A<<4, uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Mknod(path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := syscall_syscall(SYS___MKNOD_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) - if e1 != 0 { - err = errnoErr(e1) +func Seek(fd int, offset int64, whence int) (off int64, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_LSEEK<<4, uintptr(fd), uintptr(offset), uintptr(whence)) + runtime.ExitSyscall() + off = int64(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { - var _p0 unsafe.Pointer - if len(p) > 0 { - _p0 = unsafe.Pointer(&p[0]) - } else { - _p0 = unsafe.Pointer(&_zero) +func Setegid(egid int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETEGID<<4, uintptr(egid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } - r0, _, e1 := syscall_syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETEUID<<4, uintptr(euid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func impl_Sethostname(p []byte) (err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := syscall_syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SETHOSTNAME_A<<4, uintptr(_p0), uintptr(len(p))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_SethostnameAddr() *(func(p []byte) (err error)) -func Readlink(path string, buf []byte) (n int, err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - var _p1 unsafe.Pointer - if len(buf) > 0 { - _p1 = unsafe.Pointer(&buf[0]) +var Sethostname = enter_Sethostname + +func enter_Sethostname(p []byte) (err error) { + funcref := get_SethostnameAddr() + if funcptrtest(GetZosLibVec()+SYS___SETHOSTNAME_A<<4, "") == 0 { + *funcref = impl_Sethostname } else { - _p1 = unsafe.Pointer(&_zero) + *funcref = error_Sethostname } - r0, _, e1 := syscall_syscall(SYS___READLINK_A, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return + return (*funcref)(p) } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Rename(from string, to string) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(from) - if err != nil { - return - } - var _p1 *byte - _p1, err = BytePtrFromString(to) - if err != nil { - return - } - _, _, e1 := syscall_syscall(SYS___RENAME_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) - if e1 != 0 { - err = errnoErr(e1) - } +func error_Sethostname(p []byte) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Rmdir(path string) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := syscall_syscall(SYS___RMDIR_A, uintptr(unsafe.Pointer(_p0)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) +func impl_Setns(fd int, nstype int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETNS<<4, uintptr(fd), uintptr(nstype)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +//go:nosplit +func get_SetnsAddr() *(func(fd int, nstype int) (err error)) -func Seek(fd int, offset int64, whence int) (off int64, err error) { - r0, _, e1 := syscall_syscall(SYS_LSEEK, uintptr(fd), uintptr(offset), uintptr(whence)) - off = int64(r0) - if e1 != 0 { - err = errnoErr(e1) +var Setns = enter_Setns + +func enter_Setns(fd int, nstype int) (err error) { + funcref := get_SetnsAddr() + if funcptrtest(GetZosLibVec()+SYS_SETNS<<4, "") == 0 { + *funcref = impl_Setns + } else { + *funcref = error_Setns } + return (*funcref)(fd, nstype) +} + +func error_Setns(fd int, nstype int) (err error) { + err = ENOSYS return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := syscall_syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETPRIORITY<<4, uintptr(which), uintptr(who), uintptr(prio)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -971,9 +2910,9 @@ func Setpriority(which int, who int, prio int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETPGID<<4, uintptr(pid), uintptr(pgid)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -981,9 +2920,9 @@ func Setpgid(pid int, pgid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrlimit(resource int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETRLIMIT<<4, uintptr(resource), uintptr(unsafe.Pointer(lim))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -991,9 +2930,9 @@ func Setrlimit(resource int, lim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETREGID<<4, uintptr(rgid), uintptr(egid)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1001,9 +2940,9 @@ func Setregid(rgid int, egid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETREUID<<4, uintptr(ruid), uintptr(euid)) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1011,10 +2950,10 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := syscall_rawsyscall(SYS_SETSID, 0, 0, 0) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec() + SYS_SETSID<<4) pid = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1022,9 +2961,11 @@ func Setsid() (pid int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := syscall_syscall(SYS_SETUID, uintptr(uid), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETUID<<4, uintptr(uid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1032,9 +2973,11 @@ func Setuid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(uid int) (err error) { - _, _, e1 := syscall_syscall(SYS_SETGID, uintptr(uid), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SETGID<<4, uintptr(uid)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1042,9 +2985,11 @@ func Setgid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(fd int, how int) (err error) { - _, _, e1 := syscall_syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_SHUTDOWN<<4, uintptr(fd), uintptr(how)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1057,9 +3002,11 @@ func stat(path string, statLE *Stat_LE_t) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___STAT_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(statLE)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___STAT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(statLE))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1077,17 +3024,63 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___SYMLINK_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SYMLINK_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Symlinkat(oldPath string, dirfd int, newPath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldPath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newPath) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___SYMLINKAT_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(dirfd), uintptr(unsafe.Pointer(_p1))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } +//go:nosplit +func get_SymlinkatAddr() *(func(oldPath string, dirfd int, newPath string) (err error)) + +var Symlinkat = enter_Symlinkat + +func enter_Symlinkat(oldPath string, dirfd int, newPath string) (err error) { + funcref := get_SymlinkatAddr() + if funcptrtest(GetZosLibVec()+SYS___SYMLINKAT_A<<4, "") == 0 { + *funcref = impl_Symlinkat + } else { + *funcref = error_Symlinkat + } + return (*funcref)(oldPath, dirfd, newPath) +} + +func error_Symlinkat(oldPath string, dirfd int, newPath string) (err error) { + err = ENOSYS + return +} + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() { - syscall_syscall(SYS_SYNC, 0, 0, 0) + runtime.EnterSyscall() + CallLeFuncWithErr(GetZosLibVec() + SYS_SYNC<<4) + runtime.ExitSyscall() return } @@ -1099,9 +3092,11 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___TRUNCATE_A, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___TRUNCATE_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(length)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1109,9 +3104,11 @@ func Truncate(path string, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Tcgetattr(fildes int, termptr *Termios) (err error) { - _, _, e1 := syscall_syscall(SYS_TCGETATTR, uintptr(fildes), uintptr(unsafe.Pointer(termptr)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_TCGETATTR<<4, uintptr(fildes), uintptr(unsafe.Pointer(termptr))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1119,9 +3116,11 @@ func Tcgetattr(fildes int, termptr *Termios) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Tcsetattr(fildes int, when int, termptr *Termios) (err error) { - _, _, e1 := syscall_syscall(SYS_TCSETATTR, uintptr(fildes), uintptr(when), uintptr(unsafe.Pointer(termptr))) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_TCSETATTR<<4, uintptr(fildes), uintptr(when), uintptr(unsafe.Pointer(termptr))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1129,7 +3128,9 @@ func Tcsetattr(fildes int, when int, termptr *Termios) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(mask int) (oldmask int) { - r0, _, _ := syscall_syscall(SYS_UMASK, uintptr(mask), 0, 0) + runtime.EnterSyscall() + r0, _, _ := CallLeFuncWithErr(GetZosLibVec()+SYS_UMASK<<4, uintptr(mask)) + runtime.ExitSyscall() oldmask = int(r0) return } @@ -1142,10 +3143,49 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___UNLINK_A, uintptr(unsafe.Pointer(_p0)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UNLINK_A<<4, uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UNLINKAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_UnlinkatAddr() *(func(dirfd int, path string, flags int) (err error)) + +var Unlinkat = enter_Unlinkat + +func enter_Unlinkat(dirfd int, path string, flags int) (err error) { + funcref := get_UnlinkatAddr() + if funcptrtest(GetZosLibVec()+SYS___UNLINKAT_A<<4, "") == 0 { + *funcref = impl_Unlinkat + } else { + *funcref = error_Unlinkat } + return (*funcref)(dirfd, path, flags) +} + +func error_Unlinkat(dirfd int, path string, flags int) (err error) { + err = ENOSYS return } @@ -1157,9 +3197,11 @@ func Utime(path string, utim *Utimbuf) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___UTIME_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(utim)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UTIME_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(utim))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1172,11 +3214,91 @@ func open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := syscall_syscall(SYS___OPEN_A, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___OPEN_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___OPENAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_openatAddr() *(func(dirfd int, path string, flags int, mode uint32) (fd int, err error)) + +var openat = enter_openat + +func enter_openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) { + funcref := get_openatAddr() + if funcptrtest(GetZosLibVec()+SYS___OPENAT_A<<4, "") == 0 { + *funcref = impl_openat + } else { + *funcref = error_openat + } + return (*funcref)(dirfd, path, flags, mode) +} + +func error_openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) { + fd = -1 + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func impl_openat2(dirfd int, path string, open_how *OpenHow, size int) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___OPENAT2_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(open_how)), uintptr(size)) + runtime.ExitSyscall() fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_openat2Addr() *(func(dirfd int, path string, open_how *OpenHow, size int) (fd int, err error)) + +var openat2 = enter_openat2 + +func enter_openat2(dirfd int, path string, open_how *OpenHow, size int) (fd int, err error) { + funcref := get_openat2Addr() + if funcptrtest(GetZosLibVec()+SYS___OPENAT2_A<<4, "") == 0 { + *funcref = impl_openat2 + } else { + *funcref = error_openat2 } + return (*funcref)(dirfd, path, open_how, size) +} + +func error_openat2(dirfd int, path string, open_how *OpenHow, size int) (fd int, err error) { + fd = -1 + err = ENOSYS return } @@ -1188,9 +3310,23 @@ func remove(path string) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS_REMOVE, uintptr(unsafe.Pointer(_p0)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_REMOVE<<4, uintptr(unsafe.Pointer(_p0))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func waitid(idType int, id int, info *Siginfo, options int) (err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_WAITID<<4, uintptr(idType), uintptr(id), uintptr(unsafe.Pointer(info)), uintptr(options)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1198,10 +3334,12 @@ func remove(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func waitpid(pid int, wstatus *_C_int, options int) (wpid int, err error) { - r0, _, e1 := syscall_syscall(SYS_WAITPID, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options)) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_WAITPID<<4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options)) + runtime.ExitSyscall() wpid = int(r0) - if e1 != 0 { - err = errnoErr(e1) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1209,9 +3347,9 @@ func waitpid(pid int, wstatus *_C_int, options int) (wpid int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func gettimeofday(tv *timeval_zos) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GETTIMEOFDAY<<4, uintptr(unsafe.Pointer(tv))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1219,9 +3357,9 @@ func gettimeofday(tv *timeval_zos) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe(p *[2]_C_int) (err error) { - _, _, e1 := syscall_rawsyscall(SYS_PIPE, uintptr(unsafe.Pointer(p)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_PIPE<<4, uintptr(unsafe.Pointer(p))) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } @@ -1234,20 +3372,87 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := syscall_syscall(SYS___UTIMES_A, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) - if e1 != 0 { - err = errnoErr(e1) + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UTIMES_A<<4, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval))) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Select(nmsgsfds int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (ret int, err error) { - r0, _, e1 := syscall_syscall6(SYS_SELECT, uintptr(nmsgsfds), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) - ret = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func impl_utimensat(dirfd int, path string, ts *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS___UTIMENSAT_A<<4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(ts)), uintptr(flags)) + runtime.ExitSyscall() + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +//go:nosplit +func get_utimensatAddr() *(func(dirfd int, path string, ts *[2]Timespec, flags int) (err error)) + +var utimensat = enter_utimensat + +func enter_utimensat(dirfd int, path string, ts *[2]Timespec, flags int) (err error) { + funcref := get_utimensatAddr() + if funcptrtest(GetZosLibVec()+SYS___UTIMENSAT_A<<4, "") == 0 { + *funcref = impl_utimensat + } else { + *funcref = error_utimensat + } + return (*funcref)(dirfd, path, ts, flags) +} + +func error_utimensat(dirfd int, path string, ts *[2]Timespec, flags int) (err error) { + err = ENOSYS + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Posix_openpt(oflag int) (fd int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_POSIX_OPENPT<<4, uintptr(oflag)) + runtime.ExitSyscall() + fd = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Grantpt(fildes int) (rc int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_GRANTPT<<4, uintptr(fildes)) + runtime.ExitSyscall() + rc = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlockpt(fildes int) (rc int, err error) { + runtime.EnterSyscall() + r0, e2, e1 := CallLeFuncWithErr(GetZosLibVec()+SYS_UNLOCKPT<<4, uintptr(fildes)) + runtime.ExitSyscall() + rc = int(r0) + if int64(r0) == -1 { + err = errnoErr2(e1, e2) } return } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index 0cc3ce4..53aef5d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -452,4 +452,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 856d92d..71d5247 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -374,4 +374,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index 8d46709..c747706 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -416,4 +416,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index edc1732..f96e214 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -319,4 +319,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 445eba2..2842534 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -313,4 +313,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index adba01b..d095301 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -436,4 +436,9 @@ const ( SYS_FUTEX_WAKE = 4454 SYS_FUTEX_WAIT = 4455 SYS_FUTEX_REQUEUE = 4456 + SYS_STATMOUNT = 4457 + SYS_LISTMOUNT = 4458 + SYS_LSM_GET_SELF_ATTR = 4459 + SYS_LSM_SET_SELF_ATTR = 4460 + SYS_LSM_LIST_MODULES = 4461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 014c4e9..295c7f4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -366,4 +366,9 @@ const ( SYS_FUTEX_WAKE = 5454 SYS_FUTEX_WAIT = 5455 SYS_FUTEX_REQUEUE = 5456 + SYS_STATMOUNT = 5457 + SYS_LISTMOUNT = 5458 + SYS_LSM_GET_SELF_ATTR = 5459 + SYS_LSM_SET_SELF_ATTR = 5460 + SYS_LSM_LIST_MODULES = 5461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index ccc97d7..d1a9eac 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -366,4 +366,9 @@ const ( SYS_FUTEX_WAKE = 5454 SYS_FUTEX_WAIT = 5455 SYS_FUTEX_REQUEUE = 5456 + SYS_STATMOUNT = 5457 + SYS_LISTMOUNT = 5458 + SYS_LSM_GET_SELF_ATTR = 5459 + SYS_LSM_SET_SELF_ATTR = 5460 + SYS_LSM_LIST_MODULES = 5461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index ec2b64a..bec157c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -436,4 +436,9 @@ const ( SYS_FUTEX_WAKE = 4454 SYS_FUTEX_WAIT = 4455 SYS_FUTEX_REQUEUE = 4456 + SYS_STATMOUNT = 4457 + SYS_LISTMOUNT = 4458 + SYS_LSM_GET_SELF_ATTR = 4459 + SYS_LSM_SET_SELF_ATTR = 4460 + SYS_LSM_LIST_MODULES = 4461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index 21a839e..7ee7bdc 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -443,4 +443,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index c11121e..fad1f25 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -415,4 +415,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 909b631..7d3e163 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -415,4 +415,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index e49bed1..0ed53ad 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -320,4 +320,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 66017d2..2fba04a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -381,4 +381,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 47bab18..621d00d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -394,4 +394,9 @@ const ( SYS_FUTEX_WAKE = 454 SYS_FUTEX_WAIT = 455 SYS_FUTEX_REQUEUE = 456 + SYS_STATMOUNT = 457 + SYS_LISTMOUNT = 458 + SYS_LSM_GET_SELF_ATTR = 459 + SYS_LSM_SET_SELF_ATTR = 460 + SYS_LSM_LIST_MODULES = 461 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go index b2e3085..5e8c263 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go @@ -1,2669 +1,2852 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. +// go run mksyscall_zos_s390x.go -o_sysnum zsysnum_zos_s390x.go -o_syscall zsyscall_zos_s390x.go -i_syscall syscall_zos_s390x.go -o_asm zsymaddr_zos_s390x.s +// Code generated by the command above; see README.md. DO NOT EDIT. //go:build zos && s390x package unix -// TODO: auto-generate. - const ( - SYS_ACOSD128 = 0xB80 - SYS_ACOSD32 = 0xB7E - SYS_ACOSD64 = 0xB7F - SYS_ACOSHD128 = 0xB83 - SYS_ACOSHD32 = 0xB81 - SYS_ACOSHD64 = 0xB82 - SYS_AIO_FSYNC = 0xC69 - SYS_ASCTIME = 0x0AE - SYS_ASCTIME64 = 0xCD7 - SYS_ASCTIME64_R = 0xCD8 - SYS_ASIND128 = 0xB86 - SYS_ASIND32 = 0xB84 - SYS_ASIND64 = 0xB85 - SYS_ASINHD128 = 0xB89 - SYS_ASINHD32 = 0xB87 - SYS_ASINHD64 = 0xB88 - SYS_ATAN2D128 = 0xB8F - SYS_ATAN2D32 = 0xB8D - SYS_ATAN2D64 = 0xB8E - SYS_ATAND128 = 0xB8C - SYS_ATAND32 = 0xB8A - SYS_ATAND64 = 0xB8B - SYS_ATANHD128 = 0xB92 - SYS_ATANHD32 = 0xB90 - SYS_ATANHD64 = 0xB91 - SYS_BIND2ADDRSEL = 0xD59 - SYS_C16RTOMB = 0xD40 - SYS_C32RTOMB = 0xD41 - SYS_CBRTD128 = 0xB95 - SYS_CBRTD32 = 0xB93 - SYS_CBRTD64 = 0xB94 - SYS_CEILD128 = 0xB98 - SYS_CEILD32 = 0xB96 - SYS_CEILD64 = 0xB97 - SYS_CLEARENV = 0x0C9 - SYS_CLEARERR_UNLOCKED = 0xCA1 - SYS_CLOCK = 0x0AA - SYS_CLOGL = 0xA00 - SYS_CLRMEMF = 0x0BD - SYS_CONJ = 0xA03 - SYS_CONJF = 0xA06 - SYS_CONJL = 0xA09 - SYS_COPYSIGND128 = 0xB9E - SYS_COPYSIGND32 = 0xB9C - SYS_COPYSIGND64 = 0xB9D - SYS_COSD128 = 0xBA1 - SYS_COSD32 = 0xB9F - SYS_COSD64 = 0xBA0 - SYS_COSHD128 = 0xBA4 - SYS_COSHD32 = 0xBA2 - SYS_COSHD64 = 0xBA3 - SYS_CPOW = 0xA0C - SYS_CPOWF = 0xA0F - SYS_CPOWL = 0xA12 - SYS_CPROJ = 0xA15 - SYS_CPROJF = 0xA18 - SYS_CPROJL = 0xA1B - SYS_CREAL = 0xA1E - SYS_CREALF = 0xA21 - SYS_CREALL = 0xA24 - SYS_CSIN = 0xA27 - SYS_CSINF = 0xA2A - SYS_CSINH = 0xA30 - SYS_CSINHF = 0xA33 - SYS_CSINHL = 0xA36 - SYS_CSINL = 0xA2D - SYS_CSNAP = 0x0C5 - SYS_CSQRT = 0xA39 - SYS_CSQRTF = 0xA3C - SYS_CSQRTL = 0xA3F - SYS_CTAN = 0xA42 - SYS_CTANF = 0xA45 - SYS_CTANH = 0xA4B - SYS_CTANHF = 0xA4E - SYS_CTANHL = 0xA51 - SYS_CTANL = 0xA48 - SYS_CTIME = 0x0AB - SYS_CTIME64 = 0xCD9 - SYS_CTIME64_R = 0xCDA - SYS_CTRACE = 0x0C6 - SYS_DIFFTIME = 0x0A7 - SYS_DIFFTIME64 = 0xCDB - SYS_DLADDR = 0xC82 - SYS_DYNALLOC = 0x0C3 - SYS_DYNFREE = 0x0C2 - SYS_ERFCD128 = 0xBAA - SYS_ERFCD32 = 0xBA8 - SYS_ERFCD64 = 0xBA9 - SYS_ERFD128 = 0xBA7 - SYS_ERFD32 = 0xBA5 - SYS_ERFD64 = 0xBA6 - SYS_EXP2D128 = 0xBB0 - SYS_EXP2D32 = 0xBAE - SYS_EXP2D64 = 0xBAF - SYS_EXPD128 = 0xBAD - SYS_EXPD32 = 0xBAB - SYS_EXPD64 = 0xBAC - SYS_EXPM1D128 = 0xBB3 - SYS_EXPM1D32 = 0xBB1 - SYS_EXPM1D64 = 0xBB2 - SYS_FABSD128 = 0xBB6 - SYS_FABSD32 = 0xBB4 - SYS_FABSD64 = 0xBB5 - SYS_FDELREC_UNLOCKED = 0xCA2 - SYS_FDIMD128 = 0xBB9 - SYS_FDIMD32 = 0xBB7 - SYS_FDIMD64 = 0xBB8 - SYS_FDOPEN_UNLOCKED = 0xCFC - SYS_FECLEAREXCEPT = 0xAEA - SYS_FEGETENV = 0xAEB - SYS_FEGETEXCEPTFLAG = 0xAEC - SYS_FEGETROUND = 0xAED - SYS_FEHOLDEXCEPT = 0xAEE - SYS_FEOF_UNLOCKED = 0xCA3 - SYS_FERAISEEXCEPT = 0xAEF - SYS_FERROR_UNLOCKED = 0xCA4 - SYS_FESETENV = 0xAF0 - SYS_FESETEXCEPTFLAG = 0xAF1 - SYS_FESETROUND = 0xAF2 - SYS_FETCHEP = 0x0BF - SYS_FETESTEXCEPT = 0xAF3 - SYS_FEUPDATEENV = 0xAF4 - SYS_FE_DEC_GETROUND = 0xBBA - SYS_FE_DEC_SETROUND = 0xBBB - SYS_FFLUSH_UNLOCKED = 0xCA5 - SYS_FGETC_UNLOCKED = 0xC80 - SYS_FGETPOS64 = 0xCEE - SYS_FGETPOS64_UNLOCKED = 0xCF4 - SYS_FGETPOS_UNLOCKED = 0xCA6 - SYS_FGETS_UNLOCKED = 0xC7C - SYS_FGETWC_UNLOCKED = 0xCA7 - SYS_FGETWS_UNLOCKED = 0xCA8 - SYS_FILENO_UNLOCKED = 0xCA9 - SYS_FLDATA = 0x0C1 - SYS_FLDATA_UNLOCKED = 0xCAA - SYS_FLOCATE_UNLOCKED = 0xCAB - SYS_FLOORD128 = 0xBBE - SYS_FLOORD32 = 0xBBC - SYS_FLOORD64 = 0xBBD - SYS_FMA = 0xA63 - SYS_FMAD128 = 0xBC1 - SYS_FMAD32 = 0xBBF - SYS_FMAD64 = 0xBC0 - SYS_FMAF = 0xA66 - SYS_FMAL = 0xA69 - SYS_FMAX = 0xA6C - SYS_FMAXD128 = 0xBC4 - SYS_FMAXD32 = 0xBC2 - SYS_FMAXD64 = 0xBC3 - SYS_FMAXF = 0xA6F - SYS_FMAXL = 0xA72 - SYS_FMIN = 0xA75 - SYS_FMIND128 = 0xBC7 - SYS_FMIND32 = 0xBC5 - SYS_FMIND64 = 0xBC6 - SYS_FMINF = 0xA78 - SYS_FMINL = 0xA7B - SYS_FMODD128 = 0xBCA - SYS_FMODD32 = 0xBC8 - SYS_FMODD64 = 0xBC9 - SYS_FOPEN64 = 0xD49 - SYS_FOPEN64_UNLOCKED = 0xD4A - SYS_FOPEN_UNLOCKED = 0xCFA - SYS_FPRINTF_UNLOCKED = 0xCAC - SYS_FPUTC_UNLOCKED = 0xC81 - SYS_FPUTS_UNLOCKED = 0xC7E - SYS_FPUTWC_UNLOCKED = 0xCAD - SYS_FPUTWS_UNLOCKED = 0xCAE - SYS_FREAD_NOUPDATE = 0xCEC - SYS_FREAD_NOUPDATE_UNLOCKED = 0xCED - SYS_FREAD_UNLOCKED = 0xC7B - SYS_FREEIFADDRS = 0xCE6 - SYS_FREOPEN64 = 0xD4B - SYS_FREOPEN64_UNLOCKED = 0xD4C - SYS_FREOPEN_UNLOCKED = 0xCFB - SYS_FREXPD128 = 0xBCE - SYS_FREXPD32 = 0xBCC - SYS_FREXPD64 = 0xBCD - SYS_FSCANF_UNLOCKED = 0xCAF - SYS_FSEEK64 = 0xCEF - SYS_FSEEK64_UNLOCKED = 0xCF5 - SYS_FSEEKO64 = 0xCF0 - SYS_FSEEKO64_UNLOCKED = 0xCF6 - SYS_FSEEKO_UNLOCKED = 0xCB1 - SYS_FSEEK_UNLOCKED = 0xCB0 - SYS_FSETPOS64 = 0xCF1 - SYS_FSETPOS64_UNLOCKED = 0xCF7 - SYS_FSETPOS_UNLOCKED = 0xCB3 - SYS_FTELL64 = 0xCF2 - SYS_FTELL64_UNLOCKED = 0xCF8 - SYS_FTELLO64 = 0xCF3 - SYS_FTELLO64_UNLOCKED = 0xCF9 - SYS_FTELLO_UNLOCKED = 0xCB5 - SYS_FTELL_UNLOCKED = 0xCB4 - SYS_FUPDATE = 0x0B5 - SYS_FUPDATE_UNLOCKED = 0xCB7 - SYS_FWIDE_UNLOCKED = 0xCB8 - SYS_FWPRINTF_UNLOCKED = 0xCB9 - SYS_FWRITE_UNLOCKED = 0xC7A - SYS_FWSCANF_UNLOCKED = 0xCBA - SYS_GETDATE64 = 0xD4F - SYS_GETIFADDRS = 0xCE7 - SYS_GETIPV4SOURCEFILTER = 0xC77 - SYS_GETSOURCEFILTER = 0xC79 - SYS_GETSYNTX = 0x0FD - SYS_GETS_UNLOCKED = 0xC7D - SYS_GETTIMEOFDAY64 = 0xD50 - SYS_GETWCHAR_UNLOCKED = 0xCBC - SYS_GETWC_UNLOCKED = 0xCBB - SYS_GMTIME = 0x0B0 - SYS_GMTIME64 = 0xCDC - SYS_GMTIME64_R = 0xCDD - SYS_HYPOTD128 = 0xBD1 - SYS_HYPOTD32 = 0xBCF - SYS_HYPOTD64 = 0xBD0 - SYS_ILOGBD128 = 0xBD4 - SYS_ILOGBD32 = 0xBD2 - SYS_ILOGBD64 = 0xBD3 - SYS_ILOGBF = 0xA7E - SYS_ILOGBL = 0xA81 - SYS_INET6_IS_SRCADDR = 0xD5A - SYS_ISBLANK = 0x0FE - SYS_ISWALNUM = 0x0FF - SYS_LDEXPD128 = 0xBD7 - SYS_LDEXPD32 = 0xBD5 - SYS_LDEXPD64 = 0xBD6 - SYS_LGAMMAD128 = 0xBDA - SYS_LGAMMAD32 = 0xBD8 - SYS_LGAMMAD64 = 0xBD9 - SYS_LIO_LISTIO = 0xC6A - SYS_LLRINT = 0xA84 - SYS_LLRINTD128 = 0xBDD - SYS_LLRINTD32 = 0xBDB - SYS_LLRINTD64 = 0xBDC - SYS_LLRINTF = 0xA87 - SYS_LLRINTL = 0xA8A - SYS_LLROUND = 0xA8D - SYS_LLROUNDD128 = 0xBE0 - SYS_LLROUNDD32 = 0xBDE - SYS_LLROUNDD64 = 0xBDF - SYS_LLROUNDF = 0xA90 - SYS_LLROUNDL = 0xA93 - SYS_LOCALTIM = 0x0B1 - SYS_LOCALTIME = 0x0B1 - SYS_LOCALTIME64 = 0xCDE - SYS_LOCALTIME64_R = 0xCDF - SYS_LOG10D128 = 0xBE6 - SYS_LOG10D32 = 0xBE4 - SYS_LOG10D64 = 0xBE5 - SYS_LOG1PD128 = 0xBE9 - SYS_LOG1PD32 = 0xBE7 - SYS_LOG1PD64 = 0xBE8 - SYS_LOG2D128 = 0xBEC - SYS_LOG2D32 = 0xBEA - SYS_LOG2D64 = 0xBEB - SYS_LOGBD128 = 0xBEF - SYS_LOGBD32 = 0xBED - SYS_LOGBD64 = 0xBEE - SYS_LOGBF = 0xA96 - SYS_LOGBL = 0xA99 - SYS_LOGD128 = 0xBE3 - SYS_LOGD32 = 0xBE1 - SYS_LOGD64 = 0xBE2 - SYS_LRINT = 0xA9C - SYS_LRINTD128 = 0xBF2 - SYS_LRINTD32 = 0xBF0 - SYS_LRINTD64 = 0xBF1 - SYS_LRINTF = 0xA9F - SYS_LRINTL = 0xAA2 - SYS_LROUNDD128 = 0xBF5 - SYS_LROUNDD32 = 0xBF3 - SYS_LROUNDD64 = 0xBF4 - SYS_LROUNDL = 0xAA5 - SYS_MBLEN = 0x0AF - SYS_MBRTOC16 = 0xD42 - SYS_MBRTOC32 = 0xD43 - SYS_MEMSET = 0x0A3 - SYS_MKTIME = 0x0AC - SYS_MKTIME64 = 0xCE0 - SYS_MODFD128 = 0xBF8 - SYS_MODFD32 = 0xBF6 - SYS_MODFD64 = 0xBF7 - SYS_NAN = 0xAA8 - SYS_NAND128 = 0xBFB - SYS_NAND32 = 0xBF9 - SYS_NAND64 = 0xBFA - SYS_NANF = 0xAAA - SYS_NANL = 0xAAC - SYS_NEARBYINT = 0xAAE - SYS_NEARBYINTD128 = 0xBFE - SYS_NEARBYINTD32 = 0xBFC - SYS_NEARBYINTD64 = 0xBFD - SYS_NEARBYINTF = 0xAB1 - SYS_NEARBYINTL = 0xAB4 - SYS_NEXTAFTERD128 = 0xC01 - SYS_NEXTAFTERD32 = 0xBFF - SYS_NEXTAFTERD64 = 0xC00 - SYS_NEXTAFTERF = 0xAB7 - SYS_NEXTAFTERL = 0xABA - SYS_NEXTTOWARD = 0xABD - SYS_NEXTTOWARDD128 = 0xC04 - SYS_NEXTTOWARDD32 = 0xC02 - SYS_NEXTTOWARDD64 = 0xC03 - SYS_NEXTTOWARDF = 0xAC0 - SYS_NEXTTOWARDL = 0xAC3 - SYS_NL_LANGINFO = 0x0FC - SYS_PERROR_UNLOCKED = 0xCBD - SYS_POSIX_FALLOCATE = 0xCE8 - SYS_POSIX_MEMALIGN = 0xCE9 - SYS_POSIX_OPENPT = 0xC66 - SYS_POWD128 = 0xC07 - SYS_POWD32 = 0xC05 - SYS_POWD64 = 0xC06 - SYS_PRINTF_UNLOCKED = 0xCBE - SYS_PSELECT = 0xC67 - SYS_PTHREAD_ATTR_GETSTACK = 0xB3E - SYS_PTHREAD_ATTR_SETSTACK = 0xB3F - SYS_PTHREAD_SECURITY_APPLID_NP = 0xCE4 - SYS_PUTS_UNLOCKED = 0xC7F - SYS_PUTWCHAR_UNLOCKED = 0xCC0 - SYS_PUTWC_UNLOCKED = 0xCBF - SYS_QUANTEXPD128 = 0xD46 - SYS_QUANTEXPD32 = 0xD44 - SYS_QUANTEXPD64 = 0xD45 - SYS_QUANTIZED128 = 0xC0A - SYS_QUANTIZED32 = 0xC08 - SYS_QUANTIZED64 = 0xC09 - SYS_REMAINDERD128 = 0xC0D - SYS_REMAINDERD32 = 0xC0B - SYS_REMAINDERD64 = 0xC0C - SYS_RESIZE_ALLOC = 0xCEB - SYS_REWIND_UNLOCKED = 0xCC1 - SYS_RINTD128 = 0xC13 - SYS_RINTD32 = 0xC11 - SYS_RINTD64 = 0xC12 - SYS_RINTF = 0xACB - SYS_RINTL = 0xACD - SYS_ROUND = 0xACF - SYS_ROUNDD128 = 0xC16 - SYS_ROUNDD32 = 0xC14 - SYS_ROUNDD64 = 0xC15 - SYS_ROUNDF = 0xAD2 - SYS_ROUNDL = 0xAD5 - SYS_SAMEQUANTUMD128 = 0xC19 - SYS_SAMEQUANTUMD32 = 0xC17 - SYS_SAMEQUANTUMD64 = 0xC18 - SYS_SCALBLN = 0xAD8 - SYS_SCALBLND128 = 0xC1C - SYS_SCALBLND32 = 0xC1A - SYS_SCALBLND64 = 0xC1B - SYS_SCALBLNF = 0xADB - SYS_SCALBLNL = 0xADE - SYS_SCALBND128 = 0xC1F - SYS_SCALBND32 = 0xC1D - SYS_SCALBND64 = 0xC1E - SYS_SCALBNF = 0xAE3 - SYS_SCALBNL = 0xAE6 - SYS_SCANF_UNLOCKED = 0xCC2 - SYS_SCHED_YIELD = 0xB32 - SYS_SETENV = 0x0C8 - SYS_SETIPV4SOURCEFILTER = 0xC76 - SYS_SETSOURCEFILTER = 0xC78 - SYS_SHM_OPEN = 0xC8C - SYS_SHM_UNLINK = 0xC8D - SYS_SIND128 = 0xC22 - SYS_SIND32 = 0xC20 - SYS_SIND64 = 0xC21 - SYS_SINHD128 = 0xC25 - SYS_SINHD32 = 0xC23 - SYS_SINHD64 = 0xC24 - SYS_SIZEOF_ALLOC = 0xCEA - SYS_SOCKATMARK = 0xC68 - SYS_SQRTD128 = 0xC28 - SYS_SQRTD32 = 0xC26 - SYS_SQRTD64 = 0xC27 - SYS_STRCHR = 0x0A0 - SYS_STRCSPN = 0x0A1 - SYS_STRERROR = 0x0A8 - SYS_STRERROR_R = 0xB33 - SYS_STRFTIME = 0x0B2 - SYS_STRLEN = 0x0A9 - SYS_STRPBRK = 0x0A2 - SYS_STRSPN = 0x0A4 - SYS_STRSTR = 0x0A5 - SYS_STRTOD128 = 0xC2B - SYS_STRTOD32 = 0xC29 - SYS_STRTOD64 = 0xC2A - SYS_STRTOK = 0x0A6 - SYS_TAND128 = 0xC2E - SYS_TAND32 = 0xC2C - SYS_TAND64 = 0xC2D - SYS_TANHD128 = 0xC31 - SYS_TANHD32 = 0xC2F - SYS_TANHD64 = 0xC30 - SYS_TGAMMAD128 = 0xC34 - SYS_TGAMMAD32 = 0xC32 - SYS_TGAMMAD64 = 0xC33 - SYS_TIME = 0x0AD - SYS_TIME64 = 0xCE1 - SYS_TMPFILE64 = 0xD4D - SYS_TMPFILE64_UNLOCKED = 0xD4E - SYS_TMPFILE_UNLOCKED = 0xCFD - SYS_TRUNCD128 = 0xC40 - SYS_TRUNCD32 = 0xC3E - SYS_TRUNCD64 = 0xC3F - SYS_UNGETC_UNLOCKED = 0xCC3 - SYS_UNGETWC_UNLOCKED = 0xCC4 - SYS_UNSETENV = 0xB34 - SYS_VFPRINTF_UNLOCKED = 0xCC5 - SYS_VFSCANF_UNLOCKED = 0xCC7 - SYS_VFWPRINTF_UNLOCKED = 0xCC9 - SYS_VFWSCANF_UNLOCKED = 0xCCB - SYS_VPRINTF_UNLOCKED = 0xCCD - SYS_VSCANF_UNLOCKED = 0xCCF - SYS_VWPRINTF_UNLOCKED = 0xCD1 - SYS_VWSCANF_UNLOCKED = 0xCD3 - SYS_WCSTOD128 = 0xC43 - SYS_WCSTOD32 = 0xC41 - SYS_WCSTOD64 = 0xC42 - SYS_WPRINTF_UNLOCKED = 0xCD5 - SYS_WSCANF_UNLOCKED = 0xCD6 - SYS__FLUSHLBF = 0xD68 - SYS__FLUSHLBF_UNLOCKED = 0xD6F - SYS___ACOSHF_H = 0xA54 - SYS___ACOSHL_H = 0xA55 - SYS___ASINHF_H = 0xA56 - SYS___ASINHL_H = 0xA57 - SYS___ATANPID128 = 0xC6D - SYS___ATANPID32 = 0xC6B - SYS___ATANPID64 = 0xC6C - SYS___CBRTF_H = 0xA58 - SYS___CBRTL_H = 0xA59 - SYS___CDUMP = 0x0C4 - SYS___CLASS = 0xAFA - SYS___CLASS2 = 0xB99 - SYS___CLASS2D128 = 0xC99 - SYS___CLASS2D32 = 0xC97 - SYS___CLASS2D64 = 0xC98 - SYS___CLASS2F = 0xC91 - SYS___CLASS2F_B = 0xC93 - SYS___CLASS2F_H = 0xC94 - SYS___CLASS2L = 0xC92 - SYS___CLASS2L_B = 0xC95 - SYS___CLASS2L_H = 0xC96 - SYS___CLASS2_B = 0xB9A - SYS___CLASS2_H = 0xB9B - SYS___CLASS_B = 0xAFB - SYS___CLASS_H = 0xAFC - SYS___CLOGL_B = 0xA01 - SYS___CLOGL_H = 0xA02 - SYS___CLRENV = 0x0C9 - SYS___CLRMF = 0x0BD - SYS___CODEPAGE_INFO = 0xC64 - SYS___CONJF_B = 0xA07 - SYS___CONJF_H = 0xA08 - SYS___CONJL_B = 0xA0A - SYS___CONJL_H = 0xA0B - SYS___CONJ_B = 0xA04 - SYS___CONJ_H = 0xA05 - SYS___COPYSIGN_B = 0xA5A - SYS___COPYSIGN_H = 0xAF5 - SYS___COSPID128 = 0xC70 - SYS___COSPID32 = 0xC6E - SYS___COSPID64 = 0xC6F - SYS___CPOWF_B = 0xA10 - SYS___CPOWF_H = 0xA11 - SYS___CPOWL_B = 0xA13 - SYS___CPOWL_H = 0xA14 - SYS___CPOW_B = 0xA0D - SYS___CPOW_H = 0xA0E - SYS___CPROJF_B = 0xA19 - SYS___CPROJF_H = 0xA1A - SYS___CPROJL_B = 0xA1C - SYS___CPROJL_H = 0xA1D - SYS___CPROJ_B = 0xA16 - SYS___CPROJ_H = 0xA17 - SYS___CREALF_B = 0xA22 - SYS___CREALF_H = 0xA23 - SYS___CREALL_B = 0xA25 - SYS___CREALL_H = 0xA26 - SYS___CREAL_B = 0xA1F - SYS___CREAL_H = 0xA20 - SYS___CSINF_B = 0xA2B - SYS___CSINF_H = 0xA2C - SYS___CSINHF_B = 0xA34 - SYS___CSINHF_H = 0xA35 - SYS___CSINHL_B = 0xA37 - SYS___CSINHL_H = 0xA38 - SYS___CSINH_B = 0xA31 - SYS___CSINH_H = 0xA32 - SYS___CSINL_B = 0xA2E - SYS___CSINL_H = 0xA2F - SYS___CSIN_B = 0xA28 - SYS___CSIN_H = 0xA29 - SYS___CSNAP = 0x0C5 - SYS___CSQRTF_B = 0xA3D - SYS___CSQRTF_H = 0xA3E - SYS___CSQRTL_B = 0xA40 - SYS___CSQRTL_H = 0xA41 - SYS___CSQRT_B = 0xA3A - SYS___CSQRT_H = 0xA3B - SYS___CTANF_B = 0xA46 - SYS___CTANF_H = 0xA47 - SYS___CTANHF_B = 0xA4F - SYS___CTANHF_H = 0xA50 - SYS___CTANHL_B = 0xA52 - SYS___CTANHL_H = 0xA53 - SYS___CTANH_B = 0xA4C - SYS___CTANH_H = 0xA4D - SYS___CTANL_B = 0xA49 - SYS___CTANL_H = 0xA4A - SYS___CTAN_B = 0xA43 - SYS___CTAN_H = 0xA44 - SYS___CTEST = 0x0C7 - SYS___CTRACE = 0x0C6 - SYS___D1TOP = 0xC9B - SYS___D2TOP = 0xC9C - SYS___D4TOP = 0xC9D - SYS___DYNALL = 0x0C3 - SYS___DYNFRE = 0x0C2 - SYS___EXP2F_H = 0xA5E - SYS___EXP2L_H = 0xA5F - SYS___EXP2_H = 0xA5D - SYS___EXPM1F_H = 0xA5B - SYS___EXPM1L_H = 0xA5C - SYS___FBUFSIZE = 0xD60 - SYS___FLBF = 0xD62 - SYS___FLDATA = 0x0C1 - SYS___FMAF_B = 0xA67 - SYS___FMAF_H = 0xA68 - SYS___FMAL_B = 0xA6A - SYS___FMAL_H = 0xA6B - SYS___FMAXF_B = 0xA70 - SYS___FMAXF_H = 0xA71 - SYS___FMAXL_B = 0xA73 - SYS___FMAXL_H = 0xA74 - SYS___FMAX_B = 0xA6D - SYS___FMAX_H = 0xA6E - SYS___FMA_B = 0xA64 - SYS___FMA_H = 0xA65 - SYS___FMINF_B = 0xA79 - SYS___FMINF_H = 0xA7A - SYS___FMINL_B = 0xA7C - SYS___FMINL_H = 0xA7D - SYS___FMIN_B = 0xA76 - SYS___FMIN_H = 0xA77 - SYS___FPENDING = 0xD61 - SYS___FPENDING_UNLOCKED = 0xD6C - SYS___FPURGE = 0xD69 - SYS___FPURGE_UNLOCKED = 0xD70 - SYS___FP_CAST_D = 0xBCB - SYS___FREADABLE = 0xD63 - SYS___FREADAHEAD = 0xD6A - SYS___FREADAHEAD_UNLOCKED = 0xD71 - SYS___FREADING = 0xD65 - SYS___FREADING_UNLOCKED = 0xD6D - SYS___FSEEK2 = 0xB3C - SYS___FSETERR = 0xD6B - SYS___FSETLOCKING = 0xD67 - SYS___FTCHEP = 0x0BF - SYS___FTELL2 = 0xB3B - SYS___FUPDT = 0x0B5 - SYS___FWRITABLE = 0xD64 - SYS___FWRITING = 0xD66 - SYS___FWRITING_UNLOCKED = 0xD6E - SYS___GETCB = 0x0B4 - SYS___GETGRGID1 = 0xD5B - SYS___GETGRNAM1 = 0xD5C - SYS___GETTHENT = 0xCE5 - SYS___GETTOD = 0xD3E - SYS___HYPOTF_H = 0xAF6 - SYS___HYPOTL_H = 0xAF7 - SYS___ILOGBF_B = 0xA7F - SYS___ILOGBF_H = 0xA80 - SYS___ILOGBL_B = 0xA82 - SYS___ILOGBL_H = 0xA83 - SYS___ISBLANK_A = 0xB2E - SYS___ISBLNK = 0x0FE - SYS___ISWBLANK_A = 0xB2F - SYS___LE_CEEGTJS = 0xD72 - SYS___LE_TRACEBACK = 0xB7A - SYS___LGAMMAL_H = 0xA62 - SYS___LGAMMA_B_C99 = 0xB39 - SYS___LGAMMA_H_C99 = 0xB38 - SYS___LGAMMA_R_C99 = 0xB3A - SYS___LLRINTF_B = 0xA88 - SYS___LLRINTF_H = 0xA89 - SYS___LLRINTL_B = 0xA8B - SYS___LLRINTL_H = 0xA8C - SYS___LLRINT_B = 0xA85 - SYS___LLRINT_H = 0xA86 - SYS___LLROUNDF_B = 0xA91 - SYS___LLROUNDF_H = 0xA92 - SYS___LLROUNDL_B = 0xA94 - SYS___LLROUNDL_H = 0xA95 - SYS___LLROUND_B = 0xA8E - SYS___LLROUND_H = 0xA8F - SYS___LOCALE_CTL = 0xD47 - SYS___LOG1PF_H = 0xA60 - SYS___LOG1PL_H = 0xA61 - SYS___LOGBF_B = 0xA97 - SYS___LOGBF_H = 0xA98 - SYS___LOGBL_B = 0xA9A - SYS___LOGBL_H = 0xA9B - SYS___LOGIN_APPLID = 0xCE2 - SYS___LRINTF_B = 0xAA0 - SYS___LRINTF_H = 0xAA1 - SYS___LRINTL_B = 0xAA3 - SYS___LRINTL_H = 0xAA4 - SYS___LRINT_B = 0xA9D - SYS___LRINT_H = 0xA9E - SYS___LROUNDF_FIXUP = 0xB31 - SYS___LROUNDL_B = 0xAA6 - SYS___LROUNDL_H = 0xAA7 - SYS___LROUND_FIXUP = 0xB30 - SYS___MOSERVICES = 0xD3D - SYS___MUST_STAY_CLEAN = 0xB7C - SYS___NANF_B = 0xAAB - SYS___NANL_B = 0xAAD - SYS___NAN_B = 0xAA9 - SYS___NEARBYINTF_B = 0xAB2 - SYS___NEARBYINTF_H = 0xAB3 - SYS___NEARBYINTL_B = 0xAB5 - SYS___NEARBYINTL_H = 0xAB6 - SYS___NEARBYINT_B = 0xAAF - SYS___NEARBYINT_H = 0xAB0 - SYS___NEXTAFTERF_B = 0xAB8 - SYS___NEXTAFTERF_H = 0xAB9 - SYS___NEXTAFTERL_B = 0xABB - SYS___NEXTAFTERL_H = 0xABC - SYS___NEXTTOWARDF_B = 0xAC1 - SYS___NEXTTOWARDF_H = 0xAC2 - SYS___NEXTTOWARDL_B = 0xAC4 - SYS___NEXTTOWARDL_H = 0xAC5 - SYS___NEXTTOWARD_B = 0xABE - SYS___NEXTTOWARD_H = 0xABF - SYS___O_ENV = 0xB7D - SYS___PASSWD_APPLID = 0xCE3 - SYS___PTOD1 = 0xC9E - SYS___PTOD2 = 0xC9F - SYS___PTOD4 = 0xCA0 - SYS___REGCOMP_STD = 0x0EA - SYS___REMAINDERF_H = 0xAC6 - SYS___REMAINDERL_H = 0xAC7 - SYS___REMQUOD128 = 0xC10 - SYS___REMQUOD32 = 0xC0E - SYS___REMQUOD64 = 0xC0F - SYS___REMQUOF_H = 0xAC9 - SYS___REMQUOL_H = 0xACA - SYS___REMQUO_H = 0xAC8 - SYS___RINTF_B = 0xACC - SYS___RINTL_B = 0xACE - SYS___ROUNDF_B = 0xAD3 - SYS___ROUNDF_H = 0xAD4 - SYS___ROUNDL_B = 0xAD6 - SYS___ROUNDL_H = 0xAD7 - SYS___ROUND_B = 0xAD0 - SYS___ROUND_H = 0xAD1 - SYS___SCALBLNF_B = 0xADC - SYS___SCALBLNF_H = 0xADD - SYS___SCALBLNL_B = 0xADF - SYS___SCALBLNL_H = 0xAE0 - SYS___SCALBLN_B = 0xAD9 - SYS___SCALBLN_H = 0xADA - SYS___SCALBNF_B = 0xAE4 - SYS___SCALBNF_H = 0xAE5 - SYS___SCALBNL_B = 0xAE7 - SYS___SCALBNL_H = 0xAE8 - SYS___SCALBN_B = 0xAE1 - SYS___SCALBN_H = 0xAE2 - SYS___SETENV = 0x0C8 - SYS___SINPID128 = 0xC73 - SYS___SINPID32 = 0xC71 - SYS___SINPID64 = 0xC72 - SYS___SMF_RECORD2 = 0xD48 - SYS___STATIC_REINIT = 0xB3D - SYS___TGAMMAF_H_C99 = 0xB79 - SYS___TGAMMAL_H = 0xAE9 - SYS___TGAMMA_H_C99 = 0xB78 - SYS___TOCSNAME2 = 0xC9A - SYS_CEIL = 0x01F - SYS_CHAUDIT = 0x1E0 - SYS_EXP = 0x01A - SYS_FCHAUDIT = 0x1E1 - SYS_FREXP = 0x01D - SYS_GETGROUPSBYNAME = 0x1E2 - SYS_GETPWUID = 0x1A0 - SYS_GETUID = 0x1A1 - SYS_ISATTY = 0x1A3 - SYS_KILL = 0x1A4 - SYS_LDEXP = 0x01E - SYS_LINK = 0x1A5 - SYS_LOG10 = 0x01C - SYS_LSEEK = 0x1A6 - SYS_LSTAT = 0x1A7 - SYS_MKDIR = 0x1A8 - SYS_MKFIFO = 0x1A9 - SYS_MKNOD = 0x1AA - SYS_MODF = 0x01B - SYS_MOUNT = 0x1AB - SYS_OPEN = 0x1AC - SYS_OPENDIR = 0x1AD - SYS_PATHCONF = 0x1AE - SYS_PAUSE = 0x1AF - SYS_PIPE = 0x1B0 - SYS_PTHREAD_ATTR_DESTROY = 0x1E7 - SYS_PTHREAD_ATTR_GETDETACHSTATE = 0x1EB - SYS_PTHREAD_ATTR_GETSTACKSIZE = 0x1E9 - SYS_PTHREAD_ATTR_GETWEIGHT_NP = 0x1ED - SYS_PTHREAD_ATTR_INIT = 0x1E6 - SYS_PTHREAD_ATTR_SETDETACHSTATE = 0x1EA - SYS_PTHREAD_ATTR_SETSTACKSIZE = 0x1E8 - SYS_PTHREAD_ATTR_SETWEIGHT_NP = 0x1EC - SYS_PTHREAD_CANCEL = 0x1EE - SYS_PTHREAD_CLEANUP_POP = 0x1F0 - SYS_PTHREAD_CLEANUP_PUSH = 0x1EF - SYS_PTHREAD_CONDATTR_DESTROY = 0x1F2 - SYS_PTHREAD_CONDATTR_INIT = 0x1F1 - SYS_PTHREAD_COND_BROADCAST = 0x1F6 - SYS_PTHREAD_COND_DESTROY = 0x1F4 - SYS_PTHREAD_COND_INIT = 0x1F3 - SYS_PTHREAD_COND_SIGNAL = 0x1F5 - SYS_PTHREAD_COND_TIMEDWAIT = 0x1F8 - SYS_PTHREAD_COND_WAIT = 0x1F7 - SYS_PTHREAD_CREATE = 0x1F9 - SYS_PTHREAD_DETACH = 0x1FA - SYS_PTHREAD_EQUAL = 0x1FB - SYS_PTHREAD_EXIT = 0x1E4 - SYS_PTHREAD_GETSPECIFIC = 0x1FC - SYS_PTHREAD_JOIN = 0x1FD - SYS_PTHREAD_KEY_CREATE = 0x1FE - SYS_PTHREAD_KILL = 0x1E5 - SYS_PTHREAD_MUTEXATTR_INIT = 0x1FF - SYS_READ = 0x1B2 - SYS_READDIR = 0x1B3 - SYS_READLINK = 0x1B4 - SYS_REWINDDIR = 0x1B5 - SYS_RMDIR = 0x1B6 - SYS_SETEGID = 0x1B7 - SYS_SETEUID = 0x1B8 - SYS_SETGID = 0x1B9 - SYS_SETPGID = 0x1BA - SYS_SETSID = 0x1BB - SYS_SETUID = 0x1BC - SYS_SIGACTION = 0x1BD - SYS_SIGADDSET = 0x1BE - SYS_SIGDELSET = 0x1BF - SYS_SIGEMPTYSET = 0x1C0 - SYS_SIGFILLSET = 0x1C1 - SYS_SIGISMEMBER = 0x1C2 - SYS_SIGLONGJMP = 0x1C3 - SYS_SIGPENDING = 0x1C4 - SYS_SIGPROCMASK = 0x1C5 - SYS_SIGSETJMP = 0x1C6 - SYS_SIGSUSPEND = 0x1C7 - SYS_SIGWAIT = 0x1E3 - SYS_SLEEP = 0x1C8 - SYS_STAT = 0x1C9 - SYS_SYMLINK = 0x1CB - SYS_SYSCONF = 0x1CC - SYS_TCDRAIN = 0x1CD - SYS_TCFLOW = 0x1CE - SYS_TCFLUSH = 0x1CF - SYS_TCGETATTR = 0x1D0 - SYS_TCGETPGRP = 0x1D1 - SYS_TCSENDBREAK = 0x1D2 - SYS_TCSETATTR = 0x1D3 - SYS_TCSETPGRP = 0x1D4 - SYS_TIMES = 0x1D5 - SYS_TTYNAME = 0x1D6 - SYS_TZSET = 0x1D7 - SYS_UMASK = 0x1D8 - SYS_UMOUNT = 0x1D9 - SYS_UNAME = 0x1DA - SYS_UNLINK = 0x1DB - SYS_UTIME = 0x1DC - SYS_WAIT = 0x1DD - SYS_WAITPID = 0x1DE - SYS_WRITE = 0x1DF - SYS_W_GETPSENT = 0x1B1 - SYS_W_IOCTL = 0x1A2 - SYS_W_STATFS = 0x1CA - SYS_A64L = 0x2EF - SYS_BCMP = 0x2B9 - SYS_BCOPY = 0x2BA - SYS_BZERO = 0x2BB - SYS_CATCLOSE = 0x2B6 - SYS_CATGETS = 0x2B7 - SYS_CATOPEN = 0x2B8 - SYS_CRYPT = 0x2AC - SYS_DBM_CLEARERR = 0x2F7 - SYS_DBM_CLOSE = 0x2F8 - SYS_DBM_DELETE = 0x2F9 - SYS_DBM_ERROR = 0x2FA - SYS_DBM_FETCH = 0x2FB - SYS_DBM_FIRSTKEY = 0x2FC - SYS_DBM_NEXTKEY = 0x2FD - SYS_DBM_OPEN = 0x2FE - SYS_DBM_STORE = 0x2FF - SYS_DRAND48 = 0x2B2 - SYS_ENCRYPT = 0x2AD - SYS_ENDUTXENT = 0x2E1 - SYS_ERAND48 = 0x2B3 - SYS_ERF = 0x02C - SYS_ERFC = 0x02D - SYS_FCHDIR = 0x2D9 - SYS_FFS = 0x2BC - SYS_FMTMSG = 0x2E5 - SYS_FSTATVFS = 0x2B4 - SYS_FTIME = 0x2F5 - SYS_GAMMA = 0x02E - SYS_GETDATE = 0x2A6 - SYS_GETPAGESIZE = 0x2D8 - SYS_GETTIMEOFDAY = 0x2F6 - SYS_GETUTXENT = 0x2E0 - SYS_GETUTXID = 0x2E2 - SYS_GETUTXLINE = 0x2E3 - SYS_HCREATE = 0x2C6 - SYS_HDESTROY = 0x2C7 - SYS_HSEARCH = 0x2C8 - SYS_HYPOT = 0x02B - SYS_INDEX = 0x2BD - SYS_INITSTATE = 0x2C2 - SYS_INSQUE = 0x2CF - SYS_ISASCII = 0x2ED - SYS_JRAND48 = 0x2E6 - SYS_L64A = 0x2F0 - SYS_LCONG48 = 0x2EA - SYS_LFIND = 0x2C9 - SYS_LRAND48 = 0x2E7 - SYS_LSEARCH = 0x2CA - SYS_MEMCCPY = 0x2D4 - SYS_MRAND48 = 0x2E8 - SYS_NRAND48 = 0x2E9 - SYS_PCLOSE = 0x2D2 - SYS_POPEN = 0x2D1 - SYS_PUTUTXLINE = 0x2E4 - SYS_RANDOM = 0x2C4 - SYS_REMQUE = 0x2D0 - SYS_RINDEX = 0x2BE - SYS_SEED48 = 0x2EC - SYS_SETKEY = 0x2AE - SYS_SETSTATE = 0x2C3 - SYS_SETUTXENT = 0x2DF - SYS_SRAND48 = 0x2EB - SYS_SRANDOM = 0x2C5 - SYS_STATVFS = 0x2B5 - SYS_STRCASECMP = 0x2BF - SYS_STRDUP = 0x2C0 - SYS_STRNCASECMP = 0x2C1 - SYS_SWAB = 0x2D3 - SYS_TDELETE = 0x2CB - SYS_TFIND = 0x2CC - SYS_TOASCII = 0x2EE - SYS_TSEARCH = 0x2CD - SYS_TWALK = 0x2CE - SYS_UALARM = 0x2F1 - SYS_USLEEP = 0x2F2 - SYS_WAIT3 = 0x2A7 - SYS_WAITID = 0x2A8 - SYS_Y1 = 0x02A - SYS___ATOE = 0x2DB - SYS___ATOE_L = 0x2DC - SYS___CATTRM = 0x2A9 - SYS___CNVBLK = 0x2AF - SYS___CRYTRM = 0x2B0 - SYS___DLGHT = 0x2A1 - SYS___ECRTRM = 0x2B1 - SYS___ETOA = 0x2DD - SYS___ETOA_L = 0x2DE - SYS___GDTRM = 0x2AA - SYS___OCLCK = 0x2DA - SYS___OPARGF = 0x2A2 - SYS___OPERRF = 0x2A5 - SYS___OPINDF = 0x2A4 - SYS___OPOPTF = 0x2A3 - SYS___RNDTRM = 0x2AB - SYS___SRCTRM = 0x2F4 - SYS___TZONE = 0x2A0 - SYS___UTXTRM = 0x2F3 - SYS_ASIN = 0x03E - SYS_ISXDIGIT = 0x03B - SYS_SETLOCAL = 0x03A - SYS_SETLOCALE = 0x03A - SYS_SIN = 0x03F - SYS_TOLOWER = 0x03C - SYS_TOUPPER = 0x03D - SYS_ACCEPT_AND_RECV = 0x4F7 - SYS_ATOL = 0x04E - SYS_CHECKSCH = 0x4BC - SYS_CHECKSCHENV = 0x4BC - SYS_CLEARERR = 0x04C - SYS_CONNECTS = 0x4B5 - SYS_CONNECTSERVER = 0x4B5 - SYS_CONNECTW = 0x4B4 - SYS_CONNECTWORKMGR = 0x4B4 - SYS_CONTINUE = 0x4B3 - SYS_CONTINUEWORKUNIT = 0x4B3 - SYS_COPYSIGN = 0x4C2 - SYS_CREATEWO = 0x4B2 - SYS_CREATEWORKUNIT = 0x4B2 - SYS_DELETEWO = 0x4B9 - SYS_DELETEWORKUNIT = 0x4B9 - SYS_DISCONNE = 0x4B6 - SYS_DISCONNECTSERVER = 0x4B6 - SYS_FEOF = 0x04D - SYS_FERROR = 0x04A - SYS_FINITE = 0x4C8 - SYS_GAMMA_R = 0x4E2 - SYS_JOINWORK = 0x4B7 - SYS_JOINWORKUNIT = 0x4B7 - SYS_LEAVEWOR = 0x4B8 - SYS_LEAVEWORKUNIT = 0x4B8 - SYS_LGAMMA_R = 0x4EB - SYS_MATHERR = 0x4D0 - SYS_PERROR = 0x04F - SYS_QUERYMET = 0x4BA - SYS_QUERYMETRICS = 0x4BA - SYS_QUERYSCH = 0x4BB - SYS_QUERYSCHENV = 0x4BB - SYS_REWIND = 0x04B - SYS_SCALBN = 0x4D4 - SYS_SIGNIFIC = 0x4D5 - SYS_SIGNIFICAND = 0x4D5 - SYS___ACOSH_B = 0x4DA - SYS___ACOS_B = 0x4D9 - SYS___ASINH_B = 0x4BE - SYS___ASIN_B = 0x4DB - SYS___ATAN2_B = 0x4DC - SYS___ATANH_B = 0x4DD - SYS___ATAN_B = 0x4BF - SYS___CBRT_B = 0x4C0 - SYS___CEIL_B = 0x4C1 - SYS___COSH_B = 0x4DE - SYS___COS_B = 0x4C3 - SYS___DGHT = 0x4A8 - SYS___ENVN = 0x4B0 - SYS___ERFC_B = 0x4C5 - SYS___ERF_B = 0x4C4 - SYS___EXPM1_B = 0x4C6 - SYS___EXP_B = 0x4DF - SYS___FABS_B = 0x4C7 - SYS___FLOOR_B = 0x4C9 - SYS___FMOD_B = 0x4E0 - SYS___FP_SETMODE = 0x4F8 - SYS___FREXP_B = 0x4CA - SYS___GAMMA_B = 0x4E1 - SYS___GDRR = 0x4A1 - SYS___HRRNO = 0x4A2 - SYS___HYPOT_B = 0x4E3 - SYS___ILOGB_B = 0x4CB - SYS___ISNAN_B = 0x4CC - SYS___J0_B = 0x4E4 - SYS___J1_B = 0x4E6 - SYS___JN_B = 0x4E8 - SYS___LDEXP_B = 0x4CD - SYS___LGAMMA_B = 0x4EA - SYS___LOG10_B = 0x4ED - SYS___LOG1P_B = 0x4CE - SYS___LOGB_B = 0x4CF - SYS___LOGIN = 0x4F5 - SYS___LOG_B = 0x4EC - SYS___MLOCKALL = 0x4B1 - SYS___MODF_B = 0x4D1 - SYS___NEXTAFTER_B = 0x4D2 - SYS___OPENDIR2 = 0x4F3 - SYS___OPEN_STAT = 0x4F6 - SYS___OPND = 0x4A5 - SYS___OPPT = 0x4A6 - SYS___OPRG = 0x4A3 - SYS___OPRR = 0x4A4 - SYS___PID_AFFINITY = 0x4BD - SYS___POW_B = 0x4EE - SYS___READDIR2 = 0x4F4 - SYS___REMAINDER_B = 0x4EF - SYS___RINT_B = 0x4D3 - SYS___SCALB_B = 0x4F0 - SYS___SIGACTIONSET = 0x4FB - SYS___SIGGM = 0x4A7 - SYS___SINH_B = 0x4F1 - SYS___SIN_B = 0x4D6 - SYS___SQRT_B = 0x4F2 - SYS___TANH_B = 0x4D8 - SYS___TAN_B = 0x4D7 - SYS___TRRNO = 0x4AF - SYS___TZNE = 0x4A9 - SYS___TZZN = 0x4AA - SYS___UCREATE = 0x4FC - SYS___UFREE = 0x4FE - SYS___UHEAPREPORT = 0x4FF - SYS___UMALLOC = 0x4FD - SYS___Y0_B = 0x4E5 - SYS___Y1_B = 0x4E7 - SYS___YN_B = 0x4E9 - SYS_ABORT = 0x05C - SYS_ASCTIME_R = 0x5E0 - SYS_ATEXIT = 0x05D - SYS_CONNECTE = 0x5AE - SYS_CONNECTEXPORTIMPORT = 0x5AE - SYS_CTIME_R = 0x5E1 - SYS_DN_COMP = 0x5DF - SYS_DN_EXPAND = 0x5DD - SYS_DN_SKIPNAME = 0x5DE - SYS_EXIT = 0x05A - SYS_EXPORTWO = 0x5A1 - SYS_EXPORTWORKUNIT = 0x5A1 - SYS_EXTRACTW = 0x5A5 - SYS_EXTRACTWORKUNIT = 0x5A5 - SYS_FSEEKO = 0x5C9 - SYS_FTELLO = 0x5C8 - SYS_GETGRGID_R = 0x5E7 - SYS_GETGRNAM_R = 0x5E8 - SYS_GETLOGIN_R = 0x5E9 - SYS_GETPWNAM_R = 0x5EA - SYS_GETPWUID_R = 0x5EB - SYS_GMTIME_R = 0x5E2 - SYS_IMPORTWO = 0x5A3 - SYS_IMPORTWORKUNIT = 0x5A3 - SYS_INET_NTOP = 0x5D3 - SYS_INET_PTON = 0x5D4 - SYS_LLABS = 0x5CE - SYS_LLDIV = 0x5CB - SYS_LOCALTIME_R = 0x5E3 - SYS_PTHREAD_ATFORK = 0x5ED - SYS_PTHREAD_ATTR_GETDETACHSTATE_U98 = 0x5FB - SYS_PTHREAD_ATTR_GETGUARDSIZE = 0x5EE - SYS_PTHREAD_ATTR_GETSCHEDPARAM = 0x5F9 - SYS_PTHREAD_ATTR_GETSTACKADDR = 0x5EF - SYS_PTHREAD_ATTR_SETDETACHSTATE_U98 = 0x5FC - SYS_PTHREAD_ATTR_SETGUARDSIZE = 0x5F0 - SYS_PTHREAD_ATTR_SETSCHEDPARAM = 0x5FA - SYS_PTHREAD_ATTR_SETSTACKADDR = 0x5F1 - SYS_PTHREAD_CONDATTR_GETPSHARED = 0x5F2 - SYS_PTHREAD_CONDATTR_SETPSHARED = 0x5F3 - SYS_PTHREAD_DETACH_U98 = 0x5FD - SYS_PTHREAD_GETCONCURRENCY = 0x5F4 - SYS_PTHREAD_GETSPECIFIC_U98 = 0x5FE - SYS_PTHREAD_KEY_DELETE = 0x5F5 - SYS_PTHREAD_SETCANCELSTATE = 0x5FF - SYS_PTHREAD_SETCONCURRENCY = 0x5F6 - SYS_PTHREAD_SIGMASK = 0x5F7 - SYS_QUERYENC = 0x5AD - SYS_QUERYWORKUNITCLASSIFICATION = 0x5AD - SYS_RAISE = 0x05E - SYS_RAND_R = 0x5E4 - SYS_READDIR_R = 0x5E6 - SYS_REALLOC = 0x05B - SYS_RES_INIT = 0x5D8 - SYS_RES_MKQUERY = 0x5D7 - SYS_RES_QUERY = 0x5D9 - SYS_RES_QUERYDOMAIN = 0x5DC - SYS_RES_SEARCH = 0x5DA - SYS_RES_SEND = 0x5DB - SYS_SETJMP = 0x05F - SYS_SIGQUEUE = 0x5A9 - SYS_STRTOK_R = 0x5E5 - SYS_STRTOLL = 0x5B0 - SYS_STRTOULL = 0x5B1 - SYS_TTYNAME_R = 0x5EC - SYS_UNDOEXPO = 0x5A2 - SYS_UNDOEXPORTWORKUNIT = 0x5A2 - SYS_UNDOIMPO = 0x5A4 - SYS_UNDOIMPORTWORKUNIT = 0x5A4 - SYS_WCSTOLL = 0x5CC - SYS_WCSTOULL = 0x5CD - SYS___ABORT = 0x05C - SYS___CONSOLE2 = 0x5D2 - SYS___CPL = 0x5A6 - SYS___DISCARDDATA = 0x5F8 - SYS___DSA_PREV = 0x5B2 - SYS___EP_FIND = 0x5B3 - SYS___FP_SWAPMODE = 0x5AF - SYS___GETUSERID = 0x5AB - SYS___GET_CPUID = 0x5B9 - SYS___GET_SYSTEM_SETTINGS = 0x5BA - SYS___IPDOMAINNAME = 0x5AC - SYS___MAP_INIT = 0x5A7 - SYS___MAP_SERVICE = 0x5A8 - SYS___MOUNT = 0x5AA - SYS___MSGRCV_TIMED = 0x5B7 - SYS___RES = 0x5D6 - SYS___SEMOP_TIMED = 0x5B8 - SYS___SERVER_THREADS_QUERY = 0x5B4 - SYS_FPRINTF = 0x06D - SYS_FSCANF = 0x06A - SYS_PRINTF = 0x06F - SYS_SETBUF = 0x06B - SYS_SETVBUF = 0x06C - SYS_SSCANF = 0x06E - SYS___CATGETS_A = 0x6C0 - SYS___CHAUDIT_A = 0x6F4 - SYS___CHMOD_A = 0x6E8 - SYS___COLLATE_INIT_A = 0x6AC - SYS___CREAT_A = 0x6F6 - SYS___CTYPE_INIT_A = 0x6AF - SYS___DLLLOAD_A = 0x6DF - SYS___DLLQUERYFN_A = 0x6E0 - SYS___DLLQUERYVAR_A = 0x6E1 - SYS___E2A_L = 0x6E3 - SYS___EXECLE_A = 0x6A0 - SYS___EXECLP_A = 0x6A4 - SYS___EXECVE_A = 0x6C1 - SYS___EXECVP_A = 0x6C2 - SYS___EXECV_A = 0x6B1 - SYS___FPRINTF_A = 0x6FA - SYS___GETADDRINFO_A = 0x6BF - SYS___GETNAMEINFO_A = 0x6C4 - SYS___GET_WCTYPE_STD_A = 0x6AE - SYS___ICONV_OPEN_A = 0x6DE - SYS___IF_INDEXTONAME_A = 0x6DC - SYS___IF_NAMETOINDEX_A = 0x6DB - SYS___ISWCTYPE_A = 0x6B0 - SYS___IS_WCTYPE_STD_A = 0x6B2 - SYS___LOCALECONV_A = 0x6B8 - SYS___LOCALECONV_STD_A = 0x6B9 - SYS___LOCALE_INIT_A = 0x6B7 - SYS___LSTAT_A = 0x6EE - SYS___LSTAT_O_A = 0x6EF - SYS___MKDIR_A = 0x6E9 - SYS___MKFIFO_A = 0x6EC - SYS___MKNOD_A = 0x6F0 - SYS___MONETARY_INIT_A = 0x6BC - SYS___MOUNT_A = 0x6F1 - SYS___NL_CSINFO_A = 0x6D6 - SYS___NL_LANGINFO_A = 0x6BA - SYS___NL_LNAGINFO_STD_A = 0x6BB - SYS___NL_MONINFO_A = 0x6D7 - SYS___NL_NUMINFO_A = 0x6D8 - SYS___NL_RESPINFO_A = 0x6D9 - SYS___NL_TIMINFO_A = 0x6DA - SYS___NUMERIC_INIT_A = 0x6C6 - SYS___OPEN_A = 0x6F7 - SYS___PRINTF_A = 0x6DD - SYS___RESP_INIT_A = 0x6C7 - SYS___RPMATCH_A = 0x6C8 - SYS___RPMATCH_C_A = 0x6C9 - SYS___RPMATCH_STD_A = 0x6CA - SYS___SETLOCALE_A = 0x6F9 - SYS___SPAWNP_A = 0x6C5 - SYS___SPAWN_A = 0x6C3 - SYS___SPRINTF_A = 0x6FB - SYS___STAT_A = 0x6EA - SYS___STAT_O_A = 0x6EB - SYS___STRCOLL_STD_A = 0x6A1 - SYS___STRFMON_A = 0x6BD - SYS___STRFMON_STD_A = 0x6BE - SYS___STRFTIME_A = 0x6CC - SYS___STRFTIME_STD_A = 0x6CD - SYS___STRPTIME_A = 0x6CE - SYS___STRPTIME_STD_A = 0x6CF - SYS___STRXFRM_A = 0x6A2 - SYS___STRXFRM_C_A = 0x6A3 - SYS___STRXFRM_STD_A = 0x6A5 - SYS___SYNTAX_INIT_A = 0x6D4 - SYS___TIME_INIT_A = 0x6CB - SYS___TOD_INIT_A = 0x6D5 - SYS___TOWLOWER_A = 0x6B3 - SYS___TOWLOWER_STD_A = 0x6B4 - SYS___TOWUPPER_A = 0x6B5 - SYS___TOWUPPER_STD_A = 0x6B6 - SYS___UMOUNT_A = 0x6F2 - SYS___VFPRINTF_A = 0x6FC - SYS___VPRINTF_A = 0x6FD - SYS___VSPRINTF_A = 0x6FE - SYS___VSWPRINTF_A = 0x6FF - SYS___WCSCOLL_A = 0x6A6 - SYS___WCSCOLL_C_A = 0x6A7 - SYS___WCSCOLL_STD_A = 0x6A8 - SYS___WCSFTIME_A = 0x6D0 - SYS___WCSFTIME_STD_A = 0x6D1 - SYS___WCSXFRM_A = 0x6A9 - SYS___WCSXFRM_C_A = 0x6AA - SYS___WCSXFRM_STD_A = 0x6AB - SYS___WCTYPE_A = 0x6AD - SYS___W_GETMNTENT_A = 0x6F5 - SYS_____CCSIDTYPE_A = 0x6E6 - SYS_____CHATTR_A = 0x6E2 - SYS_____CSNAMETYPE_A = 0x6E7 - SYS_____OPEN_STAT_A = 0x6ED - SYS_____SPAWN2_A = 0x6D2 - SYS_____SPAWNP2_A = 0x6D3 - SYS_____TOCCSID_A = 0x6E4 - SYS_____TOCSNAME_A = 0x6E5 - SYS_ACL_FREE = 0x7FF - SYS_ACL_INIT = 0x7FE - SYS_FWIDE = 0x7DF - SYS_FWPRINTF = 0x7D1 - SYS_FWRITE = 0x07E - SYS_FWSCANF = 0x7D5 - SYS_GETCHAR = 0x07B - SYS_GETS = 0x07C - SYS_M_CREATE_LAYOUT = 0x7C9 - SYS_M_DESTROY_LAYOUT = 0x7CA - SYS_M_GETVALUES_LAYOUT = 0x7CB - SYS_M_SETVALUES_LAYOUT = 0x7CC - SYS_M_TRANSFORM_LAYOUT = 0x7CD - SYS_M_WTRANSFORM_LAYOUT = 0x7CE - SYS_PREAD = 0x7C7 - SYS_PUTC = 0x07D - SYS_PUTCHAR = 0x07A - SYS_PUTS = 0x07F - SYS_PWRITE = 0x7C8 - SYS_TOWCTRAN = 0x7D8 - SYS_TOWCTRANS = 0x7D8 - SYS_UNATEXIT = 0x7B5 - SYS_VFWPRINT = 0x7D3 - SYS_VFWPRINTF = 0x7D3 - SYS_VWPRINTF = 0x7D4 - SYS_WCTRANS = 0x7D7 - SYS_WPRINTF = 0x7D2 - SYS_WSCANF = 0x7D6 - SYS___ASCTIME_R_A = 0x7A1 - SYS___BASENAME_A = 0x7DC - SYS___BTOWC_A = 0x7E4 - SYS___CDUMP_A = 0x7B7 - SYS___CEE3DMP_A = 0x7B6 - SYS___CEILF_H = 0x7F4 - SYS___CEILL_H = 0x7F5 - SYS___CEIL_H = 0x7EA - SYS___CRYPT_A = 0x7BE - SYS___CSNAP_A = 0x7B8 - SYS___CTEST_A = 0x7B9 - SYS___CTIME_R_A = 0x7A2 - SYS___CTRACE_A = 0x7BA - SYS___DBM_OPEN_A = 0x7E6 - SYS___DIRNAME_A = 0x7DD - SYS___FABSF_H = 0x7FA - SYS___FABSL_H = 0x7FB - SYS___FABS_H = 0x7ED - SYS___FGETWC_A = 0x7AA - SYS___FGETWS_A = 0x7AD - SYS___FLOORF_H = 0x7F6 - SYS___FLOORL_H = 0x7F7 - SYS___FLOOR_H = 0x7EB - SYS___FPUTWC_A = 0x7A5 - SYS___FPUTWS_A = 0x7A8 - SYS___GETTIMEOFDAY_A = 0x7AE - SYS___GETWCHAR_A = 0x7AC - SYS___GETWC_A = 0x7AB - SYS___GLOB_A = 0x7DE - SYS___GMTIME_A = 0x7AF - SYS___GMTIME_R_A = 0x7B0 - SYS___INET_PTON_A = 0x7BC - SYS___J0_H = 0x7EE - SYS___J1_H = 0x7EF - SYS___JN_H = 0x7F0 - SYS___LOCALTIME_A = 0x7B1 - SYS___LOCALTIME_R_A = 0x7B2 - SYS___MALLOC24 = 0x7FC - SYS___MALLOC31 = 0x7FD - SYS___MKTIME_A = 0x7B3 - SYS___MODFF_H = 0x7F8 - SYS___MODFL_H = 0x7F9 - SYS___MODF_H = 0x7EC - SYS___OPENDIR_A = 0x7C2 - SYS___OSNAME = 0x7E0 - SYS___PUTWCHAR_A = 0x7A7 - SYS___PUTWC_A = 0x7A6 - SYS___READDIR_A = 0x7C3 - SYS___STRTOLL_A = 0x7A3 - SYS___STRTOULL_A = 0x7A4 - SYS___SYSLOG_A = 0x7BD - SYS___TZZNA = 0x7B4 - SYS___UNGETWC_A = 0x7A9 - SYS___UTIME_A = 0x7A0 - SYS___VFPRINTF2_A = 0x7E7 - SYS___VPRINTF2_A = 0x7E8 - SYS___VSPRINTF2_A = 0x7E9 - SYS___VSWPRNTF2_A = 0x7BB - SYS___WCSTOD_A = 0x7D9 - SYS___WCSTOL_A = 0x7DA - SYS___WCSTOUL_A = 0x7DB - SYS___WCTOB_A = 0x7E5 - SYS___Y0_H = 0x7F1 - SYS___Y1_H = 0x7F2 - SYS___YN_H = 0x7F3 - SYS_____OPENDIR2_A = 0x7BF - SYS_____OSNAME_A = 0x7E1 - SYS_____READDIR2_A = 0x7C0 - SYS_DLCLOSE = 0x8DF - SYS_DLERROR = 0x8E0 - SYS_DLOPEN = 0x8DD - SYS_DLSYM = 0x8DE - SYS_FLOCKFILE = 0x8D3 - SYS_FTRYLOCKFILE = 0x8D4 - SYS_FUNLOCKFILE = 0x8D5 - SYS_GETCHAR_UNLOCKED = 0x8D7 - SYS_GETC_UNLOCKED = 0x8D6 - SYS_PUTCHAR_UNLOCKED = 0x8D9 - SYS_PUTC_UNLOCKED = 0x8D8 - SYS_SNPRINTF = 0x8DA - SYS_VSNPRINTF = 0x8DB - SYS_WCSCSPN = 0x08B - SYS_WCSLEN = 0x08C - SYS_WCSNCAT = 0x08D - SYS_WCSNCMP = 0x08A - SYS_WCSNCPY = 0x08F - SYS_WCSSPN = 0x08E - SYS___ABSF_H = 0x8E7 - SYS___ABSL_H = 0x8E8 - SYS___ABS_H = 0x8E6 - SYS___ACOSF_H = 0x8EA - SYS___ACOSH_H = 0x8EC - SYS___ACOSL_H = 0x8EB - SYS___ACOS_H = 0x8E9 - SYS___ASINF_H = 0x8EE - SYS___ASINH_H = 0x8F0 - SYS___ASINL_H = 0x8EF - SYS___ASIN_H = 0x8ED - SYS___ATAN2F_H = 0x8F8 - SYS___ATAN2L_H = 0x8F9 - SYS___ATAN2_H = 0x8F7 - SYS___ATANF_H = 0x8F2 - SYS___ATANHF_H = 0x8F5 - SYS___ATANHL_H = 0x8F6 - SYS___ATANH_H = 0x8F4 - SYS___ATANL_H = 0x8F3 - SYS___ATAN_H = 0x8F1 - SYS___CBRT_H = 0x8FA - SYS___COPYSIGNF_H = 0x8FB - SYS___COPYSIGNL_H = 0x8FC - SYS___COSF_H = 0x8FE - SYS___COSL_H = 0x8FF - SYS___COS_H = 0x8FD - SYS___DLERROR_A = 0x8D2 - SYS___DLOPEN_A = 0x8D0 - SYS___DLSYM_A = 0x8D1 - SYS___GETUTXENT_A = 0x8C6 - SYS___GETUTXID_A = 0x8C7 - SYS___GETUTXLINE_A = 0x8C8 - SYS___ITOA = 0x8AA - SYS___ITOA_A = 0x8B0 - SYS___LE_CONDITION_TOKEN_BUILD = 0x8A5 - SYS___LE_MSG_ADD_INSERT = 0x8A6 - SYS___LE_MSG_GET = 0x8A7 - SYS___LE_MSG_GET_AND_WRITE = 0x8A8 - SYS___LE_MSG_WRITE = 0x8A9 - SYS___LLTOA = 0x8AE - SYS___LLTOA_A = 0x8B4 - SYS___LTOA = 0x8AC - SYS___LTOA_A = 0x8B2 - SYS___PUTCHAR_UNLOCKED_A = 0x8CC - SYS___PUTC_UNLOCKED_A = 0x8CB - SYS___PUTUTXLINE_A = 0x8C9 - SYS___RESET_EXCEPTION_HANDLER = 0x8E3 - SYS___REXEC_A = 0x8C4 - SYS___REXEC_AF_A = 0x8C5 - SYS___SET_EXCEPTION_HANDLER = 0x8E2 - SYS___SNPRINTF_A = 0x8CD - SYS___SUPERKILL = 0x8A4 - SYS___TCGETATTR_A = 0x8A1 - SYS___TCSETATTR_A = 0x8A2 - SYS___ULLTOA = 0x8AF - SYS___ULLTOA_A = 0x8B5 - SYS___ULTOA = 0x8AD - SYS___ULTOA_A = 0x8B3 - SYS___UTOA = 0x8AB - SYS___UTOA_A = 0x8B1 - SYS___VHM_EVENT = 0x8E4 - SYS___VSNPRINTF_A = 0x8CE - SYS_____GETENV_A = 0x8C3 - SYS_____UTMPXNAME_A = 0x8CA - SYS_CACOSH = 0x9A0 - SYS_CACOSHF = 0x9A3 - SYS_CACOSHL = 0x9A6 - SYS_CARG = 0x9A9 - SYS_CARGF = 0x9AC - SYS_CARGL = 0x9AF - SYS_CASIN = 0x9B2 - SYS_CASINF = 0x9B5 - SYS_CASINH = 0x9BB - SYS_CASINHF = 0x9BE - SYS_CASINHL = 0x9C1 - SYS_CASINL = 0x9B8 - SYS_CATAN = 0x9C4 - SYS_CATANF = 0x9C7 - SYS_CATANH = 0x9CD - SYS_CATANHF = 0x9D0 - SYS_CATANHL = 0x9D3 - SYS_CATANL = 0x9CA - SYS_CCOS = 0x9D6 - SYS_CCOSF = 0x9D9 - SYS_CCOSH = 0x9DF - SYS_CCOSHF = 0x9E2 - SYS_CCOSHL = 0x9E5 - SYS_CCOSL = 0x9DC - SYS_CEXP = 0x9E8 - SYS_CEXPF = 0x9EB - SYS_CEXPL = 0x9EE - SYS_CIMAG = 0x9F1 - SYS_CIMAGF = 0x9F4 - SYS_CIMAGL = 0x9F7 - SYS_CLOGF = 0x9FD - SYS_MEMCHR = 0x09B - SYS_MEMCMP = 0x09A - SYS_STRCOLL = 0x09C - SYS_STRNCMP = 0x09D - SYS_STRRCHR = 0x09F - SYS_STRXFRM = 0x09E - SYS___CACOSHF_B = 0x9A4 - SYS___CACOSHF_H = 0x9A5 - SYS___CACOSHL_B = 0x9A7 - SYS___CACOSHL_H = 0x9A8 - SYS___CACOSH_B = 0x9A1 - SYS___CACOSH_H = 0x9A2 - SYS___CARGF_B = 0x9AD - SYS___CARGF_H = 0x9AE - SYS___CARGL_B = 0x9B0 - SYS___CARGL_H = 0x9B1 - SYS___CARG_B = 0x9AA - SYS___CARG_H = 0x9AB - SYS___CASINF_B = 0x9B6 - SYS___CASINF_H = 0x9B7 - SYS___CASINHF_B = 0x9BF - SYS___CASINHF_H = 0x9C0 - SYS___CASINHL_B = 0x9C2 - SYS___CASINHL_H = 0x9C3 - SYS___CASINH_B = 0x9BC - SYS___CASINH_H = 0x9BD - SYS___CASINL_B = 0x9B9 - SYS___CASINL_H = 0x9BA - SYS___CASIN_B = 0x9B3 - SYS___CASIN_H = 0x9B4 - SYS___CATANF_B = 0x9C8 - SYS___CATANF_H = 0x9C9 - SYS___CATANHF_B = 0x9D1 - SYS___CATANHF_H = 0x9D2 - SYS___CATANHL_B = 0x9D4 - SYS___CATANHL_H = 0x9D5 - SYS___CATANH_B = 0x9CE - SYS___CATANH_H = 0x9CF - SYS___CATANL_B = 0x9CB - SYS___CATANL_H = 0x9CC - SYS___CATAN_B = 0x9C5 - SYS___CATAN_H = 0x9C6 - SYS___CCOSF_B = 0x9DA - SYS___CCOSF_H = 0x9DB - SYS___CCOSHF_B = 0x9E3 - SYS___CCOSHF_H = 0x9E4 - SYS___CCOSHL_B = 0x9E6 - SYS___CCOSHL_H = 0x9E7 - SYS___CCOSH_B = 0x9E0 - SYS___CCOSH_H = 0x9E1 - SYS___CCOSL_B = 0x9DD - SYS___CCOSL_H = 0x9DE - SYS___CCOS_B = 0x9D7 - SYS___CCOS_H = 0x9D8 - SYS___CEXPF_B = 0x9EC - SYS___CEXPF_H = 0x9ED - SYS___CEXPL_B = 0x9EF - SYS___CEXPL_H = 0x9F0 - SYS___CEXP_B = 0x9E9 - SYS___CEXP_H = 0x9EA - SYS___CIMAGF_B = 0x9F5 - SYS___CIMAGF_H = 0x9F6 - SYS___CIMAGL_B = 0x9F8 - SYS___CIMAGL_H = 0x9F9 - SYS___CIMAG_B = 0x9F2 - SYS___CIMAG_H = 0x9F3 - SYS___CLOG = 0x9FA - SYS___CLOGF_B = 0x9FE - SYS___CLOGF_H = 0x9FF - SYS___CLOG_B = 0x9FB - SYS___CLOG_H = 0x9FC - SYS_ISWCTYPE = 0x10C - SYS_ISWXDIGI = 0x10A - SYS_ISWXDIGIT = 0x10A - SYS_MBSINIT = 0x10F - SYS_TOWLOWER = 0x10D - SYS_TOWUPPER = 0x10E - SYS_WCTYPE = 0x10B - SYS_WCSSTR = 0x11B - SYS___RPMTCH = 0x11A - SYS_WCSTOD = 0x12E - SYS_WCSTOK = 0x12C - SYS_WCSTOL = 0x12D - SYS_WCSTOUL = 0x12F - SYS_FGETWC = 0x13C - SYS_FGETWS = 0x13D - SYS_FPUTWC = 0x13E - SYS_FPUTWS = 0x13F - SYS_REGERROR = 0x13B - SYS_REGFREE = 0x13A - SYS_COLLEQUIV = 0x14F - SYS_COLLTOSTR = 0x14E - SYS_ISMCCOLLEL = 0x14C - SYS_STRTOCOLL = 0x14D - SYS_DLLFREE = 0x16F - SYS_DLLQUERYFN = 0x16D - SYS_DLLQUERYVAR = 0x16E - SYS_GETMCCOLL = 0x16A - SYS_GETWMCCOLL = 0x16B - SYS___ERR2AD = 0x16C - SYS_CFSETOSPEED = 0x17A - SYS_CHDIR = 0x17B - SYS_CHMOD = 0x17C - SYS_CHOWN = 0x17D - SYS_CLOSE = 0x17E - SYS_CLOSEDIR = 0x17F - SYS_LOG = 0x017 - SYS_COSH = 0x018 - SYS_FCHMOD = 0x18A - SYS_FCHOWN = 0x18B - SYS_FCNTL = 0x18C - SYS_FILENO = 0x18D - SYS_FORK = 0x18E - SYS_FPATHCONF = 0x18F - SYS_GETLOGIN = 0x19A - SYS_GETPGRP = 0x19C - SYS_GETPID = 0x19D - SYS_GETPPID = 0x19E - SYS_GETPWNAM = 0x19F - SYS_TANH = 0x019 - SYS_W_GETMNTENT = 0x19B - SYS_POW = 0x020 - SYS_PTHREAD_SELF = 0x20A - SYS_PTHREAD_SETINTR = 0x20B - SYS_PTHREAD_SETINTRTYPE = 0x20C - SYS_PTHREAD_SETSPECIFIC = 0x20D - SYS_PTHREAD_TESTINTR = 0x20E - SYS_PTHREAD_YIELD = 0x20F - SYS_SQRT = 0x021 - SYS_FLOOR = 0x022 - SYS_J1 = 0x023 - SYS_WCSPBRK = 0x23F - SYS_BSEARCH = 0x24C - SYS_FABS = 0x024 - SYS_GETENV = 0x24A - SYS_LDIV = 0x24D - SYS_SYSTEM = 0x24B - SYS_FMOD = 0x025 - SYS___RETHROW = 0x25F - SYS___THROW = 0x25E - SYS_J0 = 0x026 - SYS_PUTENV = 0x26A - SYS___GETENV = 0x26F - SYS_SEMCTL = 0x27A - SYS_SEMGET = 0x27B - SYS_SEMOP = 0x27C - SYS_SHMAT = 0x27D - SYS_SHMCTL = 0x27E - SYS_SHMDT = 0x27F - SYS_YN = 0x027 - SYS_JN = 0x028 - SYS_SIGALTSTACK = 0x28A - SYS_SIGHOLD = 0x28B - SYS_SIGIGNORE = 0x28C - SYS_SIGINTERRUPT = 0x28D - SYS_SIGPAUSE = 0x28E - SYS_SIGRELSE = 0x28F - SYS_GETOPT = 0x29A - SYS_GETSUBOPT = 0x29D - SYS_LCHOWN = 0x29B - SYS_SETPGRP = 0x29E - SYS_TRUNCATE = 0x29C - SYS_Y0 = 0x029 - SYS___GDERR = 0x29F - SYS_ISALPHA = 0x030 - SYS_VFORK = 0x30F - SYS__LONGJMP = 0x30D - SYS__SETJMP = 0x30E - SYS_GLOB = 0x31A - SYS_GLOBFREE = 0x31B - SYS_ISALNUM = 0x031 - SYS_PUTW = 0x31C - SYS_SEEKDIR = 0x31D - SYS_TELLDIR = 0x31E - SYS_TEMPNAM = 0x31F - SYS_GETTIMEOFDAY_R = 0x32E - SYS_ISLOWER = 0x032 - SYS_LGAMMA = 0x32C - SYS_REMAINDER = 0x32A - SYS_SCALB = 0x32B - SYS_SYNC = 0x32F - SYS_TTYSLOT = 0x32D - SYS_ENDPROTOENT = 0x33A - SYS_ENDSERVENT = 0x33B - SYS_GETHOSTBYADDR = 0x33D - SYS_GETHOSTBYADDR_R = 0x33C - SYS_GETHOSTBYNAME = 0x33F - SYS_GETHOSTBYNAME_R = 0x33E - SYS_ISCNTRL = 0x033 - SYS_GETSERVBYNAME = 0x34A - SYS_GETSERVBYPORT = 0x34B - SYS_GETSERVENT = 0x34C - SYS_GETSOCKNAME = 0x34D - SYS_GETSOCKOPT = 0x34E - SYS_INET_ADDR = 0x34F - SYS_ISDIGIT = 0x034 - SYS_ISGRAPH = 0x035 - SYS_SELECT = 0x35B - SYS_SELECTEX = 0x35C - SYS_SEND = 0x35D - SYS_SENDTO = 0x35F - SYS_CHROOT = 0x36A - SYS_ISNAN = 0x36D - SYS_ISUPPER = 0x036 - SYS_ULIMIT = 0x36C - SYS_UTIMES = 0x36E - SYS_W_STATVFS = 0x36B - SYS___H_ERRNO = 0x36F - SYS_GRANTPT = 0x37A - SYS_ISPRINT = 0x037 - SYS_TCGETSID = 0x37C - SYS_UNLOCKPT = 0x37B - SYS___TCGETCP = 0x37D - SYS___TCSETCP = 0x37E - SYS___TCSETTABLES = 0x37F - SYS_ISPUNCT = 0x038 - SYS_NLIST = 0x38C - SYS___IPDBCS = 0x38D - SYS___IPDSPX = 0x38E - SYS___IPMSGC = 0x38F - SYS___STHOSTENT = 0x38B - SYS___STSERVENT = 0x38A - SYS_ISSPACE = 0x039 - SYS_COS = 0x040 - SYS_T_ALLOC = 0x40A - SYS_T_BIND = 0x40B - SYS_T_CLOSE = 0x40C - SYS_T_CONNECT = 0x40D - SYS_T_ERROR = 0x40E - SYS_T_FREE = 0x40F - SYS_TAN = 0x041 - SYS_T_RCVREL = 0x41A - SYS_T_RCVUDATA = 0x41B - SYS_T_RCVUDERR = 0x41C - SYS_T_SND = 0x41D - SYS_T_SNDDIS = 0x41E - SYS_T_SNDREL = 0x41F - SYS_GETPMSG = 0x42A - SYS_ISASTREAM = 0x42B - SYS_PUTMSG = 0x42C - SYS_PUTPMSG = 0x42D - SYS_SINH = 0x042 - SYS___ISPOSIXON = 0x42E - SYS___OPENMVSREL = 0x42F - SYS_ACOS = 0x043 - SYS_ATAN = 0x044 - SYS_ATAN2 = 0x045 - SYS_FTELL = 0x046 - SYS_FGETPOS = 0x047 - SYS_SOCK_DEBUG = 0x47A - SYS_SOCK_DO_TESTSTOR = 0x47D - SYS_TAKESOCKET = 0x47E - SYS___SERVER_INIT = 0x47F - SYS_FSEEK = 0x048 - SYS___IPHOST = 0x48B - SYS___IPNODE = 0x48C - SYS___SERVER_CLASSIFY_CREATE = 0x48D - SYS___SERVER_CLASSIFY_DESTROY = 0x48E - SYS___SERVER_CLASSIFY_RESET = 0x48F - SYS___SMF_RECORD = 0x48A - SYS_FSETPOS = 0x049 - SYS___FNWSA = 0x49B - SYS___SPAWN2 = 0x49D - SYS___SPAWNP2 = 0x49E - SYS_ATOF = 0x050 - SYS_PTHREAD_MUTEXATTR_GETPSHARED = 0x50A - SYS_PTHREAD_MUTEXATTR_SETPSHARED = 0x50B - SYS_PTHREAD_RWLOCK_DESTROY = 0x50C - SYS_PTHREAD_RWLOCK_INIT = 0x50D - SYS_PTHREAD_RWLOCK_RDLOCK = 0x50E - SYS_PTHREAD_RWLOCK_TRYRDLOCK = 0x50F - SYS_ATOI = 0x051 - SYS___FP_CLASS = 0x51D - SYS___FP_CLR_FLAG = 0x51A - SYS___FP_FINITE = 0x51E - SYS___FP_ISNAN = 0x51F - SYS___FP_RAISE_XCP = 0x51C - SYS___FP_READ_FLAG = 0x51B - SYS_RAND = 0x052 - SYS_SIGTIMEDWAIT = 0x52D - SYS_SIGWAITINFO = 0x52E - SYS___CHKBFP = 0x52F - SYS___FPC_RS = 0x52C - SYS___FPC_RW = 0x52A - SYS___FPC_SM = 0x52B - SYS_STRTOD = 0x053 - SYS_STRTOL = 0x054 - SYS_STRTOUL = 0x055 - SYS_MALLOC = 0x056 - SYS_SRAND = 0x057 - SYS_CALLOC = 0x058 - SYS_FREE = 0x059 - SYS___OSENV = 0x59F - SYS___W_PIOCTL = 0x59E - SYS_LONGJMP = 0x060 - SYS___FLOORF_B = 0x60A - SYS___FLOORL_B = 0x60B - SYS___FREXPF_B = 0x60C - SYS___FREXPL_B = 0x60D - SYS___LDEXPF_B = 0x60E - SYS___LDEXPL_B = 0x60F - SYS_SIGNAL = 0x061 - SYS___ATAN2F_B = 0x61A - SYS___ATAN2L_B = 0x61B - SYS___COSHF_B = 0x61C - SYS___COSHL_B = 0x61D - SYS___EXPF_B = 0x61E - SYS___EXPL_B = 0x61F - SYS_TMPNAM = 0x062 - SYS___ABSF_B = 0x62A - SYS___ABSL_B = 0x62C - SYS___ABS_B = 0x62B - SYS___FMODF_B = 0x62D - SYS___FMODL_B = 0x62E - SYS___MODFF_B = 0x62F - SYS_ATANL = 0x63A - SYS_CEILF = 0x63B - SYS_CEILL = 0x63C - SYS_COSF = 0x63D - SYS_COSHF = 0x63F - SYS_COSL = 0x63E - SYS_REMOVE = 0x063 - SYS_POWL = 0x64A - SYS_RENAME = 0x064 - SYS_SINF = 0x64B - SYS_SINHF = 0x64F - SYS_SINL = 0x64C - SYS_SQRTF = 0x64D - SYS_SQRTL = 0x64E - SYS_BTOWC = 0x65F - SYS_FREXPL = 0x65A - SYS_LDEXPF = 0x65B - SYS_LDEXPL = 0x65C - SYS_MODFF = 0x65D - SYS_MODFL = 0x65E - SYS_TMPFILE = 0x065 - SYS_FREOPEN = 0x066 - SYS___CHARMAP_INIT_A = 0x66E - SYS___GETHOSTBYADDR_R_A = 0x66C - SYS___GETHOSTBYNAME_A = 0x66A - SYS___GETHOSTBYNAME_R_A = 0x66D - SYS___MBLEN_A = 0x66F - SYS___RES_INIT_A = 0x66B - SYS_FCLOSE = 0x067 - SYS___GETGRGID_R_A = 0x67D - SYS___WCSTOMBS_A = 0x67A - SYS___WCSTOMBS_STD_A = 0x67B - SYS___WCSWIDTH_A = 0x67C - SYS___WCSWIDTH_ASIA = 0x67F - SYS___WCSWIDTH_STD_A = 0x67E - SYS_FFLUSH = 0x068 - SYS___GETLOGIN_R_A = 0x68E - SYS___GETPWNAM_R_A = 0x68C - SYS___GETPWUID_R_A = 0x68D - SYS___TTYNAME_R_A = 0x68F - SYS___WCWIDTH_ASIA = 0x68B - SYS___WCWIDTH_STD_A = 0x68A - SYS_FOPEN = 0x069 - SYS___REGEXEC_A = 0x69A - SYS___REGEXEC_STD_A = 0x69B - SYS___REGFREE_A = 0x69C - SYS___REGFREE_STD_A = 0x69D - SYS___STRCOLL_A = 0x69E - SYS___STRCOLL_C_A = 0x69F - SYS_SCANF = 0x070 - SYS___A64L_A = 0x70C - SYS___ECVT_A = 0x70D - SYS___FCVT_A = 0x70E - SYS___GCVT_A = 0x70F - SYS___STRTOUL_A = 0x70A - SYS_____AE_CORRESTBL_QUERY_A = 0x70B - SYS_SPRINTF = 0x071 - SYS___ACCESS_A = 0x71F - SYS___CATOPEN_A = 0x71E - SYS___GETOPT_A = 0x71D - SYS___REALPATH_A = 0x71A - SYS___SETENV_A = 0x71B - SYS___SYSTEM_A = 0x71C - SYS_FGETC = 0x072 - SYS___GAI_STRERROR_A = 0x72F - SYS___RMDIR_A = 0x72A - SYS___STATVFS_A = 0x72B - SYS___SYMLINK_A = 0x72C - SYS___TRUNCATE_A = 0x72D - SYS___UNLINK_A = 0x72E - SYS_VFPRINTF = 0x073 - SYS___ISSPACE_A = 0x73A - SYS___ISUPPER_A = 0x73B - SYS___ISWALNUM_A = 0x73F - SYS___ISXDIGIT_A = 0x73C - SYS___TOLOWER_A = 0x73D - SYS___TOUPPER_A = 0x73E - SYS_VPRINTF = 0x074 - SYS___CONFSTR_A = 0x74B - SYS___FDOPEN_A = 0x74E - SYS___FLDATA_A = 0x74F - SYS___FTOK_A = 0x74C - SYS___ISWXDIGIT_A = 0x74A - SYS___MKTEMP_A = 0x74D - SYS_VSPRINTF = 0x075 - SYS___GETGRGID_A = 0x75A - SYS___GETGRNAM_A = 0x75B - SYS___GETGROUPSBYNAME_A = 0x75C - SYS___GETHOSTENT_A = 0x75D - SYS___GETHOSTNAME_A = 0x75E - SYS___GETLOGIN_A = 0x75F - SYS_GETC = 0x076 - SYS___CREATEWORKUNIT_A = 0x76A - SYS___CTERMID_A = 0x76B - SYS___FMTMSG_A = 0x76C - SYS___INITGROUPS_A = 0x76D - SYS___MSGRCV_A = 0x76F - SYS_____LOGIN_A = 0x76E - SYS_FGETS = 0x077 - SYS___STRCASECMP_A = 0x77B - SYS___STRNCASECMP_A = 0x77C - SYS___TTYNAME_A = 0x77D - SYS___UNAME_A = 0x77E - SYS___UTIMES_A = 0x77F - SYS_____SERVER_PWU_A = 0x77A - SYS_FPUTC = 0x078 - SYS___CREAT_O_A = 0x78E - SYS___ENVNA = 0x78F - SYS___FREAD_A = 0x78A - SYS___FWRITE_A = 0x78B - SYS___ISASCII = 0x78D - SYS___OPEN_O_A = 0x78C - SYS_FPUTS = 0x079 - SYS___ASCTIME_A = 0x79C - SYS___CTIME_A = 0x79D - SYS___GETDATE_A = 0x79E - SYS___GETSERVBYPORT_A = 0x79A - SYS___GETSERVENT_A = 0x79B - SYS___TZSET_A = 0x79F - SYS_ACL_FROM_TEXT = 0x80C - SYS_ACL_SET_FD = 0x80A - SYS_ACL_SET_FILE = 0x80B - SYS_ACL_SORT = 0x80E - SYS_ACL_TO_TEXT = 0x80D - SYS_UNGETC = 0x080 - SYS___SHUTDOWN_REGISTRATION = 0x80F - SYS_FREAD = 0x081 - SYS_FREEADDRINFO = 0x81A - SYS_GAI_STRERROR = 0x81B - SYS_REXEC_AF = 0x81C - SYS___DYNALLOC_A = 0x81F - SYS___POE = 0x81D - SYS_WCSTOMBS = 0x082 - SYS___INET_ADDR_A = 0x82F - SYS___NLIST_A = 0x82A - SYS_____TCGETCP_A = 0x82B - SYS_____TCSETCP_A = 0x82C - SYS_____W_PIOCTL_A = 0x82E - SYS_MBTOWC = 0x083 - SYS___CABEND = 0x83D - SYS___LE_CIB_GET = 0x83E - SYS___RECVMSG_A = 0x83B - SYS___SENDMSG_A = 0x83A - SYS___SET_LAA_FOR_JIT = 0x83F - SYS_____LCHATTR_A = 0x83C - SYS_WCTOMB = 0x084 - SYS___CBRTL_B = 0x84A - SYS___COPYSIGNF_B = 0x84B - SYS___COPYSIGNL_B = 0x84C - SYS___COTANF_B = 0x84D - SYS___COTANL_B = 0x84F - SYS___COTAN_B = 0x84E - SYS_MBSTOWCS = 0x085 - SYS___LOG1PL_B = 0x85A - SYS___LOG2F_B = 0x85B - SYS___LOG2L_B = 0x85D - SYS___LOG2_B = 0x85C - SYS___REMAINDERF_B = 0x85E - SYS___REMAINDERL_B = 0x85F - SYS_ACOSHF = 0x86E - SYS_ACOSHL = 0x86F - SYS_WCSCPY = 0x086 - SYS___ERFCF_B = 0x86D - SYS___ERFF_B = 0x86C - SYS___LROUNDF_B = 0x86A - SYS___LROUND_B = 0x86B - SYS_COTANL = 0x87A - SYS_EXP2F = 0x87B - SYS_EXP2L = 0x87C - SYS_EXPM1F = 0x87D - SYS_EXPM1L = 0x87E - SYS_FDIMF = 0x87F - SYS_WCSCAT = 0x087 - SYS___COTANL = 0x87A - SYS_REMAINDERF = 0x88A - SYS_REMAINDERL = 0x88B - SYS_REMAINDF = 0x88A - SYS_REMAINDL = 0x88B - SYS_REMQUO = 0x88D - SYS_REMQUOF = 0x88C - SYS_REMQUOL = 0x88E - SYS_TGAMMAF = 0x88F - SYS_WCSCHR = 0x088 - SYS_ERFCF = 0x89B - SYS_ERFCL = 0x89C - SYS_ERFL = 0x89A - SYS_EXP2 = 0x89E - SYS_WCSCMP = 0x089 - SYS___EXP2_B = 0x89D - SYS___FAR_JUMP = 0x89F - SYS_ABS = 0x090 - SYS___ERFCL_H = 0x90A - SYS___EXPF_H = 0x90C - SYS___EXPL_H = 0x90D - SYS___EXPM1_H = 0x90E - SYS___EXP_H = 0x90B - SYS___FDIM_H = 0x90F - SYS_DIV = 0x091 - SYS___LOG2F_H = 0x91F - SYS___LOG2_H = 0x91E - SYS___LOGB_H = 0x91D - SYS___LOGF_H = 0x91B - SYS___LOGL_H = 0x91C - SYS___LOG_H = 0x91A - SYS_LABS = 0x092 - SYS___POWL_H = 0x92A - SYS___REMAINDER_H = 0x92B - SYS___RINT_H = 0x92C - SYS___SCALB_H = 0x92D - SYS___SINF_H = 0x92F - SYS___SIN_H = 0x92E - SYS_STRNCPY = 0x093 - SYS___TANHF_H = 0x93B - SYS___TANHL_H = 0x93C - SYS___TANH_H = 0x93A - SYS___TGAMMAF_H = 0x93E - SYS___TGAMMA_H = 0x93D - SYS___TRUNC_H = 0x93F - SYS_MEMCPY = 0x094 - SYS_VFWSCANF = 0x94A - SYS_VSWSCANF = 0x94E - SYS_VWSCANF = 0x94C - SYS_INET6_RTH_ADD = 0x95D - SYS_INET6_RTH_INIT = 0x95C - SYS_INET6_RTH_REVERSE = 0x95E - SYS_INET6_RTH_SEGMENTS = 0x95F - SYS_INET6_RTH_SPACE = 0x95B - SYS_MEMMOVE = 0x095 - SYS_WCSTOLD = 0x95A - SYS_STRCPY = 0x096 - SYS_STRCMP = 0x097 - SYS_CABS = 0x98E - SYS_STRCAT = 0x098 - SYS___CABS_B = 0x98F - SYS___POW_II = 0x98A - SYS___POW_II_B = 0x98B - SYS___POW_II_H = 0x98C - SYS_CACOSF = 0x99A - SYS_CACOSL = 0x99D - SYS_STRNCAT = 0x099 - SYS___CACOSF_B = 0x99B - SYS___CACOSF_H = 0x99C - SYS___CACOSL_B = 0x99E - SYS___CACOSL_H = 0x99F - SYS_ISWALPHA = 0x100 - SYS_ISWBLANK = 0x101 - SYS___ISWBLK = 0x101 - SYS_ISWCNTRL = 0x102 - SYS_ISWDIGIT = 0x103 - SYS_ISWGRAPH = 0x104 - SYS_ISWLOWER = 0x105 - SYS_ISWPRINT = 0x106 - SYS_ISWPUNCT = 0x107 - SYS_ISWSPACE = 0x108 - SYS_ISWUPPER = 0x109 - SYS_WCTOB = 0x110 - SYS_MBRLEN = 0x111 - SYS_MBRTOWC = 0x112 - SYS_MBSRTOWC = 0x113 - SYS_MBSRTOWCS = 0x113 - SYS_WCRTOMB = 0x114 - SYS_WCSRTOMB = 0x115 - SYS_WCSRTOMBS = 0x115 - SYS___CSID = 0x116 - SYS___WCSID = 0x117 - SYS_STRPTIME = 0x118 - SYS___STRPTM = 0x118 - SYS_STRFMON = 0x119 - SYS_WCSCOLL = 0x130 - SYS_WCSXFRM = 0x131 - SYS_WCSWIDTH = 0x132 - SYS_WCWIDTH = 0x133 - SYS_WCSFTIME = 0x134 - SYS_SWPRINTF = 0x135 - SYS_VSWPRINT = 0x136 - SYS_VSWPRINTF = 0x136 - SYS_SWSCANF = 0x137 - SYS_REGCOMP = 0x138 - SYS_REGEXEC = 0x139 - SYS_GETWC = 0x140 - SYS_GETWCHAR = 0x141 - SYS_PUTWC = 0x142 - SYS_PUTWCHAR = 0x143 - SYS_UNGETWC = 0x144 - SYS_ICONV_OPEN = 0x145 - SYS_ICONV = 0x146 - SYS_ICONV_CLOSE = 0x147 - SYS_COLLRANGE = 0x150 - SYS_CCLASS = 0x151 - SYS_COLLORDER = 0x152 - SYS___DEMANGLE = 0x154 - SYS_FDOPEN = 0x155 - SYS___ERRNO = 0x156 - SYS___ERRNO2 = 0x157 - SYS___TERROR = 0x158 - SYS_MAXCOLL = 0x169 - SYS_DLLLOAD = 0x170 - SYS__EXIT = 0x174 - SYS_ACCESS = 0x175 - SYS_ALARM = 0x176 - SYS_CFGETISPEED = 0x177 - SYS_CFGETOSPEED = 0x178 - SYS_CFSETISPEED = 0x179 - SYS_CREAT = 0x180 - SYS_CTERMID = 0x181 - SYS_DUP = 0x182 - SYS_DUP2 = 0x183 - SYS_EXECL = 0x184 - SYS_EXECLE = 0x185 - SYS_EXECLP = 0x186 - SYS_EXECV = 0x187 - SYS_EXECVE = 0x188 - SYS_EXECVP = 0x189 - SYS_FSTAT = 0x190 - SYS_FSYNC = 0x191 - SYS_FTRUNCATE = 0x192 - SYS_GETCWD = 0x193 - SYS_GETEGID = 0x194 - SYS_GETEUID = 0x195 - SYS_GETGID = 0x196 - SYS_GETGRGID = 0x197 - SYS_GETGRNAM = 0x198 - SYS_GETGROUPS = 0x199 - SYS_PTHREAD_MUTEXATTR_DESTROY = 0x200 - SYS_PTHREAD_MUTEXATTR_SETKIND_NP = 0x201 - SYS_PTHREAD_MUTEXATTR_GETKIND_NP = 0x202 - SYS_PTHREAD_MUTEX_INIT = 0x203 - SYS_PTHREAD_MUTEX_DESTROY = 0x204 - SYS_PTHREAD_MUTEX_LOCK = 0x205 - SYS_PTHREAD_MUTEX_TRYLOCK = 0x206 - SYS_PTHREAD_MUTEX_UNLOCK = 0x207 - SYS_PTHREAD_ONCE = 0x209 - SYS_TW_OPEN = 0x210 - SYS_TW_FCNTL = 0x211 - SYS_PTHREAD_JOIN_D4_NP = 0x212 - SYS_PTHREAD_CONDATTR_SETKIND_NP = 0x213 - SYS_PTHREAD_CONDATTR_GETKIND_NP = 0x214 - SYS_EXTLINK_NP = 0x215 - SYS___PASSWD = 0x216 - SYS_SETGROUPS = 0x217 - SYS_INITGROUPS = 0x218 - SYS_WCSRCHR = 0x240 - SYS_SVC99 = 0x241 - SYS___SVC99 = 0x241 - SYS_WCSWCS = 0x242 - SYS_LOCALECO = 0x243 - SYS_LOCALECONV = 0x243 - SYS___LIBREL = 0x244 - SYS_RELEASE = 0x245 - SYS___RLSE = 0x245 - SYS_FLOCATE = 0x246 - SYS___FLOCT = 0x246 - SYS_FDELREC = 0x247 - SYS___FDLREC = 0x247 - SYS_FETCH = 0x248 - SYS___FETCH = 0x248 - SYS_QSORT = 0x249 - SYS___CLEANUPCATCH = 0x260 - SYS___CATCHMATCH = 0x261 - SYS___CLEAN2UPCATCH = 0x262 - SYS_GETPRIORITY = 0x270 - SYS_NICE = 0x271 - SYS_SETPRIORITY = 0x272 - SYS_GETITIMER = 0x273 - SYS_SETITIMER = 0x274 - SYS_MSGCTL = 0x275 - SYS_MSGGET = 0x276 - SYS_MSGRCV = 0x277 - SYS_MSGSND = 0x278 - SYS_MSGXRCV = 0x279 - SYS___MSGXR = 0x279 - SYS_SHMGET = 0x280 - SYS___GETIPC = 0x281 - SYS_SETGRENT = 0x282 - SYS_GETGRENT = 0x283 - SYS_ENDGRENT = 0x284 - SYS_SETPWENT = 0x285 - SYS_GETPWENT = 0x286 - SYS_ENDPWENT = 0x287 - SYS_BSD_SIGNAL = 0x288 - SYS_KILLPG = 0x289 - SYS_SIGSET = 0x290 - SYS_SIGSTACK = 0x291 - SYS_GETRLIMIT = 0x292 - SYS_SETRLIMIT = 0x293 - SYS_GETRUSAGE = 0x294 - SYS_MMAP = 0x295 - SYS_MPROTECT = 0x296 - SYS_MSYNC = 0x297 - SYS_MUNMAP = 0x298 - SYS_CONFSTR = 0x299 - SYS___NDMTRM = 0x300 - SYS_FTOK = 0x301 - SYS_BASENAME = 0x302 - SYS_DIRNAME = 0x303 - SYS_GETDTABLESIZE = 0x304 - SYS_MKSTEMP = 0x305 - SYS_MKTEMP = 0x306 - SYS_NFTW = 0x307 - SYS_GETWD = 0x308 - SYS_LOCKF = 0x309 - SYS_WORDEXP = 0x310 - SYS_WORDFREE = 0x311 - SYS_GETPGID = 0x312 - SYS_GETSID = 0x313 - SYS___UTMPXNAME = 0x314 - SYS_CUSERID = 0x315 - SYS_GETPASS = 0x316 - SYS_FNMATCH = 0x317 - SYS_FTW = 0x318 - SYS_GETW = 0x319 - SYS_ACOSH = 0x320 - SYS_ASINH = 0x321 - SYS_ATANH = 0x322 - SYS_CBRT = 0x323 - SYS_EXPM1 = 0x324 - SYS_ILOGB = 0x325 - SYS_LOGB = 0x326 - SYS_LOG1P = 0x327 - SYS_NEXTAFTER = 0x328 - SYS_RINT = 0x329 - SYS_SPAWN = 0x330 - SYS_SPAWNP = 0x331 - SYS_GETLOGIN_UU = 0x332 - SYS_ECVT = 0x333 - SYS_FCVT = 0x334 - SYS_GCVT = 0x335 - SYS_ACCEPT = 0x336 - SYS_BIND = 0x337 - SYS_CONNECT = 0x338 - SYS_ENDHOSTENT = 0x339 - SYS_GETHOSTENT = 0x340 - SYS_GETHOSTID = 0x341 - SYS_GETHOSTNAME = 0x342 - SYS_GETNETBYADDR = 0x343 - SYS_GETNETBYNAME = 0x344 - SYS_GETNETENT = 0x345 - SYS_GETPEERNAME = 0x346 - SYS_GETPROTOBYNAME = 0x347 - SYS_GETPROTOBYNUMBER = 0x348 - SYS_GETPROTOENT = 0x349 - SYS_INET_LNAOF = 0x350 - SYS_INET_MAKEADDR = 0x351 - SYS_INET_NETOF = 0x352 - SYS_INET_NETWORK = 0x353 - SYS_INET_NTOA = 0x354 - SYS_IOCTL = 0x355 - SYS_LISTEN = 0x356 - SYS_READV = 0x357 - SYS_RECV = 0x358 - SYS_RECVFROM = 0x359 - SYS_SETHOSTENT = 0x360 - SYS_SETNETENT = 0x361 - SYS_SETPEER = 0x362 - SYS_SETPROTOENT = 0x363 - SYS_SETSERVENT = 0x364 - SYS_SETSOCKOPT = 0x365 - SYS_SHUTDOWN = 0x366 - SYS_SOCKET = 0x367 - SYS_SOCKETPAIR = 0x368 - SYS_WRITEV = 0x369 - SYS_ENDNETENT = 0x370 - SYS_CLOSELOG = 0x371 - SYS_OPENLOG = 0x372 - SYS_SETLOGMASK = 0x373 - SYS_SYSLOG = 0x374 - SYS_PTSNAME = 0x375 - SYS_SETREUID = 0x376 - SYS_SETREGID = 0x377 - SYS_REALPATH = 0x378 - SYS___SIGNGAM = 0x379 - SYS_POLL = 0x380 - SYS_REXEC = 0x381 - SYS___ISASCII2 = 0x382 - SYS___TOASCII2 = 0x383 - SYS_CHPRIORITY = 0x384 - SYS_PTHREAD_ATTR_SETSYNCTYPE_NP = 0x385 - SYS_PTHREAD_ATTR_GETSYNCTYPE_NP = 0x386 - SYS_PTHREAD_SET_LIMIT_NP = 0x387 - SYS___STNETENT = 0x388 - SYS___STPROTOENT = 0x389 - SYS___SELECT1 = 0x390 - SYS_PTHREAD_SECURITY_NP = 0x391 - SYS___CHECK_RESOURCE_AUTH_NP = 0x392 - SYS___CONVERT_ID_NP = 0x393 - SYS___OPENVMREL = 0x394 - SYS_WMEMCHR = 0x395 - SYS_WMEMCMP = 0x396 - SYS_WMEMCPY = 0x397 - SYS_WMEMMOVE = 0x398 - SYS_WMEMSET = 0x399 - SYS___FPUTWC = 0x400 - SYS___PUTWC = 0x401 - SYS___PWCHAR = 0x402 - SYS___WCSFTM = 0x403 - SYS___WCSTOK = 0x404 - SYS___WCWDTH = 0x405 - SYS_T_ACCEPT = 0x409 - SYS_T_GETINFO = 0x410 - SYS_T_GETPROTADDR = 0x411 - SYS_T_GETSTATE = 0x412 - SYS_T_LISTEN = 0x413 - SYS_T_LOOK = 0x414 - SYS_T_OPEN = 0x415 - SYS_T_OPTMGMT = 0x416 - SYS_T_RCV = 0x417 - SYS_T_RCVCONNECT = 0x418 - SYS_T_RCVDIS = 0x419 - SYS_T_SNDUDATA = 0x420 - SYS_T_STRERROR = 0x421 - SYS_T_SYNC = 0x422 - SYS_T_UNBIND = 0x423 - SYS___T_ERRNO = 0x424 - SYS___RECVMSG2 = 0x425 - SYS___SENDMSG2 = 0x426 - SYS_FATTACH = 0x427 - SYS_FDETACH = 0x428 - SYS_GETMSG = 0x429 - SYS_GETCONTEXT = 0x430 - SYS_SETCONTEXT = 0x431 - SYS_MAKECONTEXT = 0x432 - SYS_SWAPCONTEXT = 0x433 - SYS_PTHREAD_GETSPECIFIC_D8_NP = 0x434 - SYS_GETCLIENTID = 0x470 - SYS___GETCLIENTID = 0x471 - SYS_GETSTABLESIZE = 0x472 - SYS_GETIBMOPT = 0x473 - SYS_GETIBMSOCKOPT = 0x474 - SYS_GIVESOCKET = 0x475 - SYS_IBMSFLUSH = 0x476 - SYS_MAXDESC = 0x477 - SYS_SETIBMOPT = 0x478 - SYS_SETIBMSOCKOPT = 0x479 - SYS___SERVER_PWU = 0x480 - SYS_PTHREAD_TAG_NP = 0x481 - SYS___CONSOLE = 0x482 - SYS___WSINIT = 0x483 - SYS___IPTCPN = 0x489 - SYS___SERVER_CLASSIFY = 0x490 - SYS___HEAPRPT = 0x496 - SYS___ISBFP = 0x500 - SYS___FP_CAST = 0x501 - SYS___CERTIFICATE = 0x502 - SYS_SEND_FILE = 0x503 - SYS_AIO_CANCEL = 0x504 - SYS_AIO_ERROR = 0x505 - SYS_AIO_READ = 0x506 - SYS_AIO_RETURN = 0x507 - SYS_AIO_SUSPEND = 0x508 - SYS_AIO_WRITE = 0x509 - SYS_PTHREAD_RWLOCK_TRYWRLOCK = 0x510 - SYS_PTHREAD_RWLOCK_UNLOCK = 0x511 - SYS_PTHREAD_RWLOCK_WRLOCK = 0x512 - SYS_PTHREAD_RWLOCKATTR_GETPSHARED = 0x513 - SYS_PTHREAD_RWLOCKATTR_SETPSHARED = 0x514 - SYS_PTHREAD_RWLOCKATTR_INIT = 0x515 - SYS_PTHREAD_RWLOCKATTR_DESTROY = 0x516 - SYS___CTTBL = 0x517 - SYS_PTHREAD_MUTEXATTR_SETTYPE = 0x518 - SYS_PTHREAD_MUTEXATTR_GETTYPE = 0x519 - SYS___FP_UNORDERED = 0x520 - SYS___FP_READ_RND = 0x521 - SYS___FP_READ_RND_B = 0x522 - SYS___FP_SWAP_RND = 0x523 - SYS___FP_SWAP_RND_B = 0x524 - SYS___FP_LEVEL = 0x525 - SYS___FP_BTOH = 0x526 - SYS___FP_HTOB = 0x527 - SYS___FPC_RD = 0x528 - SYS___FPC_WR = 0x529 - SYS_PTHREAD_SETCANCELTYPE = 0x600 - SYS_PTHREAD_TESTCANCEL = 0x601 - SYS___ATANF_B = 0x602 - SYS___ATANL_B = 0x603 - SYS___CEILF_B = 0x604 - SYS___CEILL_B = 0x605 - SYS___COSF_B = 0x606 - SYS___COSL_B = 0x607 - SYS___FABSF_B = 0x608 - SYS___FABSL_B = 0x609 - SYS___SINF_B = 0x610 - SYS___SINL_B = 0x611 - SYS___TANF_B = 0x612 - SYS___TANL_B = 0x613 - SYS___TANHF_B = 0x614 - SYS___TANHL_B = 0x615 - SYS___ACOSF_B = 0x616 - SYS___ACOSL_B = 0x617 - SYS___ASINF_B = 0x618 - SYS___ASINL_B = 0x619 - SYS___LOGF_B = 0x620 - SYS___LOGL_B = 0x621 - SYS___LOG10F_B = 0x622 - SYS___LOG10L_B = 0x623 - SYS___POWF_B = 0x624 - SYS___POWL_B = 0x625 - SYS___SINHF_B = 0x626 - SYS___SINHL_B = 0x627 - SYS___SQRTF_B = 0x628 - SYS___SQRTL_B = 0x629 - SYS___MODFL_B = 0x630 - SYS_ABSF = 0x631 - SYS_ABSL = 0x632 - SYS_ACOSF = 0x633 - SYS_ACOSL = 0x634 - SYS_ASINF = 0x635 - SYS_ASINL = 0x636 - SYS_ATAN2F = 0x637 - SYS_ATAN2L = 0x638 - SYS_ATANF = 0x639 - SYS_COSHL = 0x640 - SYS_EXPF = 0x641 - SYS_EXPL = 0x642 - SYS_TANHF = 0x643 - SYS_TANHL = 0x644 - SYS_LOG10F = 0x645 - SYS_LOG10L = 0x646 - SYS_LOGF = 0x647 - SYS_LOGL = 0x648 - SYS_POWF = 0x649 - SYS_SINHL = 0x650 - SYS_TANF = 0x651 - SYS_TANL = 0x652 - SYS_FABSF = 0x653 - SYS_FABSL = 0x654 - SYS_FLOORF = 0x655 - SYS_FLOORL = 0x656 - SYS_FMODF = 0x657 - SYS_FMODL = 0x658 - SYS_FREXPF = 0x659 - SYS___CHATTR = 0x660 - SYS___FCHATTR = 0x661 - SYS___TOCCSID = 0x662 - SYS___CSNAMETYPE = 0x663 - SYS___TOCSNAME = 0x664 - SYS___CCSIDTYPE = 0x665 - SYS___AE_CORRESTBL_QUERY = 0x666 - SYS___AE_AUTOCONVERT_STATE = 0x667 - SYS_DN_FIND = 0x668 - SYS___GETHOSTBYADDR_A = 0x669 - SYS___MBLEN_SB_A = 0x670 - SYS___MBLEN_STD_A = 0x671 - SYS___MBLEN_UTF = 0x672 - SYS___MBSTOWCS_A = 0x673 - SYS___MBSTOWCS_STD_A = 0x674 - SYS___MBTOWC_A = 0x675 - SYS___MBTOWC_ISO1 = 0x676 - SYS___MBTOWC_SBCS = 0x677 - SYS___MBTOWC_MBCS = 0x678 - SYS___MBTOWC_UTF = 0x679 - SYS___CSID_A = 0x680 - SYS___CSID_STD_A = 0x681 - SYS___WCSID_A = 0x682 - SYS___WCSID_STD_A = 0x683 - SYS___WCTOMB_A = 0x684 - SYS___WCTOMB_ISO1 = 0x685 - SYS___WCTOMB_STD_A = 0x686 - SYS___WCTOMB_UTF = 0x687 - SYS___WCWIDTH_A = 0x688 - SYS___GETGRNAM_R_A = 0x689 - SYS___READDIR_R_A = 0x690 - SYS___E2A_S = 0x691 - SYS___FNMATCH_A = 0x692 - SYS___FNMATCH_C_A = 0x693 - SYS___EXECL_A = 0x694 - SYS___FNMATCH_STD_A = 0x695 - SYS___REGCOMP_A = 0x696 - SYS___REGCOMP_STD_A = 0x697 - SYS___REGERROR_A = 0x698 - SYS___REGERROR_STD_A = 0x699 - SYS___SWPRINTF_A = 0x700 - SYS___FSCANF_A = 0x701 - SYS___SCANF_A = 0x702 - SYS___SSCANF_A = 0x703 - SYS___SWSCANF_A = 0x704 - SYS___ATOF_A = 0x705 - SYS___ATOI_A = 0x706 - SYS___ATOL_A = 0x707 - SYS___STRTOD_A = 0x708 - SYS___STRTOL_A = 0x709 - SYS___L64A_A = 0x710 - SYS___STRERROR_A = 0x711 - SYS___PERROR_A = 0x712 - SYS___FETCH_A = 0x713 - SYS___GETENV_A = 0x714 - SYS___MKSTEMP_A = 0x717 - SYS___PTSNAME_A = 0x718 - SYS___PUTENV_A = 0x719 - SYS___CHDIR_A = 0x720 - SYS___CHOWN_A = 0x721 - SYS___CHROOT_A = 0x722 - SYS___GETCWD_A = 0x723 - SYS___GETWD_A = 0x724 - SYS___LCHOWN_A = 0x725 - SYS___LINK_A = 0x726 - SYS___PATHCONF_A = 0x727 - SYS___IF_NAMEINDEX_A = 0x728 - SYS___READLINK_A = 0x729 - SYS___EXTLINK_NP_A = 0x730 - SYS___ISALNUM_A = 0x731 - SYS___ISALPHA_A = 0x732 - SYS___A2E_S = 0x733 - SYS___ISCNTRL_A = 0x734 - SYS___ISDIGIT_A = 0x735 - SYS___ISGRAPH_A = 0x736 - SYS___ISLOWER_A = 0x737 - SYS___ISPRINT_A = 0x738 - SYS___ISPUNCT_A = 0x739 - SYS___ISWALPHA_A = 0x740 - SYS___A2E_L = 0x741 - SYS___ISWCNTRL_A = 0x742 - SYS___ISWDIGIT_A = 0x743 - SYS___ISWGRAPH_A = 0x744 - SYS___ISWLOWER_A = 0x745 - SYS___ISWPRINT_A = 0x746 - SYS___ISWPUNCT_A = 0x747 - SYS___ISWSPACE_A = 0x748 - SYS___ISWUPPER_A = 0x749 - SYS___REMOVE_A = 0x750 - SYS___RENAME_A = 0x751 - SYS___TMPNAM_A = 0x752 - SYS___FOPEN_A = 0x753 - SYS___FREOPEN_A = 0x754 - SYS___CUSERID_A = 0x755 - SYS___POPEN_A = 0x756 - SYS___TEMPNAM_A = 0x757 - SYS___FTW_A = 0x758 - SYS___GETGRENT_A = 0x759 - SYS___INET_NTOP_A = 0x760 - SYS___GETPASS_A = 0x761 - SYS___GETPWENT_A = 0x762 - SYS___GETPWNAM_A = 0x763 - SYS___GETPWUID_A = 0x764 - SYS_____CHECK_RESOURCE_AUTH_NP_A = 0x765 - SYS___CHECKSCHENV_A = 0x766 - SYS___CONNECTSERVER_A = 0x767 - SYS___CONNECTWORKMGR_A = 0x768 - SYS_____CONSOLE_A = 0x769 - SYS___MSGSND_A = 0x770 - SYS___MSGXRCV_A = 0x771 - SYS___NFTW_A = 0x772 - SYS_____PASSWD_A = 0x773 - SYS___PTHREAD_SECURITY_NP_A = 0x774 - SYS___QUERYMETRICS_A = 0x775 - SYS___QUERYSCHENV = 0x776 - SYS___READV_A = 0x777 - SYS_____SERVER_CLASSIFY_A = 0x778 - SYS_____SERVER_INIT_A = 0x779 - SYS___W_GETPSENT_A = 0x780 - SYS___WRITEV_A = 0x781 - SYS___W_STATFS_A = 0x782 - SYS___W_STATVFS_A = 0x783 - SYS___FPUTC_A = 0x784 - SYS___PUTCHAR_A = 0x785 - SYS___PUTS_A = 0x786 - SYS___FGETS_A = 0x787 - SYS___GETS_A = 0x788 - SYS___FPUTS_A = 0x789 - SYS___PUTC_A = 0x790 - SYS___AE_THREAD_SETMODE = 0x791 - SYS___AE_THREAD_SWAPMODE = 0x792 - SYS___GETNETBYADDR_A = 0x793 - SYS___GETNETBYNAME_A = 0x794 - SYS___GETNETENT_A = 0x795 - SYS___GETPROTOBYNAME_A = 0x796 - SYS___GETPROTOBYNUMBER_A = 0x797 - SYS___GETPROTOENT_A = 0x798 - SYS___GETSERVBYNAME_A = 0x799 - SYS_ACL_FIRST_ENTRY = 0x800 - SYS_ACL_GET_ENTRY = 0x801 - SYS_ACL_VALID = 0x802 - SYS_ACL_CREATE_ENTRY = 0x803 - SYS_ACL_DELETE_ENTRY = 0x804 - SYS_ACL_UPDATE_ENTRY = 0x805 - SYS_ACL_DELETE_FD = 0x806 - SYS_ACL_DELETE_FILE = 0x807 - SYS_ACL_GET_FD = 0x808 - SYS_ACL_GET_FILE = 0x809 - SYS___ERFL_B = 0x810 - SYS___ERFCL_B = 0x811 - SYS___LGAMMAL_B = 0x812 - SYS___SETHOOKEVENTS = 0x813 - SYS_IF_NAMETOINDEX = 0x814 - SYS_IF_INDEXTONAME = 0x815 - SYS_IF_NAMEINDEX = 0x816 - SYS_IF_FREENAMEINDEX = 0x817 - SYS_GETADDRINFO = 0x818 - SYS_GETNAMEINFO = 0x819 - SYS___DYNFREE_A = 0x820 - SYS___RES_QUERY_A = 0x821 - SYS___RES_SEARCH_A = 0x822 - SYS___RES_QUERYDOMAIN_A = 0x823 - SYS___RES_MKQUERY_A = 0x824 - SYS___RES_SEND_A = 0x825 - SYS___DN_EXPAND_A = 0x826 - SYS___DN_SKIPNAME_A = 0x827 - SYS___DN_COMP_A = 0x828 - SYS___DN_FIND_A = 0x829 - SYS___INET_NTOA_A = 0x830 - SYS___INET_NETWORK_A = 0x831 - SYS___ACCEPT_A = 0x832 - SYS___ACCEPT_AND_RECV_A = 0x833 - SYS___BIND_A = 0x834 - SYS___CONNECT_A = 0x835 - SYS___GETPEERNAME_A = 0x836 - SYS___GETSOCKNAME_A = 0x837 - SYS___RECVFROM_A = 0x838 - SYS___SENDTO_A = 0x839 - SYS___LCHATTR = 0x840 - SYS___WRITEDOWN = 0x841 - SYS_PTHREAD_MUTEX_INIT2 = 0x842 - SYS___ACOSHF_B = 0x843 - SYS___ACOSHL_B = 0x844 - SYS___ASINHF_B = 0x845 - SYS___ASINHL_B = 0x846 - SYS___ATANHF_B = 0x847 - SYS___ATANHL_B = 0x848 - SYS___CBRTF_B = 0x849 - SYS___EXP2F_B = 0x850 - SYS___EXP2L_B = 0x851 - SYS___EXPM1F_B = 0x852 - SYS___EXPM1L_B = 0x853 - SYS___FDIMF_B = 0x854 - SYS___FDIM_B = 0x855 - SYS___FDIML_B = 0x856 - SYS___HYPOTF_B = 0x857 - SYS___HYPOTL_B = 0x858 - SYS___LOG1PF_B = 0x859 - SYS___REMQUOF_B = 0x860 - SYS___REMQUO_B = 0x861 - SYS___REMQUOL_B = 0x862 - SYS___TGAMMAF_B = 0x863 - SYS___TGAMMA_B = 0x864 - SYS___TGAMMAL_B = 0x865 - SYS___TRUNCF_B = 0x866 - SYS___TRUNC_B = 0x867 - SYS___TRUNCL_B = 0x868 - SYS___LGAMMAF_B = 0x869 - SYS_ASINHF = 0x870 - SYS_ASINHL = 0x871 - SYS_ATANHF = 0x872 - SYS_ATANHL = 0x873 - SYS_CBRTF = 0x874 - SYS_CBRTL = 0x875 - SYS_COPYSIGNF = 0x876 - SYS_CPYSIGNF = 0x876 - SYS_COPYSIGNL = 0x877 - SYS_CPYSIGNL = 0x877 - SYS_COTANF = 0x878 - SYS___COTANF = 0x878 - SYS_COTAN = 0x879 - SYS___COTAN = 0x879 - SYS_FDIM = 0x881 - SYS_FDIML = 0x882 - SYS_HYPOTF = 0x883 - SYS_HYPOTL = 0x884 - SYS_LOG1PF = 0x885 - SYS_LOG1PL = 0x886 - SYS_LOG2F = 0x887 - SYS_LOG2 = 0x888 - SYS_LOG2L = 0x889 - SYS_TGAMMA = 0x890 - SYS_TGAMMAL = 0x891 - SYS_TRUNCF = 0x892 - SYS_TRUNC = 0x893 - SYS_TRUNCL = 0x894 - SYS_LGAMMAF = 0x895 - SYS_LGAMMAL = 0x896 - SYS_LROUNDF = 0x897 - SYS_LROUND = 0x898 - SYS_ERFF = 0x899 - SYS___COSHF_H = 0x900 - SYS___COSHL_H = 0x901 - SYS___COTAN_H = 0x902 - SYS___COTANF_H = 0x903 - SYS___COTANL_H = 0x904 - SYS___ERF_H = 0x905 - SYS___ERFF_H = 0x906 - SYS___ERFL_H = 0x907 - SYS___ERFC_H = 0x908 - SYS___ERFCF_H = 0x909 - SYS___FDIMF_H = 0x910 - SYS___FDIML_H = 0x911 - SYS___FMOD_H = 0x912 - SYS___FMODF_H = 0x913 - SYS___FMODL_H = 0x914 - SYS___GAMMA_H = 0x915 - SYS___HYPOT_H = 0x916 - SYS___ILOGB_H = 0x917 - SYS___LGAMMA_H = 0x918 - SYS___LGAMMAF_H = 0x919 - SYS___LOG2L_H = 0x920 - SYS___LOG1P_H = 0x921 - SYS___LOG10_H = 0x922 - SYS___LOG10F_H = 0x923 - SYS___LOG10L_H = 0x924 - SYS___LROUND_H = 0x925 - SYS___LROUNDF_H = 0x926 - SYS___NEXTAFTER_H = 0x927 - SYS___POW_H = 0x928 - SYS___POWF_H = 0x929 - SYS___SINL_H = 0x930 - SYS___SINH_H = 0x931 - SYS___SINHF_H = 0x932 - SYS___SINHL_H = 0x933 - SYS___SQRT_H = 0x934 - SYS___SQRTF_H = 0x935 - SYS___SQRTL_H = 0x936 - SYS___TAN_H = 0x937 - SYS___TANF_H = 0x938 - SYS___TANL_H = 0x939 - SYS___TRUNCF_H = 0x940 - SYS___TRUNCL_H = 0x941 - SYS___COSH_H = 0x942 - SYS___LE_DEBUG_SET_RESUME_MCH = 0x943 - SYS_VFSCANF = 0x944 - SYS_VSCANF = 0x946 - SYS_VSSCANF = 0x948 - SYS_IMAXABS = 0x950 - SYS_IMAXDIV = 0x951 - SYS_STRTOIMAX = 0x952 - SYS_STRTOUMAX = 0x953 - SYS_WCSTOIMAX = 0x954 - SYS_WCSTOUMAX = 0x955 - SYS_ATOLL = 0x956 - SYS_STRTOF = 0x957 - SYS_STRTOLD = 0x958 - SYS_WCSTOF = 0x959 - SYS_INET6_RTH_GETADDR = 0x960 - SYS_INET6_OPT_INIT = 0x961 - SYS_INET6_OPT_APPEND = 0x962 - SYS_INET6_OPT_FINISH = 0x963 - SYS_INET6_OPT_SET_VAL = 0x964 - SYS_INET6_OPT_NEXT = 0x965 - SYS_INET6_OPT_FIND = 0x966 - SYS_INET6_OPT_GET_VAL = 0x967 - SYS___POW_I = 0x987 - SYS___POW_I_B = 0x988 - SYS___POW_I_H = 0x989 - SYS___CABS_H = 0x990 - SYS_CABSF = 0x991 - SYS___CABSF_B = 0x992 - SYS___CABSF_H = 0x993 - SYS_CABSL = 0x994 - SYS___CABSL_B = 0x995 - SYS___CABSL_H = 0x996 - SYS_CACOS = 0x997 - SYS___CACOS_B = 0x998 - SYS___CACOS_H = 0x999 + SYS_LOG = 0x17 // 23 + SYS_COSH = 0x18 // 24 + SYS_TANH = 0x19 // 25 + SYS_EXP = 0x1A // 26 + SYS_MODF = 0x1B // 27 + SYS_LOG10 = 0x1C // 28 + SYS_FREXP = 0x1D // 29 + SYS_LDEXP = 0x1E // 30 + SYS_CEIL = 0x1F // 31 + SYS_POW = 0x20 // 32 + SYS_SQRT = 0x21 // 33 + SYS_FLOOR = 0x22 // 34 + SYS_J1 = 0x23 // 35 + SYS_FABS = 0x24 // 36 + SYS_FMOD = 0x25 // 37 + SYS_J0 = 0x26 // 38 + SYS_YN = 0x27 // 39 + SYS_JN = 0x28 // 40 + SYS_Y0 = 0x29 // 41 + SYS_Y1 = 0x2A // 42 + SYS_HYPOT = 0x2B // 43 + SYS_ERF = 0x2C // 44 + SYS_ERFC = 0x2D // 45 + SYS_GAMMA = 0x2E // 46 + SYS_ISALPHA = 0x30 // 48 + SYS_ISALNUM = 0x31 // 49 + SYS_ISLOWER = 0x32 // 50 + SYS_ISCNTRL = 0x33 // 51 + SYS_ISDIGIT = 0x34 // 52 + SYS_ISGRAPH = 0x35 // 53 + SYS_ISUPPER = 0x36 // 54 + SYS_ISPRINT = 0x37 // 55 + SYS_ISPUNCT = 0x38 // 56 + SYS_ISSPACE = 0x39 // 57 + SYS_SETLOCAL = 0x3A // 58 + SYS_SETLOCALE = 0x3A // 58 + SYS_ISXDIGIT = 0x3B // 59 + SYS_TOLOWER = 0x3C // 60 + SYS_TOUPPER = 0x3D // 61 + SYS_ASIN = 0x3E // 62 + SYS_SIN = 0x3F // 63 + SYS_COS = 0x40 // 64 + SYS_TAN = 0x41 // 65 + SYS_SINH = 0x42 // 66 + SYS_ACOS = 0x43 // 67 + SYS_ATAN = 0x44 // 68 + SYS_ATAN2 = 0x45 // 69 + SYS_FTELL = 0x46 // 70 + SYS_FGETPOS = 0x47 // 71 + SYS_FSEEK = 0x48 // 72 + SYS_FSETPOS = 0x49 // 73 + SYS_FERROR = 0x4A // 74 + SYS_REWIND = 0x4B // 75 + SYS_CLEARERR = 0x4C // 76 + SYS_FEOF = 0x4D // 77 + SYS_ATOL = 0x4E // 78 + SYS_PERROR = 0x4F // 79 + SYS_ATOF = 0x50 // 80 + SYS_ATOI = 0x51 // 81 + SYS_RAND = 0x52 // 82 + SYS_STRTOD = 0x53 // 83 + SYS_STRTOL = 0x54 // 84 + SYS_STRTOUL = 0x55 // 85 + SYS_MALLOC = 0x56 // 86 + SYS_SRAND = 0x57 // 87 + SYS_CALLOC = 0x58 // 88 + SYS_FREE = 0x59 // 89 + SYS_EXIT = 0x5A // 90 + SYS_REALLOC = 0x5B // 91 + SYS_ABORT = 0x5C // 92 + SYS___ABORT = 0x5C // 92 + SYS_ATEXIT = 0x5D // 93 + SYS_RAISE = 0x5E // 94 + SYS_SETJMP = 0x5F // 95 + SYS_LONGJMP = 0x60 // 96 + SYS_SIGNAL = 0x61 // 97 + SYS_TMPNAM = 0x62 // 98 + SYS_REMOVE = 0x63 // 99 + SYS_RENAME = 0x64 // 100 + SYS_TMPFILE = 0x65 // 101 + SYS_FREOPEN = 0x66 // 102 + SYS_FCLOSE = 0x67 // 103 + SYS_FFLUSH = 0x68 // 104 + SYS_FOPEN = 0x69 // 105 + SYS_FSCANF = 0x6A // 106 + SYS_SETBUF = 0x6B // 107 + SYS_SETVBUF = 0x6C // 108 + SYS_FPRINTF = 0x6D // 109 + SYS_SSCANF = 0x6E // 110 + SYS_PRINTF = 0x6F // 111 + SYS_SCANF = 0x70 // 112 + SYS_SPRINTF = 0x71 // 113 + SYS_FGETC = 0x72 // 114 + SYS_VFPRINTF = 0x73 // 115 + SYS_VPRINTF = 0x74 // 116 + SYS_VSPRINTF = 0x75 // 117 + SYS_GETC = 0x76 // 118 + SYS_FGETS = 0x77 // 119 + SYS_FPUTC = 0x78 // 120 + SYS_FPUTS = 0x79 // 121 + SYS_PUTCHAR = 0x7A // 122 + SYS_GETCHAR = 0x7B // 123 + SYS_GETS = 0x7C // 124 + SYS_PUTC = 0x7D // 125 + SYS_FWRITE = 0x7E // 126 + SYS_PUTS = 0x7F // 127 + SYS_UNGETC = 0x80 // 128 + SYS_FREAD = 0x81 // 129 + SYS_WCSTOMBS = 0x82 // 130 + SYS_MBTOWC = 0x83 // 131 + SYS_WCTOMB = 0x84 // 132 + SYS_MBSTOWCS = 0x85 // 133 + SYS_WCSCPY = 0x86 // 134 + SYS_WCSCAT = 0x87 // 135 + SYS_WCSCHR = 0x88 // 136 + SYS_WCSCMP = 0x89 // 137 + SYS_WCSNCMP = 0x8A // 138 + SYS_WCSCSPN = 0x8B // 139 + SYS_WCSLEN = 0x8C // 140 + SYS_WCSNCAT = 0x8D // 141 + SYS_WCSSPN = 0x8E // 142 + SYS_WCSNCPY = 0x8F // 143 + SYS_ABS = 0x90 // 144 + SYS_DIV = 0x91 // 145 + SYS_LABS = 0x92 // 146 + SYS_STRNCPY = 0x93 // 147 + SYS_MEMCPY = 0x94 // 148 + SYS_MEMMOVE = 0x95 // 149 + SYS_STRCPY = 0x96 // 150 + SYS_STRCMP = 0x97 // 151 + SYS_STRCAT = 0x98 // 152 + SYS_STRNCAT = 0x99 // 153 + SYS_MEMCMP = 0x9A // 154 + SYS_MEMCHR = 0x9B // 155 + SYS_STRCOLL = 0x9C // 156 + SYS_STRNCMP = 0x9D // 157 + SYS_STRXFRM = 0x9E // 158 + SYS_STRRCHR = 0x9F // 159 + SYS_STRCHR = 0xA0 // 160 + SYS_STRCSPN = 0xA1 // 161 + SYS_STRPBRK = 0xA2 // 162 + SYS_MEMSET = 0xA3 // 163 + SYS_STRSPN = 0xA4 // 164 + SYS_STRSTR = 0xA5 // 165 + SYS_STRTOK = 0xA6 // 166 + SYS_DIFFTIME = 0xA7 // 167 + SYS_STRERROR = 0xA8 // 168 + SYS_STRLEN = 0xA9 // 169 + SYS_CLOCK = 0xAA // 170 + SYS_CTIME = 0xAB // 171 + SYS_MKTIME = 0xAC // 172 + SYS_TIME = 0xAD // 173 + SYS_ASCTIME = 0xAE // 174 + SYS_MBLEN = 0xAF // 175 + SYS_GMTIME = 0xB0 // 176 + SYS_LOCALTIM = 0xB1 // 177 + SYS_LOCALTIME = 0xB1 // 177 + SYS_STRFTIME = 0xB2 // 178 + SYS___GETCB = 0xB4 // 180 + SYS_FUPDATE = 0xB5 // 181 + SYS___FUPDT = 0xB5 // 181 + SYS_CLRMEMF = 0xBD // 189 + SYS___CLRMF = 0xBD // 189 + SYS_FETCHEP = 0xBF // 191 + SYS___FTCHEP = 0xBF // 191 + SYS_FLDATA = 0xC1 // 193 + SYS___FLDATA = 0xC1 // 193 + SYS_DYNFREE = 0xC2 // 194 + SYS___DYNFRE = 0xC2 // 194 + SYS_DYNALLOC = 0xC3 // 195 + SYS___DYNALL = 0xC3 // 195 + SYS___CDUMP = 0xC4 // 196 + SYS_CSNAP = 0xC5 // 197 + SYS___CSNAP = 0xC5 // 197 + SYS_CTRACE = 0xC6 // 198 + SYS___CTRACE = 0xC6 // 198 + SYS___CTEST = 0xC7 // 199 + SYS_SETENV = 0xC8 // 200 + SYS___SETENV = 0xC8 // 200 + SYS_CLEARENV = 0xC9 // 201 + SYS___CLRENV = 0xC9 // 201 + SYS___REGCOMP_STD = 0xEA // 234 + SYS_NL_LANGINFO = 0xFC // 252 + SYS_GETSYNTX = 0xFD // 253 + SYS_ISBLANK = 0xFE // 254 + SYS___ISBLNK = 0xFE // 254 + SYS_ISWALNUM = 0xFF // 255 + SYS_ISWALPHA = 0x100 // 256 + SYS_ISWBLANK = 0x101 // 257 + SYS___ISWBLK = 0x101 // 257 + SYS_ISWCNTRL = 0x102 // 258 + SYS_ISWDIGIT = 0x103 // 259 + SYS_ISWGRAPH = 0x104 // 260 + SYS_ISWLOWER = 0x105 // 261 + SYS_ISWPRINT = 0x106 // 262 + SYS_ISWPUNCT = 0x107 // 263 + SYS_ISWSPACE = 0x108 // 264 + SYS_ISWUPPER = 0x109 // 265 + SYS_ISWXDIGI = 0x10A // 266 + SYS_ISWXDIGIT = 0x10A // 266 + SYS_WCTYPE = 0x10B // 267 + SYS_ISWCTYPE = 0x10C // 268 + SYS_TOWLOWER = 0x10D // 269 + SYS_TOWUPPER = 0x10E // 270 + SYS_MBSINIT = 0x10F // 271 + SYS_WCTOB = 0x110 // 272 + SYS_MBRLEN = 0x111 // 273 + SYS_MBRTOWC = 0x112 // 274 + SYS_MBSRTOWC = 0x113 // 275 + SYS_MBSRTOWCS = 0x113 // 275 + SYS_WCRTOMB = 0x114 // 276 + SYS_WCSRTOMB = 0x115 // 277 + SYS_WCSRTOMBS = 0x115 // 277 + SYS___CSID = 0x116 // 278 + SYS___WCSID = 0x117 // 279 + SYS_STRPTIME = 0x118 // 280 + SYS___STRPTM = 0x118 // 280 + SYS_STRFMON = 0x119 // 281 + SYS___RPMTCH = 0x11A // 282 + SYS_WCSSTR = 0x11B // 283 + SYS_WCSTOK = 0x12C // 300 + SYS_WCSTOL = 0x12D // 301 + SYS_WCSTOD = 0x12E // 302 + SYS_WCSTOUL = 0x12F // 303 + SYS_WCSCOLL = 0x130 // 304 + SYS_WCSXFRM = 0x131 // 305 + SYS_WCSWIDTH = 0x132 // 306 + SYS_WCWIDTH = 0x133 // 307 + SYS_WCSFTIME = 0x134 // 308 + SYS_SWPRINTF = 0x135 // 309 + SYS_VSWPRINT = 0x136 // 310 + SYS_VSWPRINTF = 0x136 // 310 + SYS_SWSCANF = 0x137 // 311 + SYS_REGCOMP = 0x138 // 312 + SYS_REGEXEC = 0x139 // 313 + SYS_REGFREE = 0x13A // 314 + SYS_REGERROR = 0x13B // 315 + SYS_FGETWC = 0x13C // 316 + SYS_FGETWS = 0x13D // 317 + SYS_FPUTWC = 0x13E // 318 + SYS_FPUTWS = 0x13F // 319 + SYS_GETWC = 0x140 // 320 + SYS_GETWCHAR = 0x141 // 321 + SYS_PUTWC = 0x142 // 322 + SYS_PUTWCHAR = 0x143 // 323 + SYS_UNGETWC = 0x144 // 324 + SYS_ICONV_OPEN = 0x145 // 325 + SYS_ICONV = 0x146 // 326 + SYS_ICONV_CLOSE = 0x147 // 327 + SYS_ISMCCOLLEL = 0x14C // 332 + SYS_STRTOCOLL = 0x14D // 333 + SYS_COLLTOSTR = 0x14E // 334 + SYS_COLLEQUIV = 0x14F // 335 + SYS_COLLRANGE = 0x150 // 336 + SYS_CCLASS = 0x151 // 337 + SYS_COLLORDER = 0x152 // 338 + SYS___DEMANGLE = 0x154 // 340 + SYS_FDOPEN = 0x155 // 341 + SYS___ERRNO = 0x156 // 342 + SYS___ERRNO2 = 0x157 // 343 + SYS___TERROR = 0x158 // 344 + SYS_MAXCOLL = 0x169 // 361 + SYS_GETMCCOLL = 0x16A // 362 + SYS_GETWMCCOLL = 0x16B // 363 + SYS___ERR2AD = 0x16C // 364 + SYS_DLLQUERYFN = 0x16D // 365 + SYS_DLLQUERYVAR = 0x16E // 366 + SYS_DLLFREE = 0x16F // 367 + SYS_DLLLOAD = 0x170 // 368 + SYS__EXIT = 0x174 // 372 + SYS_ACCESS = 0x175 // 373 + SYS_ALARM = 0x176 // 374 + SYS_CFGETISPEED = 0x177 // 375 + SYS_CFGETOSPEED = 0x178 // 376 + SYS_CFSETISPEED = 0x179 // 377 + SYS_CFSETOSPEED = 0x17A // 378 + SYS_CHDIR = 0x17B // 379 + SYS_CHMOD = 0x17C // 380 + SYS_CHOWN = 0x17D // 381 + SYS_CLOSE = 0x17E // 382 + SYS_CLOSEDIR = 0x17F // 383 + SYS_CREAT = 0x180 // 384 + SYS_CTERMID = 0x181 // 385 + SYS_DUP = 0x182 // 386 + SYS_DUP2 = 0x183 // 387 + SYS_EXECL = 0x184 // 388 + SYS_EXECLE = 0x185 // 389 + SYS_EXECLP = 0x186 // 390 + SYS_EXECV = 0x187 // 391 + SYS_EXECVE = 0x188 // 392 + SYS_EXECVP = 0x189 // 393 + SYS_FCHMOD = 0x18A // 394 + SYS_FCHOWN = 0x18B // 395 + SYS_FCNTL = 0x18C // 396 + SYS_FILENO = 0x18D // 397 + SYS_FORK = 0x18E // 398 + SYS_FPATHCONF = 0x18F // 399 + SYS_FSTAT = 0x190 // 400 + SYS_FSYNC = 0x191 // 401 + SYS_FTRUNCATE = 0x192 // 402 + SYS_GETCWD = 0x193 // 403 + SYS_GETEGID = 0x194 // 404 + SYS_GETEUID = 0x195 // 405 + SYS_GETGID = 0x196 // 406 + SYS_GETGRGID = 0x197 // 407 + SYS_GETGRNAM = 0x198 // 408 + SYS_GETGROUPS = 0x199 // 409 + SYS_GETLOGIN = 0x19A // 410 + SYS_W_GETMNTENT = 0x19B // 411 + SYS_GETPGRP = 0x19C // 412 + SYS_GETPID = 0x19D // 413 + SYS_GETPPID = 0x19E // 414 + SYS_GETPWNAM = 0x19F // 415 + SYS_GETPWUID = 0x1A0 // 416 + SYS_GETUID = 0x1A1 // 417 + SYS_W_IOCTL = 0x1A2 // 418 + SYS_ISATTY = 0x1A3 // 419 + SYS_KILL = 0x1A4 // 420 + SYS_LINK = 0x1A5 // 421 + SYS_LSEEK = 0x1A6 // 422 + SYS_LSTAT = 0x1A7 // 423 + SYS_MKDIR = 0x1A8 // 424 + SYS_MKFIFO = 0x1A9 // 425 + SYS_MKNOD = 0x1AA // 426 + SYS_MOUNT = 0x1AB // 427 + SYS_OPEN = 0x1AC // 428 + SYS_OPENDIR = 0x1AD // 429 + SYS_PATHCONF = 0x1AE // 430 + SYS_PAUSE = 0x1AF // 431 + SYS_PIPE = 0x1B0 // 432 + SYS_W_GETPSENT = 0x1B1 // 433 + SYS_READ = 0x1B2 // 434 + SYS_READDIR = 0x1B3 // 435 + SYS_READLINK = 0x1B4 // 436 + SYS_REWINDDIR = 0x1B5 // 437 + SYS_RMDIR = 0x1B6 // 438 + SYS_SETEGID = 0x1B7 // 439 + SYS_SETEUID = 0x1B8 // 440 + SYS_SETGID = 0x1B9 // 441 + SYS_SETPGID = 0x1BA // 442 + SYS_SETSID = 0x1BB // 443 + SYS_SETUID = 0x1BC // 444 + SYS_SIGACTION = 0x1BD // 445 + SYS_SIGADDSET = 0x1BE // 446 + SYS_SIGDELSET = 0x1BF // 447 + SYS_SIGEMPTYSET = 0x1C0 // 448 + SYS_SIGFILLSET = 0x1C1 // 449 + SYS_SIGISMEMBER = 0x1C2 // 450 + SYS_SIGLONGJMP = 0x1C3 // 451 + SYS_SIGPENDING = 0x1C4 // 452 + SYS_SIGPROCMASK = 0x1C5 // 453 + SYS_SIGSETJMP = 0x1C6 // 454 + SYS_SIGSUSPEND = 0x1C7 // 455 + SYS_SLEEP = 0x1C8 // 456 + SYS_STAT = 0x1C9 // 457 + SYS_W_STATFS = 0x1CA // 458 + SYS_SYMLINK = 0x1CB // 459 + SYS_SYSCONF = 0x1CC // 460 + SYS_TCDRAIN = 0x1CD // 461 + SYS_TCFLOW = 0x1CE // 462 + SYS_TCFLUSH = 0x1CF // 463 + SYS_TCGETATTR = 0x1D0 // 464 + SYS_TCGETPGRP = 0x1D1 // 465 + SYS_TCSENDBREAK = 0x1D2 // 466 + SYS_TCSETATTR = 0x1D3 // 467 + SYS_TCSETPGRP = 0x1D4 // 468 + SYS_TIMES = 0x1D5 // 469 + SYS_TTYNAME = 0x1D6 // 470 + SYS_TZSET = 0x1D7 // 471 + SYS_UMASK = 0x1D8 // 472 + SYS_UMOUNT = 0x1D9 // 473 + SYS_UNAME = 0x1DA // 474 + SYS_UNLINK = 0x1DB // 475 + SYS_UTIME = 0x1DC // 476 + SYS_WAIT = 0x1DD // 477 + SYS_WAITPID = 0x1DE // 478 + SYS_WRITE = 0x1DF // 479 + SYS_CHAUDIT = 0x1E0 // 480 + SYS_FCHAUDIT = 0x1E1 // 481 + SYS_GETGROUPSBYNAME = 0x1E2 // 482 + SYS_SIGWAIT = 0x1E3 // 483 + SYS_PTHREAD_EXIT = 0x1E4 // 484 + SYS_PTHREAD_KILL = 0x1E5 // 485 + SYS_PTHREAD_ATTR_INIT = 0x1E6 // 486 + SYS_PTHREAD_ATTR_DESTROY = 0x1E7 // 487 + SYS_PTHREAD_ATTR_SETSTACKSIZE = 0x1E8 // 488 + SYS_PTHREAD_ATTR_GETSTACKSIZE = 0x1E9 // 489 + SYS_PTHREAD_ATTR_SETDETACHSTATE = 0x1EA // 490 + SYS_PTHREAD_ATTR_GETDETACHSTATE = 0x1EB // 491 + SYS_PTHREAD_ATTR_SETWEIGHT_NP = 0x1EC // 492 + SYS_PTHREAD_ATTR_GETWEIGHT_NP = 0x1ED // 493 + SYS_PTHREAD_CANCEL = 0x1EE // 494 + SYS_PTHREAD_CLEANUP_PUSH = 0x1EF // 495 + SYS_PTHREAD_CLEANUP_POP = 0x1F0 // 496 + SYS_PTHREAD_CONDATTR_INIT = 0x1F1 // 497 + SYS_PTHREAD_CONDATTR_DESTROY = 0x1F2 // 498 + SYS_PTHREAD_COND_INIT = 0x1F3 // 499 + SYS_PTHREAD_COND_DESTROY = 0x1F4 // 500 + SYS_PTHREAD_COND_SIGNAL = 0x1F5 // 501 + SYS_PTHREAD_COND_BROADCAST = 0x1F6 // 502 + SYS_PTHREAD_COND_WAIT = 0x1F7 // 503 + SYS_PTHREAD_COND_TIMEDWAIT = 0x1F8 // 504 + SYS_PTHREAD_CREATE = 0x1F9 // 505 + SYS_PTHREAD_DETACH = 0x1FA // 506 + SYS_PTHREAD_EQUAL = 0x1FB // 507 + SYS_PTHREAD_GETSPECIFIC = 0x1FC // 508 + SYS_PTHREAD_JOIN = 0x1FD // 509 + SYS_PTHREAD_KEY_CREATE = 0x1FE // 510 + SYS_PTHREAD_MUTEXATTR_INIT = 0x1FF // 511 + SYS_PTHREAD_MUTEXATTR_DESTROY = 0x200 // 512 + SYS_PTHREAD_MUTEXATTR_SETKIND_NP = 0x201 // 513 + SYS_PTHREAD_MUTEXATTR_GETKIND_NP = 0x202 // 514 + SYS_PTHREAD_MUTEX_INIT = 0x203 // 515 + SYS_PTHREAD_MUTEX_DESTROY = 0x204 // 516 + SYS_PTHREAD_MUTEX_LOCK = 0x205 // 517 + SYS_PTHREAD_MUTEX_TRYLOCK = 0x206 // 518 + SYS_PTHREAD_MUTEX_UNLOCK = 0x207 // 519 + SYS_PTHREAD_ONCE = 0x209 // 521 + SYS_PTHREAD_SELF = 0x20A // 522 + SYS_PTHREAD_SETINTR = 0x20B // 523 + SYS_PTHREAD_SETINTRTYPE = 0x20C // 524 + SYS_PTHREAD_SETSPECIFIC = 0x20D // 525 + SYS_PTHREAD_TESTINTR = 0x20E // 526 + SYS_PTHREAD_YIELD = 0x20F // 527 + SYS_TW_OPEN = 0x210 // 528 + SYS_TW_FCNTL = 0x211 // 529 + SYS_PTHREAD_JOIN_D4_NP = 0x212 // 530 + SYS_PTHREAD_CONDATTR_SETKIND_NP = 0x213 // 531 + SYS_PTHREAD_CONDATTR_GETKIND_NP = 0x214 // 532 + SYS_EXTLINK_NP = 0x215 // 533 + SYS___PASSWD = 0x216 // 534 + SYS_SETGROUPS = 0x217 // 535 + SYS_INITGROUPS = 0x218 // 536 + SYS_WCSPBRK = 0x23F // 575 + SYS_WCSRCHR = 0x240 // 576 + SYS_SVC99 = 0x241 // 577 + SYS___SVC99 = 0x241 // 577 + SYS_WCSWCS = 0x242 // 578 + SYS_LOCALECO = 0x243 // 579 + SYS_LOCALECONV = 0x243 // 579 + SYS___LIBREL = 0x244 // 580 + SYS_RELEASE = 0x245 // 581 + SYS___RLSE = 0x245 // 581 + SYS_FLOCATE = 0x246 // 582 + SYS___FLOCT = 0x246 // 582 + SYS_FDELREC = 0x247 // 583 + SYS___FDLREC = 0x247 // 583 + SYS_FETCH = 0x248 // 584 + SYS___FETCH = 0x248 // 584 + SYS_QSORT = 0x249 // 585 + SYS_GETENV = 0x24A // 586 + SYS_SYSTEM = 0x24B // 587 + SYS_BSEARCH = 0x24C // 588 + SYS_LDIV = 0x24D // 589 + SYS___THROW = 0x25E // 606 + SYS___RETHROW = 0x25F // 607 + SYS___CLEANUPCATCH = 0x260 // 608 + SYS___CATCHMATCH = 0x261 // 609 + SYS___CLEAN2UPCATCH = 0x262 // 610 + SYS_PUTENV = 0x26A // 618 + SYS___GETENV = 0x26F // 623 + SYS_GETPRIORITY = 0x270 // 624 + SYS_NICE = 0x271 // 625 + SYS_SETPRIORITY = 0x272 // 626 + SYS_GETITIMER = 0x273 // 627 + SYS_SETITIMER = 0x274 // 628 + SYS_MSGCTL = 0x275 // 629 + SYS_MSGGET = 0x276 // 630 + SYS_MSGRCV = 0x277 // 631 + SYS_MSGSND = 0x278 // 632 + SYS_MSGXRCV = 0x279 // 633 + SYS___MSGXR = 0x279 // 633 + SYS_SEMCTL = 0x27A // 634 + SYS_SEMGET = 0x27B // 635 + SYS_SEMOP = 0x27C // 636 + SYS_SHMAT = 0x27D // 637 + SYS_SHMCTL = 0x27E // 638 + SYS_SHMDT = 0x27F // 639 + SYS_SHMGET = 0x280 // 640 + SYS___GETIPC = 0x281 // 641 + SYS_SETGRENT = 0x282 // 642 + SYS_GETGRENT = 0x283 // 643 + SYS_ENDGRENT = 0x284 // 644 + SYS_SETPWENT = 0x285 // 645 + SYS_GETPWENT = 0x286 // 646 + SYS_ENDPWENT = 0x287 // 647 + SYS_BSD_SIGNAL = 0x288 // 648 + SYS_KILLPG = 0x289 // 649 + SYS_SIGALTSTACK = 0x28A // 650 + SYS_SIGHOLD = 0x28B // 651 + SYS_SIGIGNORE = 0x28C // 652 + SYS_SIGINTERRUPT = 0x28D // 653 + SYS_SIGPAUSE = 0x28E // 654 + SYS_SIGRELSE = 0x28F // 655 + SYS_SIGSET = 0x290 // 656 + SYS_SIGSTACK = 0x291 // 657 + SYS_GETRLIMIT = 0x292 // 658 + SYS_SETRLIMIT = 0x293 // 659 + SYS_GETRUSAGE = 0x294 // 660 + SYS_MMAP = 0x295 // 661 + SYS_MPROTECT = 0x296 // 662 + SYS_MSYNC = 0x297 // 663 + SYS_MUNMAP = 0x298 // 664 + SYS_CONFSTR = 0x299 // 665 + SYS_GETOPT = 0x29A // 666 + SYS_LCHOWN = 0x29B // 667 + SYS_TRUNCATE = 0x29C // 668 + SYS_GETSUBOPT = 0x29D // 669 + SYS_SETPGRP = 0x29E // 670 + SYS___GDERR = 0x29F // 671 + SYS___TZONE = 0x2A0 // 672 + SYS___DLGHT = 0x2A1 // 673 + SYS___OPARGF = 0x2A2 // 674 + SYS___OPOPTF = 0x2A3 // 675 + SYS___OPINDF = 0x2A4 // 676 + SYS___OPERRF = 0x2A5 // 677 + SYS_GETDATE = 0x2A6 // 678 + SYS_WAIT3 = 0x2A7 // 679 + SYS_WAITID = 0x2A8 // 680 + SYS___CATTRM = 0x2A9 // 681 + SYS___GDTRM = 0x2AA // 682 + SYS___RNDTRM = 0x2AB // 683 + SYS_CRYPT = 0x2AC // 684 + SYS_ENCRYPT = 0x2AD // 685 + SYS_SETKEY = 0x2AE // 686 + SYS___CNVBLK = 0x2AF // 687 + SYS___CRYTRM = 0x2B0 // 688 + SYS___ECRTRM = 0x2B1 // 689 + SYS_DRAND48 = 0x2B2 // 690 + SYS_ERAND48 = 0x2B3 // 691 + SYS_FSTATVFS = 0x2B4 // 692 + SYS_STATVFS = 0x2B5 // 693 + SYS_CATCLOSE = 0x2B6 // 694 + SYS_CATGETS = 0x2B7 // 695 + SYS_CATOPEN = 0x2B8 // 696 + SYS_BCMP = 0x2B9 // 697 + SYS_BCOPY = 0x2BA // 698 + SYS_BZERO = 0x2BB // 699 + SYS_FFS = 0x2BC // 700 + SYS_INDEX = 0x2BD // 701 + SYS_RINDEX = 0x2BE // 702 + SYS_STRCASECMP = 0x2BF // 703 + SYS_STRDUP = 0x2C0 // 704 + SYS_STRNCASECMP = 0x2C1 // 705 + SYS_INITSTATE = 0x2C2 // 706 + SYS_SETSTATE = 0x2C3 // 707 + SYS_RANDOM = 0x2C4 // 708 + SYS_SRANDOM = 0x2C5 // 709 + SYS_HCREATE = 0x2C6 // 710 + SYS_HDESTROY = 0x2C7 // 711 + SYS_HSEARCH = 0x2C8 // 712 + SYS_LFIND = 0x2C9 // 713 + SYS_LSEARCH = 0x2CA // 714 + SYS_TDELETE = 0x2CB // 715 + SYS_TFIND = 0x2CC // 716 + SYS_TSEARCH = 0x2CD // 717 + SYS_TWALK = 0x2CE // 718 + SYS_INSQUE = 0x2CF // 719 + SYS_REMQUE = 0x2D0 // 720 + SYS_POPEN = 0x2D1 // 721 + SYS_PCLOSE = 0x2D2 // 722 + SYS_SWAB = 0x2D3 // 723 + SYS_MEMCCPY = 0x2D4 // 724 + SYS_GETPAGESIZE = 0x2D8 // 728 + SYS_FCHDIR = 0x2D9 // 729 + SYS___OCLCK = 0x2DA // 730 + SYS___ATOE = 0x2DB // 731 + SYS___ATOE_L = 0x2DC // 732 + SYS___ETOA = 0x2DD // 733 + SYS___ETOA_L = 0x2DE // 734 + SYS_SETUTXENT = 0x2DF // 735 + SYS_GETUTXENT = 0x2E0 // 736 + SYS_ENDUTXENT = 0x2E1 // 737 + SYS_GETUTXID = 0x2E2 // 738 + SYS_GETUTXLINE = 0x2E3 // 739 + SYS_PUTUTXLINE = 0x2E4 // 740 + SYS_FMTMSG = 0x2E5 // 741 + SYS_JRAND48 = 0x2E6 // 742 + SYS_LRAND48 = 0x2E7 // 743 + SYS_MRAND48 = 0x2E8 // 744 + SYS_NRAND48 = 0x2E9 // 745 + SYS_LCONG48 = 0x2EA // 746 + SYS_SRAND48 = 0x2EB // 747 + SYS_SEED48 = 0x2EC // 748 + SYS_ISASCII = 0x2ED // 749 + SYS_TOASCII = 0x2EE // 750 + SYS_A64L = 0x2EF // 751 + SYS_L64A = 0x2F0 // 752 + SYS_UALARM = 0x2F1 // 753 + SYS_USLEEP = 0x2F2 // 754 + SYS___UTXTRM = 0x2F3 // 755 + SYS___SRCTRM = 0x2F4 // 756 + SYS_FTIME = 0x2F5 // 757 + SYS_GETTIMEOFDAY = 0x2F6 // 758 + SYS_DBM_CLEARERR = 0x2F7 // 759 + SYS_DBM_CLOSE = 0x2F8 // 760 + SYS_DBM_DELETE = 0x2F9 // 761 + SYS_DBM_ERROR = 0x2FA // 762 + SYS_DBM_FETCH = 0x2FB // 763 + SYS_DBM_FIRSTKEY = 0x2FC // 764 + SYS_DBM_NEXTKEY = 0x2FD // 765 + SYS_DBM_OPEN = 0x2FE // 766 + SYS_DBM_STORE = 0x2FF // 767 + SYS___NDMTRM = 0x300 // 768 + SYS_FTOK = 0x301 // 769 + SYS_BASENAME = 0x302 // 770 + SYS_DIRNAME = 0x303 // 771 + SYS_GETDTABLESIZE = 0x304 // 772 + SYS_MKSTEMP = 0x305 // 773 + SYS_MKTEMP = 0x306 // 774 + SYS_NFTW = 0x307 // 775 + SYS_GETWD = 0x308 // 776 + SYS_LOCKF = 0x309 // 777 + SYS__LONGJMP = 0x30D // 781 + SYS__SETJMP = 0x30E // 782 + SYS_VFORK = 0x30F // 783 + SYS_WORDEXP = 0x310 // 784 + SYS_WORDFREE = 0x311 // 785 + SYS_GETPGID = 0x312 // 786 + SYS_GETSID = 0x313 // 787 + SYS___UTMPXNAME = 0x314 // 788 + SYS_CUSERID = 0x315 // 789 + SYS_GETPASS = 0x316 // 790 + SYS_FNMATCH = 0x317 // 791 + SYS_FTW = 0x318 // 792 + SYS_GETW = 0x319 // 793 + SYS_GLOB = 0x31A // 794 + SYS_GLOBFREE = 0x31B // 795 + SYS_PUTW = 0x31C // 796 + SYS_SEEKDIR = 0x31D // 797 + SYS_TELLDIR = 0x31E // 798 + SYS_TEMPNAM = 0x31F // 799 + SYS_ACOSH = 0x320 // 800 + SYS_ASINH = 0x321 // 801 + SYS_ATANH = 0x322 // 802 + SYS_CBRT = 0x323 // 803 + SYS_EXPM1 = 0x324 // 804 + SYS_ILOGB = 0x325 // 805 + SYS_LOGB = 0x326 // 806 + SYS_LOG1P = 0x327 // 807 + SYS_NEXTAFTER = 0x328 // 808 + SYS_RINT = 0x329 // 809 + SYS_REMAINDER = 0x32A // 810 + SYS_SCALB = 0x32B // 811 + SYS_LGAMMA = 0x32C // 812 + SYS_TTYSLOT = 0x32D // 813 + SYS_GETTIMEOFDAY_R = 0x32E // 814 + SYS_SYNC = 0x32F // 815 + SYS_SPAWN = 0x330 // 816 + SYS_SPAWNP = 0x331 // 817 + SYS_GETLOGIN_UU = 0x332 // 818 + SYS_ECVT = 0x333 // 819 + SYS_FCVT = 0x334 // 820 + SYS_GCVT = 0x335 // 821 + SYS_ACCEPT = 0x336 // 822 + SYS_BIND = 0x337 // 823 + SYS_CONNECT = 0x338 // 824 + SYS_ENDHOSTENT = 0x339 // 825 + SYS_ENDPROTOENT = 0x33A // 826 + SYS_ENDSERVENT = 0x33B // 827 + SYS_GETHOSTBYADDR_R = 0x33C // 828 + SYS_GETHOSTBYADDR = 0x33D // 829 + SYS_GETHOSTBYNAME_R = 0x33E // 830 + SYS_GETHOSTBYNAME = 0x33F // 831 + SYS_GETHOSTENT = 0x340 // 832 + SYS_GETHOSTID = 0x341 // 833 + SYS_GETHOSTNAME = 0x342 // 834 + SYS_GETNETBYADDR = 0x343 // 835 + SYS_GETNETBYNAME = 0x344 // 836 + SYS_GETNETENT = 0x345 // 837 + SYS_GETPEERNAME = 0x346 // 838 + SYS_GETPROTOBYNAME = 0x347 // 839 + SYS_GETPROTOBYNUMBER = 0x348 // 840 + SYS_GETPROTOENT = 0x349 // 841 + SYS_GETSERVBYNAME = 0x34A // 842 + SYS_GETSERVBYPORT = 0x34B // 843 + SYS_GETSERVENT = 0x34C // 844 + SYS_GETSOCKNAME = 0x34D // 845 + SYS_GETSOCKOPT = 0x34E // 846 + SYS_INET_ADDR = 0x34F // 847 + SYS_INET_LNAOF = 0x350 // 848 + SYS_INET_MAKEADDR = 0x351 // 849 + SYS_INET_NETOF = 0x352 // 850 + SYS_INET_NETWORK = 0x353 // 851 + SYS_INET_NTOA = 0x354 // 852 + SYS_IOCTL = 0x355 // 853 + SYS_LISTEN = 0x356 // 854 + SYS_READV = 0x357 // 855 + SYS_RECV = 0x358 // 856 + SYS_RECVFROM = 0x359 // 857 + SYS_SELECT = 0x35B // 859 + SYS_SELECTEX = 0x35C // 860 + SYS_SEND = 0x35D // 861 + SYS_SENDTO = 0x35F // 863 + SYS_SETHOSTENT = 0x360 // 864 + SYS_SETNETENT = 0x361 // 865 + SYS_SETPEER = 0x362 // 866 + SYS_SETPROTOENT = 0x363 // 867 + SYS_SETSERVENT = 0x364 // 868 + SYS_SETSOCKOPT = 0x365 // 869 + SYS_SHUTDOWN = 0x366 // 870 + SYS_SOCKET = 0x367 // 871 + SYS_SOCKETPAIR = 0x368 // 872 + SYS_WRITEV = 0x369 // 873 + SYS_CHROOT = 0x36A // 874 + SYS_W_STATVFS = 0x36B // 875 + SYS_ULIMIT = 0x36C // 876 + SYS_ISNAN = 0x36D // 877 + SYS_UTIMES = 0x36E // 878 + SYS___H_ERRNO = 0x36F // 879 + SYS_ENDNETENT = 0x370 // 880 + SYS_CLOSELOG = 0x371 // 881 + SYS_OPENLOG = 0x372 // 882 + SYS_SETLOGMASK = 0x373 // 883 + SYS_SYSLOG = 0x374 // 884 + SYS_PTSNAME = 0x375 // 885 + SYS_SETREUID = 0x376 // 886 + SYS_SETREGID = 0x377 // 887 + SYS_REALPATH = 0x378 // 888 + SYS___SIGNGAM = 0x379 // 889 + SYS_GRANTPT = 0x37A // 890 + SYS_UNLOCKPT = 0x37B // 891 + SYS_TCGETSID = 0x37C // 892 + SYS___TCGETCP = 0x37D // 893 + SYS___TCSETCP = 0x37E // 894 + SYS___TCSETTABLES = 0x37F // 895 + SYS_POLL = 0x380 // 896 + SYS_REXEC = 0x381 // 897 + SYS___ISASCII2 = 0x382 // 898 + SYS___TOASCII2 = 0x383 // 899 + SYS_CHPRIORITY = 0x384 // 900 + SYS_PTHREAD_ATTR_SETSYNCTYPE_NP = 0x385 // 901 + SYS_PTHREAD_ATTR_GETSYNCTYPE_NP = 0x386 // 902 + SYS_PTHREAD_SET_LIMIT_NP = 0x387 // 903 + SYS___STNETENT = 0x388 // 904 + SYS___STPROTOENT = 0x389 // 905 + SYS___STSERVENT = 0x38A // 906 + SYS___STHOSTENT = 0x38B // 907 + SYS_NLIST = 0x38C // 908 + SYS___IPDBCS = 0x38D // 909 + SYS___IPDSPX = 0x38E // 910 + SYS___IPMSGC = 0x38F // 911 + SYS___SELECT1 = 0x390 // 912 + SYS_PTHREAD_SECURITY_NP = 0x391 // 913 + SYS___CHECK_RESOURCE_AUTH_NP = 0x392 // 914 + SYS___CONVERT_ID_NP = 0x393 // 915 + SYS___OPENVMREL = 0x394 // 916 + SYS_WMEMCHR = 0x395 // 917 + SYS_WMEMCMP = 0x396 // 918 + SYS_WMEMCPY = 0x397 // 919 + SYS_WMEMMOVE = 0x398 // 920 + SYS_WMEMSET = 0x399 // 921 + SYS___FPUTWC = 0x400 // 1024 + SYS___PUTWC = 0x401 // 1025 + SYS___PWCHAR = 0x402 // 1026 + SYS___WCSFTM = 0x403 // 1027 + SYS___WCSTOK = 0x404 // 1028 + SYS___WCWDTH = 0x405 // 1029 + SYS_T_ACCEPT = 0x409 // 1033 + SYS_T_ALLOC = 0x40A // 1034 + SYS_T_BIND = 0x40B // 1035 + SYS_T_CLOSE = 0x40C // 1036 + SYS_T_CONNECT = 0x40D // 1037 + SYS_T_ERROR = 0x40E // 1038 + SYS_T_FREE = 0x40F // 1039 + SYS_T_GETINFO = 0x410 // 1040 + SYS_T_GETPROTADDR = 0x411 // 1041 + SYS_T_GETSTATE = 0x412 // 1042 + SYS_T_LISTEN = 0x413 // 1043 + SYS_T_LOOK = 0x414 // 1044 + SYS_T_OPEN = 0x415 // 1045 + SYS_T_OPTMGMT = 0x416 // 1046 + SYS_T_RCV = 0x417 // 1047 + SYS_T_RCVCONNECT = 0x418 // 1048 + SYS_T_RCVDIS = 0x419 // 1049 + SYS_T_RCVREL = 0x41A // 1050 + SYS_T_RCVUDATA = 0x41B // 1051 + SYS_T_RCVUDERR = 0x41C // 1052 + SYS_T_SND = 0x41D // 1053 + SYS_T_SNDDIS = 0x41E // 1054 + SYS_T_SNDREL = 0x41F // 1055 + SYS_T_SNDUDATA = 0x420 // 1056 + SYS_T_STRERROR = 0x421 // 1057 + SYS_T_SYNC = 0x422 // 1058 + SYS_T_UNBIND = 0x423 // 1059 + SYS___T_ERRNO = 0x424 // 1060 + SYS___RECVMSG2 = 0x425 // 1061 + SYS___SENDMSG2 = 0x426 // 1062 + SYS_FATTACH = 0x427 // 1063 + SYS_FDETACH = 0x428 // 1064 + SYS_GETMSG = 0x429 // 1065 + SYS_GETPMSG = 0x42A // 1066 + SYS_ISASTREAM = 0x42B // 1067 + SYS_PUTMSG = 0x42C // 1068 + SYS_PUTPMSG = 0x42D // 1069 + SYS___ISPOSIXON = 0x42E // 1070 + SYS___OPENMVSREL = 0x42F // 1071 + SYS_GETCONTEXT = 0x430 // 1072 + SYS_SETCONTEXT = 0x431 // 1073 + SYS_MAKECONTEXT = 0x432 // 1074 + SYS_SWAPCONTEXT = 0x433 // 1075 + SYS_PTHREAD_GETSPECIFIC_D8_NP = 0x434 // 1076 + SYS_GETCLIENTID = 0x470 // 1136 + SYS___GETCLIENTID = 0x471 // 1137 + SYS_GETSTABLESIZE = 0x472 // 1138 + SYS_GETIBMOPT = 0x473 // 1139 + SYS_GETIBMSOCKOPT = 0x474 // 1140 + SYS_GIVESOCKET = 0x475 // 1141 + SYS_IBMSFLUSH = 0x476 // 1142 + SYS_MAXDESC = 0x477 // 1143 + SYS_SETIBMOPT = 0x478 // 1144 + SYS_SETIBMSOCKOPT = 0x479 // 1145 + SYS_SOCK_DEBUG = 0x47A // 1146 + SYS_SOCK_DO_TESTSTOR = 0x47D // 1149 + SYS_TAKESOCKET = 0x47E // 1150 + SYS___SERVER_INIT = 0x47F // 1151 + SYS___SERVER_PWU = 0x480 // 1152 + SYS_PTHREAD_TAG_NP = 0x481 // 1153 + SYS___CONSOLE = 0x482 // 1154 + SYS___WSINIT = 0x483 // 1155 + SYS___IPTCPN = 0x489 // 1161 + SYS___SMF_RECORD = 0x48A // 1162 + SYS___IPHOST = 0x48B // 1163 + SYS___IPNODE = 0x48C // 1164 + SYS___SERVER_CLASSIFY_CREATE = 0x48D // 1165 + SYS___SERVER_CLASSIFY_DESTROY = 0x48E // 1166 + SYS___SERVER_CLASSIFY_RESET = 0x48F // 1167 + SYS___SERVER_CLASSIFY = 0x490 // 1168 + SYS___HEAPRPT = 0x496 // 1174 + SYS___FNWSA = 0x49B // 1179 + SYS___SPAWN2 = 0x49D // 1181 + SYS___SPAWNP2 = 0x49E // 1182 + SYS___GDRR = 0x4A1 // 1185 + SYS___HRRNO = 0x4A2 // 1186 + SYS___OPRG = 0x4A3 // 1187 + SYS___OPRR = 0x4A4 // 1188 + SYS___OPND = 0x4A5 // 1189 + SYS___OPPT = 0x4A6 // 1190 + SYS___SIGGM = 0x4A7 // 1191 + SYS___DGHT = 0x4A8 // 1192 + SYS___TZNE = 0x4A9 // 1193 + SYS___TZZN = 0x4AA // 1194 + SYS___TRRNO = 0x4AF // 1199 + SYS___ENVN = 0x4B0 // 1200 + SYS___MLOCKALL = 0x4B1 // 1201 + SYS_CREATEWO = 0x4B2 // 1202 + SYS_CREATEWORKUNIT = 0x4B2 // 1202 + SYS_CONTINUE = 0x4B3 // 1203 + SYS_CONTINUEWORKUNIT = 0x4B3 // 1203 + SYS_CONNECTW = 0x4B4 // 1204 + SYS_CONNECTWORKMGR = 0x4B4 // 1204 + SYS_CONNECTS = 0x4B5 // 1205 + SYS_CONNECTSERVER = 0x4B5 // 1205 + SYS_DISCONNE = 0x4B6 // 1206 + SYS_DISCONNECTSERVER = 0x4B6 // 1206 + SYS_JOINWORK = 0x4B7 // 1207 + SYS_JOINWORKUNIT = 0x4B7 // 1207 + SYS_LEAVEWOR = 0x4B8 // 1208 + SYS_LEAVEWORKUNIT = 0x4B8 // 1208 + SYS_DELETEWO = 0x4B9 // 1209 + SYS_DELETEWORKUNIT = 0x4B9 // 1209 + SYS_QUERYMET = 0x4BA // 1210 + SYS_QUERYMETRICS = 0x4BA // 1210 + SYS_QUERYSCH = 0x4BB // 1211 + SYS_QUERYSCHENV = 0x4BB // 1211 + SYS_CHECKSCH = 0x4BC // 1212 + SYS_CHECKSCHENV = 0x4BC // 1212 + SYS___PID_AFFINITY = 0x4BD // 1213 + SYS___ASINH_B = 0x4BE // 1214 + SYS___ATAN_B = 0x4BF // 1215 + SYS___CBRT_B = 0x4C0 // 1216 + SYS___CEIL_B = 0x4C1 // 1217 + SYS_COPYSIGN = 0x4C2 // 1218 + SYS___COS_B = 0x4C3 // 1219 + SYS___ERF_B = 0x4C4 // 1220 + SYS___ERFC_B = 0x4C5 // 1221 + SYS___EXPM1_B = 0x4C6 // 1222 + SYS___FABS_B = 0x4C7 // 1223 + SYS_FINITE = 0x4C8 // 1224 + SYS___FLOOR_B = 0x4C9 // 1225 + SYS___FREXP_B = 0x4CA // 1226 + SYS___ILOGB_B = 0x4CB // 1227 + SYS___ISNAN_B = 0x4CC // 1228 + SYS___LDEXP_B = 0x4CD // 1229 + SYS___LOG1P_B = 0x4CE // 1230 + SYS___LOGB_B = 0x4CF // 1231 + SYS_MATHERR = 0x4D0 // 1232 + SYS___MODF_B = 0x4D1 // 1233 + SYS___NEXTAFTER_B = 0x4D2 // 1234 + SYS___RINT_B = 0x4D3 // 1235 + SYS_SCALBN = 0x4D4 // 1236 + SYS_SIGNIFIC = 0x4D5 // 1237 + SYS_SIGNIFICAND = 0x4D5 // 1237 + SYS___SIN_B = 0x4D6 // 1238 + SYS___TAN_B = 0x4D7 // 1239 + SYS___TANH_B = 0x4D8 // 1240 + SYS___ACOS_B = 0x4D9 // 1241 + SYS___ACOSH_B = 0x4DA // 1242 + SYS___ASIN_B = 0x4DB // 1243 + SYS___ATAN2_B = 0x4DC // 1244 + SYS___ATANH_B = 0x4DD // 1245 + SYS___COSH_B = 0x4DE // 1246 + SYS___EXP_B = 0x4DF // 1247 + SYS___FMOD_B = 0x4E0 // 1248 + SYS___GAMMA_B = 0x4E1 // 1249 + SYS_GAMMA_R = 0x4E2 // 1250 + SYS___HYPOT_B = 0x4E3 // 1251 + SYS___J0_B = 0x4E4 // 1252 + SYS___Y0_B = 0x4E5 // 1253 + SYS___J1_B = 0x4E6 // 1254 + SYS___Y1_B = 0x4E7 // 1255 + SYS___JN_B = 0x4E8 // 1256 + SYS___YN_B = 0x4E9 // 1257 + SYS___LGAMMA_B = 0x4EA // 1258 + SYS_LGAMMA_R = 0x4EB // 1259 + SYS___LOG_B = 0x4EC // 1260 + SYS___LOG10_B = 0x4ED // 1261 + SYS___POW_B = 0x4EE // 1262 + SYS___REMAINDER_B = 0x4EF // 1263 + SYS___SCALB_B = 0x4F0 // 1264 + SYS___SINH_B = 0x4F1 // 1265 + SYS___SQRT_B = 0x4F2 // 1266 + SYS___OPENDIR2 = 0x4F3 // 1267 + SYS___READDIR2 = 0x4F4 // 1268 + SYS___LOGIN = 0x4F5 // 1269 + SYS___OPEN_STAT = 0x4F6 // 1270 + SYS_ACCEPT_AND_RECV = 0x4F7 // 1271 + SYS___FP_SETMODE = 0x4F8 // 1272 + SYS___SIGACTIONSET = 0x4FB // 1275 + SYS___UCREATE = 0x4FC // 1276 + SYS___UMALLOC = 0x4FD // 1277 + SYS___UFREE = 0x4FE // 1278 + SYS___UHEAPREPORT = 0x4FF // 1279 + SYS___ISBFP = 0x500 // 1280 + SYS___FP_CAST = 0x501 // 1281 + SYS___CERTIFICATE = 0x502 // 1282 + SYS_SEND_FILE = 0x503 // 1283 + SYS_AIO_CANCEL = 0x504 // 1284 + SYS_AIO_ERROR = 0x505 // 1285 + SYS_AIO_READ = 0x506 // 1286 + SYS_AIO_RETURN = 0x507 // 1287 + SYS_AIO_SUSPEND = 0x508 // 1288 + SYS_AIO_WRITE = 0x509 // 1289 + SYS_PTHREAD_MUTEXATTR_GETPSHARED = 0x50A // 1290 + SYS_PTHREAD_MUTEXATTR_SETPSHARED = 0x50B // 1291 + SYS_PTHREAD_RWLOCK_DESTROY = 0x50C // 1292 + SYS_PTHREAD_RWLOCK_INIT = 0x50D // 1293 + SYS_PTHREAD_RWLOCK_RDLOCK = 0x50E // 1294 + SYS_PTHREAD_RWLOCK_TRYRDLOCK = 0x50F // 1295 + SYS_PTHREAD_RWLOCK_TRYWRLOCK = 0x510 // 1296 + SYS_PTHREAD_RWLOCK_UNLOCK = 0x511 // 1297 + SYS_PTHREAD_RWLOCK_WRLOCK = 0x512 // 1298 + SYS_PTHREAD_RWLOCKATTR_GETPSHARED = 0x513 // 1299 + SYS_PTHREAD_RWLOCKATTR_SETPSHARED = 0x514 // 1300 + SYS_PTHREAD_RWLOCKATTR_INIT = 0x515 // 1301 + SYS_PTHREAD_RWLOCKATTR_DESTROY = 0x516 // 1302 + SYS___CTTBL = 0x517 // 1303 + SYS_PTHREAD_MUTEXATTR_SETTYPE = 0x518 // 1304 + SYS_PTHREAD_MUTEXATTR_GETTYPE = 0x519 // 1305 + SYS___FP_CLR_FLAG = 0x51A // 1306 + SYS___FP_READ_FLAG = 0x51B // 1307 + SYS___FP_RAISE_XCP = 0x51C // 1308 + SYS___FP_CLASS = 0x51D // 1309 + SYS___FP_FINITE = 0x51E // 1310 + SYS___FP_ISNAN = 0x51F // 1311 + SYS___FP_UNORDERED = 0x520 // 1312 + SYS___FP_READ_RND = 0x521 // 1313 + SYS___FP_READ_RND_B = 0x522 // 1314 + SYS___FP_SWAP_RND = 0x523 // 1315 + SYS___FP_SWAP_RND_B = 0x524 // 1316 + SYS___FP_LEVEL = 0x525 // 1317 + SYS___FP_BTOH = 0x526 // 1318 + SYS___FP_HTOB = 0x527 // 1319 + SYS___FPC_RD = 0x528 // 1320 + SYS___FPC_WR = 0x529 // 1321 + SYS___FPC_RW = 0x52A // 1322 + SYS___FPC_SM = 0x52B // 1323 + SYS___FPC_RS = 0x52C // 1324 + SYS_SIGTIMEDWAIT = 0x52D // 1325 + SYS_SIGWAITINFO = 0x52E // 1326 + SYS___CHKBFP = 0x52F // 1327 + SYS___W_PIOCTL = 0x59E // 1438 + SYS___OSENV = 0x59F // 1439 + SYS_EXPORTWO = 0x5A1 // 1441 + SYS_EXPORTWORKUNIT = 0x5A1 // 1441 + SYS_UNDOEXPO = 0x5A2 // 1442 + SYS_UNDOEXPORTWORKUNIT = 0x5A2 // 1442 + SYS_IMPORTWO = 0x5A3 // 1443 + SYS_IMPORTWORKUNIT = 0x5A3 // 1443 + SYS_UNDOIMPO = 0x5A4 // 1444 + SYS_UNDOIMPORTWORKUNIT = 0x5A4 // 1444 + SYS_EXTRACTW = 0x5A5 // 1445 + SYS_EXTRACTWORKUNIT = 0x5A5 // 1445 + SYS___CPL = 0x5A6 // 1446 + SYS___MAP_INIT = 0x5A7 // 1447 + SYS___MAP_SERVICE = 0x5A8 // 1448 + SYS_SIGQUEUE = 0x5A9 // 1449 + SYS___MOUNT = 0x5AA // 1450 + SYS___GETUSERID = 0x5AB // 1451 + SYS___IPDOMAINNAME = 0x5AC // 1452 + SYS_QUERYENC = 0x5AD // 1453 + SYS_QUERYWORKUNITCLASSIFICATION = 0x5AD // 1453 + SYS_CONNECTE = 0x5AE // 1454 + SYS_CONNECTEXPORTIMPORT = 0x5AE // 1454 + SYS___FP_SWAPMODE = 0x5AF // 1455 + SYS_STRTOLL = 0x5B0 // 1456 + SYS_STRTOULL = 0x5B1 // 1457 + SYS___DSA_PREV = 0x5B2 // 1458 + SYS___EP_FIND = 0x5B3 // 1459 + SYS___SERVER_THREADS_QUERY = 0x5B4 // 1460 + SYS___MSGRCV_TIMED = 0x5B7 // 1463 + SYS___SEMOP_TIMED = 0x5B8 // 1464 + SYS___GET_CPUID = 0x5B9 // 1465 + SYS___GET_SYSTEM_SETTINGS = 0x5BA // 1466 + SYS_FTELLO = 0x5C8 // 1480 + SYS_FSEEKO = 0x5C9 // 1481 + SYS_LLDIV = 0x5CB // 1483 + SYS_WCSTOLL = 0x5CC // 1484 + SYS_WCSTOULL = 0x5CD // 1485 + SYS_LLABS = 0x5CE // 1486 + SYS___CONSOLE2 = 0x5D2 // 1490 + SYS_INET_NTOP = 0x5D3 // 1491 + SYS_INET_PTON = 0x5D4 // 1492 + SYS___RES = 0x5D6 // 1494 + SYS_RES_MKQUERY = 0x5D7 // 1495 + SYS_RES_INIT = 0x5D8 // 1496 + SYS_RES_QUERY = 0x5D9 // 1497 + SYS_RES_SEARCH = 0x5DA // 1498 + SYS_RES_SEND = 0x5DB // 1499 + SYS_RES_QUERYDOMAIN = 0x5DC // 1500 + SYS_DN_EXPAND = 0x5DD // 1501 + SYS_DN_SKIPNAME = 0x5DE // 1502 + SYS_DN_COMP = 0x5DF // 1503 + SYS_ASCTIME_R = 0x5E0 // 1504 + SYS_CTIME_R = 0x5E1 // 1505 + SYS_GMTIME_R = 0x5E2 // 1506 + SYS_LOCALTIME_R = 0x5E3 // 1507 + SYS_RAND_R = 0x5E4 // 1508 + SYS_STRTOK_R = 0x5E5 // 1509 + SYS_READDIR_R = 0x5E6 // 1510 + SYS_GETGRGID_R = 0x5E7 // 1511 + SYS_GETGRNAM_R = 0x5E8 // 1512 + SYS_GETLOGIN_R = 0x5E9 // 1513 + SYS_GETPWNAM_R = 0x5EA // 1514 + SYS_GETPWUID_R = 0x5EB // 1515 + SYS_TTYNAME_R = 0x5EC // 1516 + SYS_PTHREAD_ATFORK = 0x5ED // 1517 + SYS_PTHREAD_ATTR_GETGUARDSIZE = 0x5EE // 1518 + SYS_PTHREAD_ATTR_GETSTACKADDR = 0x5EF // 1519 + SYS_PTHREAD_ATTR_SETGUARDSIZE = 0x5F0 // 1520 + SYS_PTHREAD_ATTR_SETSTACKADDR = 0x5F1 // 1521 + SYS_PTHREAD_CONDATTR_GETPSHARED = 0x5F2 // 1522 + SYS_PTHREAD_CONDATTR_SETPSHARED = 0x5F3 // 1523 + SYS_PTHREAD_GETCONCURRENCY = 0x5F4 // 1524 + SYS_PTHREAD_KEY_DELETE = 0x5F5 // 1525 + SYS_PTHREAD_SETCONCURRENCY = 0x5F6 // 1526 + SYS_PTHREAD_SIGMASK = 0x5F7 // 1527 + SYS___DISCARDDATA = 0x5F8 // 1528 + SYS_PTHREAD_ATTR_GETSCHEDPARAM = 0x5F9 // 1529 + SYS_PTHREAD_ATTR_SETSCHEDPARAM = 0x5FA // 1530 + SYS_PTHREAD_ATTR_GETDETACHSTATE_U98 = 0x5FB // 1531 + SYS_PTHREAD_ATTR_SETDETACHSTATE_U98 = 0x5FC // 1532 + SYS_PTHREAD_DETACH_U98 = 0x5FD // 1533 + SYS_PTHREAD_GETSPECIFIC_U98 = 0x5FE // 1534 + SYS_PTHREAD_SETCANCELSTATE = 0x5FF // 1535 + SYS_PTHREAD_SETCANCELTYPE = 0x600 // 1536 + SYS_PTHREAD_TESTCANCEL = 0x601 // 1537 + SYS___ATANF_B = 0x602 // 1538 + SYS___ATANL_B = 0x603 // 1539 + SYS___CEILF_B = 0x604 // 1540 + SYS___CEILL_B = 0x605 // 1541 + SYS___COSF_B = 0x606 // 1542 + SYS___COSL_B = 0x607 // 1543 + SYS___FABSF_B = 0x608 // 1544 + SYS___FABSL_B = 0x609 // 1545 + SYS___FLOORF_B = 0x60A // 1546 + SYS___FLOORL_B = 0x60B // 1547 + SYS___FREXPF_B = 0x60C // 1548 + SYS___FREXPL_B = 0x60D // 1549 + SYS___LDEXPF_B = 0x60E // 1550 + SYS___LDEXPL_B = 0x60F // 1551 + SYS___SINF_B = 0x610 // 1552 + SYS___SINL_B = 0x611 // 1553 + SYS___TANF_B = 0x612 // 1554 + SYS___TANL_B = 0x613 // 1555 + SYS___TANHF_B = 0x614 // 1556 + SYS___TANHL_B = 0x615 // 1557 + SYS___ACOSF_B = 0x616 // 1558 + SYS___ACOSL_B = 0x617 // 1559 + SYS___ASINF_B = 0x618 // 1560 + SYS___ASINL_B = 0x619 // 1561 + SYS___ATAN2F_B = 0x61A // 1562 + SYS___ATAN2L_B = 0x61B // 1563 + SYS___COSHF_B = 0x61C // 1564 + SYS___COSHL_B = 0x61D // 1565 + SYS___EXPF_B = 0x61E // 1566 + SYS___EXPL_B = 0x61F // 1567 + SYS___LOGF_B = 0x620 // 1568 + SYS___LOGL_B = 0x621 // 1569 + SYS___LOG10F_B = 0x622 // 1570 + SYS___LOG10L_B = 0x623 // 1571 + SYS___POWF_B = 0x624 // 1572 + SYS___POWL_B = 0x625 // 1573 + SYS___SINHF_B = 0x626 // 1574 + SYS___SINHL_B = 0x627 // 1575 + SYS___SQRTF_B = 0x628 // 1576 + SYS___SQRTL_B = 0x629 // 1577 + SYS___ABSF_B = 0x62A // 1578 + SYS___ABS_B = 0x62B // 1579 + SYS___ABSL_B = 0x62C // 1580 + SYS___FMODF_B = 0x62D // 1581 + SYS___FMODL_B = 0x62E // 1582 + SYS___MODFF_B = 0x62F // 1583 + SYS___MODFL_B = 0x630 // 1584 + SYS_ABSF = 0x631 // 1585 + SYS_ABSL = 0x632 // 1586 + SYS_ACOSF = 0x633 // 1587 + SYS_ACOSL = 0x634 // 1588 + SYS_ASINF = 0x635 // 1589 + SYS_ASINL = 0x636 // 1590 + SYS_ATAN2F = 0x637 // 1591 + SYS_ATAN2L = 0x638 // 1592 + SYS_ATANF = 0x639 // 1593 + SYS_ATANL = 0x63A // 1594 + SYS_CEILF = 0x63B // 1595 + SYS_CEILL = 0x63C // 1596 + SYS_COSF = 0x63D // 1597 + SYS_COSL = 0x63E // 1598 + SYS_COSHF = 0x63F // 1599 + SYS_COSHL = 0x640 // 1600 + SYS_EXPF = 0x641 // 1601 + SYS_EXPL = 0x642 // 1602 + SYS_TANHF = 0x643 // 1603 + SYS_TANHL = 0x644 // 1604 + SYS_LOG10F = 0x645 // 1605 + SYS_LOG10L = 0x646 // 1606 + SYS_LOGF = 0x647 // 1607 + SYS_LOGL = 0x648 // 1608 + SYS_POWF = 0x649 // 1609 + SYS_POWL = 0x64A // 1610 + SYS_SINF = 0x64B // 1611 + SYS_SINL = 0x64C // 1612 + SYS_SQRTF = 0x64D // 1613 + SYS_SQRTL = 0x64E // 1614 + SYS_SINHF = 0x64F // 1615 + SYS_SINHL = 0x650 // 1616 + SYS_TANF = 0x651 // 1617 + SYS_TANL = 0x652 // 1618 + SYS_FABSF = 0x653 // 1619 + SYS_FABSL = 0x654 // 1620 + SYS_FLOORF = 0x655 // 1621 + SYS_FLOORL = 0x656 // 1622 + SYS_FMODF = 0x657 // 1623 + SYS_FMODL = 0x658 // 1624 + SYS_FREXPF = 0x659 // 1625 + SYS_FREXPL = 0x65A // 1626 + SYS_LDEXPF = 0x65B // 1627 + SYS_LDEXPL = 0x65C // 1628 + SYS_MODFF = 0x65D // 1629 + SYS_MODFL = 0x65E // 1630 + SYS_BTOWC = 0x65F // 1631 + SYS___CHATTR = 0x660 // 1632 + SYS___FCHATTR = 0x661 // 1633 + SYS___TOCCSID = 0x662 // 1634 + SYS___CSNAMETYPE = 0x663 // 1635 + SYS___TOCSNAME = 0x664 // 1636 + SYS___CCSIDTYPE = 0x665 // 1637 + SYS___AE_CORRESTBL_QUERY = 0x666 // 1638 + SYS___AE_AUTOCONVERT_STATE = 0x667 // 1639 + SYS_DN_FIND = 0x668 // 1640 + SYS___GETHOSTBYADDR_A = 0x669 // 1641 + SYS___GETHOSTBYNAME_A = 0x66A // 1642 + SYS___RES_INIT_A = 0x66B // 1643 + SYS___GETHOSTBYADDR_R_A = 0x66C // 1644 + SYS___GETHOSTBYNAME_R_A = 0x66D // 1645 + SYS___CHARMAP_INIT_A = 0x66E // 1646 + SYS___MBLEN_A = 0x66F // 1647 + SYS___MBLEN_SB_A = 0x670 // 1648 + SYS___MBLEN_STD_A = 0x671 // 1649 + SYS___MBLEN_UTF = 0x672 // 1650 + SYS___MBSTOWCS_A = 0x673 // 1651 + SYS___MBSTOWCS_STD_A = 0x674 // 1652 + SYS___MBTOWC_A = 0x675 // 1653 + SYS___MBTOWC_ISO1 = 0x676 // 1654 + SYS___MBTOWC_SBCS = 0x677 // 1655 + SYS___MBTOWC_MBCS = 0x678 // 1656 + SYS___MBTOWC_UTF = 0x679 // 1657 + SYS___WCSTOMBS_A = 0x67A // 1658 + SYS___WCSTOMBS_STD_A = 0x67B // 1659 + SYS___WCSWIDTH_A = 0x67C // 1660 + SYS___GETGRGID_R_A = 0x67D // 1661 + SYS___WCSWIDTH_STD_A = 0x67E // 1662 + SYS___WCSWIDTH_ASIA = 0x67F // 1663 + SYS___CSID_A = 0x680 // 1664 + SYS___CSID_STD_A = 0x681 // 1665 + SYS___WCSID_A = 0x682 // 1666 + SYS___WCSID_STD_A = 0x683 // 1667 + SYS___WCTOMB_A = 0x684 // 1668 + SYS___WCTOMB_ISO1 = 0x685 // 1669 + SYS___WCTOMB_STD_A = 0x686 // 1670 + SYS___WCTOMB_UTF = 0x687 // 1671 + SYS___WCWIDTH_A = 0x688 // 1672 + SYS___GETGRNAM_R_A = 0x689 // 1673 + SYS___WCWIDTH_STD_A = 0x68A // 1674 + SYS___WCWIDTH_ASIA = 0x68B // 1675 + SYS___GETPWNAM_R_A = 0x68C // 1676 + SYS___GETPWUID_R_A = 0x68D // 1677 + SYS___GETLOGIN_R_A = 0x68E // 1678 + SYS___TTYNAME_R_A = 0x68F // 1679 + SYS___READDIR_R_A = 0x690 // 1680 + SYS___E2A_S = 0x691 // 1681 + SYS___FNMATCH_A = 0x692 // 1682 + SYS___FNMATCH_C_A = 0x693 // 1683 + SYS___EXECL_A = 0x694 // 1684 + SYS___FNMATCH_STD_A = 0x695 // 1685 + SYS___REGCOMP_A = 0x696 // 1686 + SYS___REGCOMP_STD_A = 0x697 // 1687 + SYS___REGERROR_A = 0x698 // 1688 + SYS___REGERROR_STD_A = 0x699 // 1689 + SYS___REGEXEC_A = 0x69A // 1690 + SYS___REGEXEC_STD_A = 0x69B // 1691 + SYS___REGFREE_A = 0x69C // 1692 + SYS___REGFREE_STD_A = 0x69D // 1693 + SYS___STRCOLL_A = 0x69E // 1694 + SYS___STRCOLL_C_A = 0x69F // 1695 + SYS___EXECLE_A = 0x6A0 // 1696 + SYS___STRCOLL_STD_A = 0x6A1 // 1697 + SYS___STRXFRM_A = 0x6A2 // 1698 + SYS___STRXFRM_C_A = 0x6A3 // 1699 + SYS___EXECLP_A = 0x6A4 // 1700 + SYS___STRXFRM_STD_A = 0x6A5 // 1701 + SYS___WCSCOLL_A = 0x6A6 // 1702 + SYS___WCSCOLL_C_A = 0x6A7 // 1703 + SYS___WCSCOLL_STD_A = 0x6A8 // 1704 + SYS___WCSXFRM_A = 0x6A9 // 1705 + SYS___WCSXFRM_C_A = 0x6AA // 1706 + SYS___WCSXFRM_STD_A = 0x6AB // 1707 + SYS___COLLATE_INIT_A = 0x6AC // 1708 + SYS___WCTYPE_A = 0x6AD // 1709 + SYS___GET_WCTYPE_STD_A = 0x6AE // 1710 + SYS___CTYPE_INIT_A = 0x6AF // 1711 + SYS___ISWCTYPE_A = 0x6B0 // 1712 + SYS___EXECV_A = 0x6B1 // 1713 + SYS___IS_WCTYPE_STD_A = 0x6B2 // 1714 + SYS___TOWLOWER_A = 0x6B3 // 1715 + SYS___TOWLOWER_STD_A = 0x6B4 // 1716 + SYS___TOWUPPER_A = 0x6B5 // 1717 + SYS___TOWUPPER_STD_A = 0x6B6 // 1718 + SYS___LOCALE_INIT_A = 0x6B7 // 1719 + SYS___LOCALECONV_A = 0x6B8 // 1720 + SYS___LOCALECONV_STD_A = 0x6B9 // 1721 + SYS___NL_LANGINFO_A = 0x6BA // 1722 + SYS___NL_LNAGINFO_STD_A = 0x6BB // 1723 + SYS___MONETARY_INIT_A = 0x6BC // 1724 + SYS___STRFMON_A = 0x6BD // 1725 + SYS___STRFMON_STD_A = 0x6BE // 1726 + SYS___GETADDRINFO_A = 0x6BF // 1727 + SYS___CATGETS_A = 0x6C0 // 1728 + SYS___EXECVE_A = 0x6C1 // 1729 + SYS___EXECVP_A = 0x6C2 // 1730 + SYS___SPAWN_A = 0x6C3 // 1731 + SYS___GETNAMEINFO_A = 0x6C4 // 1732 + SYS___SPAWNP_A = 0x6C5 // 1733 + SYS___NUMERIC_INIT_A = 0x6C6 // 1734 + SYS___RESP_INIT_A = 0x6C7 // 1735 + SYS___RPMATCH_A = 0x6C8 // 1736 + SYS___RPMATCH_C_A = 0x6C9 // 1737 + SYS___RPMATCH_STD_A = 0x6CA // 1738 + SYS___TIME_INIT_A = 0x6CB // 1739 + SYS___STRFTIME_A = 0x6CC // 1740 + SYS___STRFTIME_STD_A = 0x6CD // 1741 + SYS___STRPTIME_A = 0x6CE // 1742 + SYS___STRPTIME_STD_A = 0x6CF // 1743 + SYS___WCSFTIME_A = 0x6D0 // 1744 + SYS___WCSFTIME_STD_A = 0x6D1 // 1745 + SYS_____SPAWN2_A = 0x6D2 // 1746 + SYS_____SPAWNP2_A = 0x6D3 // 1747 + SYS___SYNTAX_INIT_A = 0x6D4 // 1748 + SYS___TOD_INIT_A = 0x6D5 // 1749 + SYS___NL_CSINFO_A = 0x6D6 // 1750 + SYS___NL_MONINFO_A = 0x6D7 // 1751 + SYS___NL_NUMINFO_A = 0x6D8 // 1752 + SYS___NL_RESPINFO_A = 0x6D9 // 1753 + SYS___NL_TIMINFO_A = 0x6DA // 1754 + SYS___IF_NAMETOINDEX_A = 0x6DB // 1755 + SYS___IF_INDEXTONAME_A = 0x6DC // 1756 + SYS___PRINTF_A = 0x6DD // 1757 + SYS___ICONV_OPEN_A = 0x6DE // 1758 + SYS___DLLLOAD_A = 0x6DF // 1759 + SYS___DLLQUERYFN_A = 0x6E0 // 1760 + SYS___DLLQUERYVAR_A = 0x6E1 // 1761 + SYS_____CHATTR_A = 0x6E2 // 1762 + SYS___E2A_L = 0x6E3 // 1763 + SYS_____TOCCSID_A = 0x6E4 // 1764 + SYS_____TOCSNAME_A = 0x6E5 // 1765 + SYS_____CCSIDTYPE_A = 0x6E6 // 1766 + SYS_____CSNAMETYPE_A = 0x6E7 // 1767 + SYS___CHMOD_A = 0x6E8 // 1768 + SYS___MKDIR_A = 0x6E9 // 1769 + SYS___STAT_A = 0x6EA // 1770 + SYS___STAT_O_A = 0x6EB // 1771 + SYS___MKFIFO_A = 0x6EC // 1772 + SYS_____OPEN_STAT_A = 0x6ED // 1773 + SYS___LSTAT_A = 0x6EE // 1774 + SYS___LSTAT_O_A = 0x6EF // 1775 + SYS___MKNOD_A = 0x6F0 // 1776 + SYS___MOUNT_A = 0x6F1 // 1777 + SYS___UMOUNT_A = 0x6F2 // 1778 + SYS___CHAUDIT_A = 0x6F4 // 1780 + SYS___W_GETMNTENT_A = 0x6F5 // 1781 + SYS___CREAT_A = 0x6F6 // 1782 + SYS___OPEN_A = 0x6F7 // 1783 + SYS___SETLOCALE_A = 0x6F9 // 1785 + SYS___FPRINTF_A = 0x6FA // 1786 + SYS___SPRINTF_A = 0x6FB // 1787 + SYS___VFPRINTF_A = 0x6FC // 1788 + SYS___VPRINTF_A = 0x6FD // 1789 + SYS___VSPRINTF_A = 0x6FE // 1790 + SYS___VSWPRINTF_A = 0x6FF // 1791 + SYS___SWPRINTF_A = 0x700 // 1792 + SYS___FSCANF_A = 0x701 // 1793 + SYS___SCANF_A = 0x702 // 1794 + SYS___SSCANF_A = 0x703 // 1795 + SYS___SWSCANF_A = 0x704 // 1796 + SYS___ATOF_A = 0x705 // 1797 + SYS___ATOI_A = 0x706 // 1798 + SYS___ATOL_A = 0x707 // 1799 + SYS___STRTOD_A = 0x708 // 1800 + SYS___STRTOL_A = 0x709 // 1801 + SYS___STRTOUL_A = 0x70A // 1802 + SYS_____AE_CORRESTBL_QUERY_A = 0x70B // 1803 + SYS___A64L_A = 0x70C // 1804 + SYS___ECVT_A = 0x70D // 1805 + SYS___FCVT_A = 0x70E // 1806 + SYS___GCVT_A = 0x70F // 1807 + SYS___L64A_A = 0x710 // 1808 + SYS___STRERROR_A = 0x711 // 1809 + SYS___PERROR_A = 0x712 // 1810 + SYS___FETCH_A = 0x713 // 1811 + SYS___GETENV_A = 0x714 // 1812 + SYS___MKSTEMP_A = 0x717 // 1815 + SYS___PTSNAME_A = 0x718 // 1816 + SYS___PUTENV_A = 0x719 // 1817 + SYS___REALPATH_A = 0x71A // 1818 + SYS___SETENV_A = 0x71B // 1819 + SYS___SYSTEM_A = 0x71C // 1820 + SYS___GETOPT_A = 0x71D // 1821 + SYS___CATOPEN_A = 0x71E // 1822 + SYS___ACCESS_A = 0x71F // 1823 + SYS___CHDIR_A = 0x720 // 1824 + SYS___CHOWN_A = 0x721 // 1825 + SYS___CHROOT_A = 0x722 // 1826 + SYS___GETCWD_A = 0x723 // 1827 + SYS___GETWD_A = 0x724 // 1828 + SYS___LCHOWN_A = 0x725 // 1829 + SYS___LINK_A = 0x726 // 1830 + SYS___PATHCONF_A = 0x727 // 1831 + SYS___IF_NAMEINDEX_A = 0x728 // 1832 + SYS___READLINK_A = 0x729 // 1833 + SYS___RMDIR_A = 0x72A // 1834 + SYS___STATVFS_A = 0x72B // 1835 + SYS___SYMLINK_A = 0x72C // 1836 + SYS___TRUNCATE_A = 0x72D // 1837 + SYS___UNLINK_A = 0x72E // 1838 + SYS___GAI_STRERROR_A = 0x72F // 1839 + SYS___EXTLINK_NP_A = 0x730 // 1840 + SYS___ISALNUM_A = 0x731 // 1841 + SYS___ISALPHA_A = 0x732 // 1842 + SYS___A2E_S = 0x733 // 1843 + SYS___ISCNTRL_A = 0x734 // 1844 + SYS___ISDIGIT_A = 0x735 // 1845 + SYS___ISGRAPH_A = 0x736 // 1846 + SYS___ISLOWER_A = 0x737 // 1847 + SYS___ISPRINT_A = 0x738 // 1848 + SYS___ISPUNCT_A = 0x739 // 1849 + SYS___ISSPACE_A = 0x73A // 1850 + SYS___ISUPPER_A = 0x73B // 1851 + SYS___ISXDIGIT_A = 0x73C // 1852 + SYS___TOLOWER_A = 0x73D // 1853 + SYS___TOUPPER_A = 0x73E // 1854 + SYS___ISWALNUM_A = 0x73F // 1855 + SYS___ISWALPHA_A = 0x740 // 1856 + SYS___A2E_L = 0x741 // 1857 + SYS___ISWCNTRL_A = 0x742 // 1858 + SYS___ISWDIGIT_A = 0x743 // 1859 + SYS___ISWGRAPH_A = 0x744 // 1860 + SYS___ISWLOWER_A = 0x745 // 1861 + SYS___ISWPRINT_A = 0x746 // 1862 + SYS___ISWPUNCT_A = 0x747 // 1863 + SYS___ISWSPACE_A = 0x748 // 1864 + SYS___ISWUPPER_A = 0x749 // 1865 + SYS___ISWXDIGIT_A = 0x74A // 1866 + SYS___CONFSTR_A = 0x74B // 1867 + SYS___FTOK_A = 0x74C // 1868 + SYS___MKTEMP_A = 0x74D // 1869 + SYS___FDOPEN_A = 0x74E // 1870 + SYS___FLDATA_A = 0x74F // 1871 + SYS___REMOVE_A = 0x750 // 1872 + SYS___RENAME_A = 0x751 // 1873 + SYS___TMPNAM_A = 0x752 // 1874 + SYS___FOPEN_A = 0x753 // 1875 + SYS___FREOPEN_A = 0x754 // 1876 + SYS___CUSERID_A = 0x755 // 1877 + SYS___POPEN_A = 0x756 // 1878 + SYS___TEMPNAM_A = 0x757 // 1879 + SYS___FTW_A = 0x758 // 1880 + SYS___GETGRENT_A = 0x759 // 1881 + SYS___GETGRGID_A = 0x75A // 1882 + SYS___GETGRNAM_A = 0x75B // 1883 + SYS___GETGROUPSBYNAME_A = 0x75C // 1884 + SYS___GETHOSTENT_A = 0x75D // 1885 + SYS___GETHOSTNAME_A = 0x75E // 1886 + SYS___GETLOGIN_A = 0x75F // 1887 + SYS___INET_NTOP_A = 0x760 // 1888 + SYS___GETPASS_A = 0x761 // 1889 + SYS___GETPWENT_A = 0x762 // 1890 + SYS___GETPWNAM_A = 0x763 // 1891 + SYS___GETPWUID_A = 0x764 // 1892 + SYS_____CHECK_RESOURCE_AUTH_NP_A = 0x765 // 1893 + SYS___CHECKSCHENV_A = 0x766 // 1894 + SYS___CONNECTSERVER_A = 0x767 // 1895 + SYS___CONNECTWORKMGR_A = 0x768 // 1896 + SYS_____CONSOLE_A = 0x769 // 1897 + SYS___CREATEWORKUNIT_A = 0x76A // 1898 + SYS___CTERMID_A = 0x76B // 1899 + SYS___FMTMSG_A = 0x76C // 1900 + SYS___INITGROUPS_A = 0x76D // 1901 + SYS_____LOGIN_A = 0x76E // 1902 + SYS___MSGRCV_A = 0x76F // 1903 + SYS___MSGSND_A = 0x770 // 1904 + SYS___MSGXRCV_A = 0x771 // 1905 + SYS___NFTW_A = 0x772 // 1906 + SYS_____PASSWD_A = 0x773 // 1907 + SYS___PTHREAD_SECURITY_NP_A = 0x774 // 1908 + SYS___QUERYMETRICS_A = 0x775 // 1909 + SYS___QUERYSCHENV = 0x776 // 1910 + SYS___READV_A = 0x777 // 1911 + SYS_____SERVER_CLASSIFY_A = 0x778 // 1912 + SYS_____SERVER_INIT_A = 0x779 // 1913 + SYS_____SERVER_PWU_A = 0x77A // 1914 + SYS___STRCASECMP_A = 0x77B // 1915 + SYS___STRNCASECMP_A = 0x77C // 1916 + SYS___TTYNAME_A = 0x77D // 1917 + SYS___UNAME_A = 0x77E // 1918 + SYS___UTIMES_A = 0x77F // 1919 + SYS___W_GETPSENT_A = 0x780 // 1920 + SYS___WRITEV_A = 0x781 // 1921 + SYS___W_STATFS_A = 0x782 // 1922 + SYS___W_STATVFS_A = 0x783 // 1923 + SYS___FPUTC_A = 0x784 // 1924 + SYS___PUTCHAR_A = 0x785 // 1925 + SYS___PUTS_A = 0x786 // 1926 + SYS___FGETS_A = 0x787 // 1927 + SYS___GETS_A = 0x788 // 1928 + SYS___FPUTS_A = 0x789 // 1929 + SYS___FREAD_A = 0x78A // 1930 + SYS___FWRITE_A = 0x78B // 1931 + SYS___OPEN_O_A = 0x78C // 1932 + SYS___ISASCII = 0x78D // 1933 + SYS___CREAT_O_A = 0x78E // 1934 + SYS___ENVNA = 0x78F // 1935 + SYS___PUTC_A = 0x790 // 1936 + SYS___AE_THREAD_SETMODE = 0x791 // 1937 + SYS___AE_THREAD_SWAPMODE = 0x792 // 1938 + SYS___GETNETBYADDR_A = 0x793 // 1939 + SYS___GETNETBYNAME_A = 0x794 // 1940 + SYS___GETNETENT_A = 0x795 // 1941 + SYS___GETPROTOBYNAME_A = 0x796 // 1942 + SYS___GETPROTOBYNUMBER_A = 0x797 // 1943 + SYS___GETPROTOENT_A = 0x798 // 1944 + SYS___GETSERVBYNAME_A = 0x799 // 1945 + SYS___GETSERVBYPORT_A = 0x79A // 1946 + SYS___GETSERVENT_A = 0x79B // 1947 + SYS___ASCTIME_A = 0x79C // 1948 + SYS___CTIME_A = 0x79D // 1949 + SYS___GETDATE_A = 0x79E // 1950 + SYS___TZSET_A = 0x79F // 1951 + SYS___UTIME_A = 0x7A0 // 1952 + SYS___ASCTIME_R_A = 0x7A1 // 1953 + SYS___CTIME_R_A = 0x7A2 // 1954 + SYS___STRTOLL_A = 0x7A3 // 1955 + SYS___STRTOULL_A = 0x7A4 // 1956 + SYS___FPUTWC_A = 0x7A5 // 1957 + SYS___PUTWC_A = 0x7A6 // 1958 + SYS___PUTWCHAR_A = 0x7A7 // 1959 + SYS___FPUTWS_A = 0x7A8 // 1960 + SYS___UNGETWC_A = 0x7A9 // 1961 + SYS___FGETWC_A = 0x7AA // 1962 + SYS___GETWC_A = 0x7AB // 1963 + SYS___GETWCHAR_A = 0x7AC // 1964 + SYS___FGETWS_A = 0x7AD // 1965 + SYS___GETTIMEOFDAY_A = 0x7AE // 1966 + SYS___GMTIME_A = 0x7AF // 1967 + SYS___GMTIME_R_A = 0x7B0 // 1968 + SYS___LOCALTIME_A = 0x7B1 // 1969 + SYS___LOCALTIME_R_A = 0x7B2 // 1970 + SYS___MKTIME_A = 0x7B3 // 1971 + SYS___TZZNA = 0x7B4 // 1972 + SYS_UNATEXIT = 0x7B5 // 1973 + SYS___CEE3DMP_A = 0x7B6 // 1974 + SYS___CDUMP_A = 0x7B7 // 1975 + SYS___CSNAP_A = 0x7B8 // 1976 + SYS___CTEST_A = 0x7B9 // 1977 + SYS___CTRACE_A = 0x7BA // 1978 + SYS___VSWPRNTF2_A = 0x7BB // 1979 + SYS___INET_PTON_A = 0x7BC // 1980 + SYS___SYSLOG_A = 0x7BD // 1981 + SYS___CRYPT_A = 0x7BE // 1982 + SYS_____OPENDIR2_A = 0x7BF // 1983 + SYS_____READDIR2_A = 0x7C0 // 1984 + SYS___OPENDIR_A = 0x7C2 // 1986 + SYS___READDIR_A = 0x7C3 // 1987 + SYS_PREAD = 0x7C7 // 1991 + SYS_PWRITE = 0x7C8 // 1992 + SYS_M_CREATE_LAYOUT = 0x7C9 // 1993 + SYS_M_DESTROY_LAYOUT = 0x7CA // 1994 + SYS_M_GETVALUES_LAYOUT = 0x7CB // 1995 + SYS_M_SETVALUES_LAYOUT = 0x7CC // 1996 + SYS_M_TRANSFORM_LAYOUT = 0x7CD // 1997 + SYS_M_WTRANSFORM_LAYOUT = 0x7CE // 1998 + SYS_FWPRINTF = 0x7D1 // 2001 + SYS_WPRINTF = 0x7D2 // 2002 + SYS_VFWPRINT = 0x7D3 // 2003 + SYS_VFWPRINTF = 0x7D3 // 2003 + SYS_VWPRINTF = 0x7D4 // 2004 + SYS_FWSCANF = 0x7D5 // 2005 + SYS_WSCANF = 0x7D6 // 2006 + SYS_WCTRANS = 0x7D7 // 2007 + SYS_TOWCTRAN = 0x7D8 // 2008 + SYS_TOWCTRANS = 0x7D8 // 2008 + SYS___WCSTOD_A = 0x7D9 // 2009 + SYS___WCSTOL_A = 0x7DA // 2010 + SYS___WCSTOUL_A = 0x7DB // 2011 + SYS___BASENAME_A = 0x7DC // 2012 + SYS___DIRNAME_A = 0x7DD // 2013 + SYS___GLOB_A = 0x7DE // 2014 + SYS_FWIDE = 0x7DF // 2015 + SYS___OSNAME = 0x7E0 // 2016 + SYS_____OSNAME_A = 0x7E1 // 2017 + SYS___BTOWC_A = 0x7E4 // 2020 + SYS___WCTOB_A = 0x7E5 // 2021 + SYS___DBM_OPEN_A = 0x7E6 // 2022 + SYS___VFPRINTF2_A = 0x7E7 // 2023 + SYS___VPRINTF2_A = 0x7E8 // 2024 + SYS___VSPRINTF2_A = 0x7E9 // 2025 + SYS___CEIL_H = 0x7EA // 2026 + SYS___FLOOR_H = 0x7EB // 2027 + SYS___MODF_H = 0x7EC // 2028 + SYS___FABS_H = 0x7ED // 2029 + SYS___J0_H = 0x7EE // 2030 + SYS___J1_H = 0x7EF // 2031 + SYS___JN_H = 0x7F0 // 2032 + SYS___Y0_H = 0x7F1 // 2033 + SYS___Y1_H = 0x7F2 // 2034 + SYS___YN_H = 0x7F3 // 2035 + SYS___CEILF_H = 0x7F4 // 2036 + SYS___CEILL_H = 0x7F5 // 2037 + SYS___FLOORF_H = 0x7F6 // 2038 + SYS___FLOORL_H = 0x7F7 // 2039 + SYS___MODFF_H = 0x7F8 // 2040 + SYS___MODFL_H = 0x7F9 // 2041 + SYS___FABSF_H = 0x7FA // 2042 + SYS___FABSL_H = 0x7FB // 2043 + SYS___MALLOC24 = 0x7FC // 2044 + SYS___MALLOC31 = 0x7FD // 2045 + SYS_ACL_INIT = 0x7FE // 2046 + SYS_ACL_FREE = 0x7FF // 2047 + SYS_ACL_FIRST_ENTRY = 0x800 // 2048 + SYS_ACL_GET_ENTRY = 0x801 // 2049 + SYS_ACL_VALID = 0x802 // 2050 + SYS_ACL_CREATE_ENTRY = 0x803 // 2051 + SYS_ACL_DELETE_ENTRY = 0x804 // 2052 + SYS_ACL_UPDATE_ENTRY = 0x805 // 2053 + SYS_ACL_DELETE_FD = 0x806 // 2054 + SYS_ACL_DELETE_FILE = 0x807 // 2055 + SYS_ACL_GET_FD = 0x808 // 2056 + SYS_ACL_GET_FILE = 0x809 // 2057 + SYS_ACL_SET_FD = 0x80A // 2058 + SYS_ACL_SET_FILE = 0x80B // 2059 + SYS_ACL_FROM_TEXT = 0x80C // 2060 + SYS_ACL_TO_TEXT = 0x80D // 2061 + SYS_ACL_SORT = 0x80E // 2062 + SYS___SHUTDOWN_REGISTRATION = 0x80F // 2063 + SYS___ERFL_B = 0x810 // 2064 + SYS___ERFCL_B = 0x811 // 2065 + SYS___LGAMMAL_B = 0x812 // 2066 + SYS___SETHOOKEVENTS = 0x813 // 2067 + SYS_IF_NAMETOINDEX = 0x814 // 2068 + SYS_IF_INDEXTONAME = 0x815 // 2069 + SYS_IF_NAMEINDEX = 0x816 // 2070 + SYS_IF_FREENAMEINDEX = 0x817 // 2071 + SYS_GETADDRINFO = 0x818 // 2072 + SYS_GETNAMEINFO = 0x819 // 2073 + SYS_FREEADDRINFO = 0x81A // 2074 + SYS_GAI_STRERROR = 0x81B // 2075 + SYS_REXEC_AF = 0x81C // 2076 + SYS___POE = 0x81D // 2077 + SYS___DYNALLOC_A = 0x81F // 2079 + SYS___DYNFREE_A = 0x820 // 2080 + SYS___RES_QUERY_A = 0x821 // 2081 + SYS___RES_SEARCH_A = 0x822 // 2082 + SYS___RES_QUERYDOMAIN_A = 0x823 // 2083 + SYS___RES_MKQUERY_A = 0x824 // 2084 + SYS___RES_SEND_A = 0x825 // 2085 + SYS___DN_EXPAND_A = 0x826 // 2086 + SYS___DN_SKIPNAME_A = 0x827 // 2087 + SYS___DN_COMP_A = 0x828 // 2088 + SYS___DN_FIND_A = 0x829 // 2089 + SYS___NLIST_A = 0x82A // 2090 + SYS_____TCGETCP_A = 0x82B // 2091 + SYS_____TCSETCP_A = 0x82C // 2092 + SYS_____W_PIOCTL_A = 0x82E // 2094 + SYS___INET_ADDR_A = 0x82F // 2095 + SYS___INET_NTOA_A = 0x830 // 2096 + SYS___INET_NETWORK_A = 0x831 // 2097 + SYS___ACCEPT_A = 0x832 // 2098 + SYS___ACCEPT_AND_RECV_A = 0x833 // 2099 + SYS___BIND_A = 0x834 // 2100 + SYS___CONNECT_A = 0x835 // 2101 + SYS___GETPEERNAME_A = 0x836 // 2102 + SYS___GETSOCKNAME_A = 0x837 // 2103 + SYS___RECVFROM_A = 0x838 // 2104 + SYS___SENDTO_A = 0x839 // 2105 + SYS___SENDMSG_A = 0x83A // 2106 + SYS___RECVMSG_A = 0x83B // 2107 + SYS_____LCHATTR_A = 0x83C // 2108 + SYS___CABEND = 0x83D // 2109 + SYS___LE_CIB_GET = 0x83E // 2110 + SYS___SET_LAA_FOR_JIT = 0x83F // 2111 + SYS___LCHATTR = 0x840 // 2112 + SYS___WRITEDOWN = 0x841 // 2113 + SYS_PTHREAD_MUTEX_INIT2 = 0x842 // 2114 + SYS___ACOSHF_B = 0x843 // 2115 + SYS___ACOSHL_B = 0x844 // 2116 + SYS___ASINHF_B = 0x845 // 2117 + SYS___ASINHL_B = 0x846 // 2118 + SYS___ATANHF_B = 0x847 // 2119 + SYS___ATANHL_B = 0x848 // 2120 + SYS___CBRTF_B = 0x849 // 2121 + SYS___CBRTL_B = 0x84A // 2122 + SYS___COPYSIGNF_B = 0x84B // 2123 + SYS___COPYSIGNL_B = 0x84C // 2124 + SYS___COTANF_B = 0x84D // 2125 + SYS___COTAN_B = 0x84E // 2126 + SYS___COTANL_B = 0x84F // 2127 + SYS___EXP2F_B = 0x850 // 2128 + SYS___EXP2L_B = 0x851 // 2129 + SYS___EXPM1F_B = 0x852 // 2130 + SYS___EXPM1L_B = 0x853 // 2131 + SYS___FDIMF_B = 0x854 // 2132 + SYS___FDIM_B = 0x855 // 2133 + SYS___FDIML_B = 0x856 // 2134 + SYS___HYPOTF_B = 0x857 // 2135 + SYS___HYPOTL_B = 0x858 // 2136 + SYS___LOG1PF_B = 0x859 // 2137 + SYS___LOG1PL_B = 0x85A // 2138 + SYS___LOG2F_B = 0x85B // 2139 + SYS___LOG2_B = 0x85C // 2140 + SYS___LOG2L_B = 0x85D // 2141 + SYS___REMAINDERF_B = 0x85E // 2142 + SYS___REMAINDERL_B = 0x85F // 2143 + SYS___REMQUOF_B = 0x860 // 2144 + SYS___REMQUO_B = 0x861 // 2145 + SYS___REMQUOL_B = 0x862 // 2146 + SYS___TGAMMAF_B = 0x863 // 2147 + SYS___TGAMMA_B = 0x864 // 2148 + SYS___TGAMMAL_B = 0x865 // 2149 + SYS___TRUNCF_B = 0x866 // 2150 + SYS___TRUNC_B = 0x867 // 2151 + SYS___TRUNCL_B = 0x868 // 2152 + SYS___LGAMMAF_B = 0x869 // 2153 + SYS___LROUNDF_B = 0x86A // 2154 + SYS___LROUND_B = 0x86B // 2155 + SYS___ERFF_B = 0x86C // 2156 + SYS___ERFCF_B = 0x86D // 2157 + SYS_ACOSHF = 0x86E // 2158 + SYS_ACOSHL = 0x86F // 2159 + SYS_ASINHF = 0x870 // 2160 + SYS_ASINHL = 0x871 // 2161 + SYS_ATANHF = 0x872 // 2162 + SYS_ATANHL = 0x873 // 2163 + SYS_CBRTF = 0x874 // 2164 + SYS_CBRTL = 0x875 // 2165 + SYS_COPYSIGNF = 0x876 // 2166 + SYS_CPYSIGNF = 0x876 // 2166 + SYS_COPYSIGNL = 0x877 // 2167 + SYS_CPYSIGNL = 0x877 // 2167 + SYS_COTANF = 0x878 // 2168 + SYS___COTANF = 0x878 // 2168 + SYS_COTAN = 0x879 // 2169 + SYS___COTAN = 0x879 // 2169 + SYS_COTANL = 0x87A // 2170 + SYS___COTANL = 0x87A // 2170 + SYS_EXP2F = 0x87B // 2171 + SYS_EXP2L = 0x87C // 2172 + SYS_EXPM1F = 0x87D // 2173 + SYS_EXPM1L = 0x87E // 2174 + SYS_FDIMF = 0x87F // 2175 + SYS_FDIM = 0x881 // 2177 + SYS_FDIML = 0x882 // 2178 + SYS_HYPOTF = 0x883 // 2179 + SYS_HYPOTL = 0x884 // 2180 + SYS_LOG1PF = 0x885 // 2181 + SYS_LOG1PL = 0x886 // 2182 + SYS_LOG2F = 0x887 // 2183 + SYS_LOG2 = 0x888 // 2184 + SYS_LOG2L = 0x889 // 2185 + SYS_REMAINDERF = 0x88A // 2186 + SYS_REMAINDF = 0x88A // 2186 + SYS_REMAINDERL = 0x88B // 2187 + SYS_REMAINDL = 0x88B // 2187 + SYS_REMQUOF = 0x88C // 2188 + SYS_REMQUO = 0x88D // 2189 + SYS_REMQUOL = 0x88E // 2190 + SYS_TGAMMAF = 0x88F // 2191 + SYS_TGAMMA = 0x890 // 2192 + SYS_TGAMMAL = 0x891 // 2193 + SYS_TRUNCF = 0x892 // 2194 + SYS_TRUNC = 0x893 // 2195 + SYS_TRUNCL = 0x894 // 2196 + SYS_LGAMMAF = 0x895 // 2197 + SYS_LGAMMAL = 0x896 // 2198 + SYS_LROUNDF = 0x897 // 2199 + SYS_LROUND = 0x898 // 2200 + SYS_ERFF = 0x899 // 2201 + SYS_ERFL = 0x89A // 2202 + SYS_ERFCF = 0x89B // 2203 + SYS_ERFCL = 0x89C // 2204 + SYS___EXP2_B = 0x89D // 2205 + SYS_EXP2 = 0x89E // 2206 + SYS___FAR_JUMP = 0x89F // 2207 + SYS___TCGETATTR_A = 0x8A1 // 2209 + SYS___TCSETATTR_A = 0x8A2 // 2210 + SYS___SUPERKILL = 0x8A4 // 2212 + SYS___LE_CONDITION_TOKEN_BUILD = 0x8A5 // 2213 + SYS___LE_MSG_ADD_INSERT = 0x8A6 // 2214 + SYS___LE_MSG_GET = 0x8A7 // 2215 + SYS___LE_MSG_GET_AND_WRITE = 0x8A8 // 2216 + SYS___LE_MSG_WRITE = 0x8A9 // 2217 + SYS___ITOA = 0x8AA // 2218 + SYS___UTOA = 0x8AB // 2219 + SYS___LTOA = 0x8AC // 2220 + SYS___ULTOA = 0x8AD // 2221 + SYS___LLTOA = 0x8AE // 2222 + SYS___ULLTOA = 0x8AF // 2223 + SYS___ITOA_A = 0x8B0 // 2224 + SYS___UTOA_A = 0x8B1 // 2225 + SYS___LTOA_A = 0x8B2 // 2226 + SYS___ULTOA_A = 0x8B3 // 2227 + SYS___LLTOA_A = 0x8B4 // 2228 + SYS___ULLTOA_A = 0x8B5 // 2229 + SYS_____GETENV_A = 0x8C3 // 2243 + SYS___REXEC_A = 0x8C4 // 2244 + SYS___REXEC_AF_A = 0x8C5 // 2245 + SYS___GETUTXENT_A = 0x8C6 // 2246 + SYS___GETUTXID_A = 0x8C7 // 2247 + SYS___GETUTXLINE_A = 0x8C8 // 2248 + SYS___PUTUTXLINE_A = 0x8C9 // 2249 + SYS_____UTMPXNAME_A = 0x8CA // 2250 + SYS___PUTC_UNLOCKED_A = 0x8CB // 2251 + SYS___PUTCHAR_UNLOCKED_A = 0x8CC // 2252 + SYS___SNPRINTF_A = 0x8CD // 2253 + SYS___VSNPRINTF_A = 0x8CE // 2254 + SYS___DLOPEN_A = 0x8D0 // 2256 + SYS___DLSYM_A = 0x8D1 // 2257 + SYS___DLERROR_A = 0x8D2 // 2258 + SYS_FLOCKFILE = 0x8D3 // 2259 + SYS_FTRYLOCKFILE = 0x8D4 // 2260 + SYS_FUNLOCKFILE = 0x8D5 // 2261 + SYS_GETC_UNLOCKED = 0x8D6 // 2262 + SYS_GETCHAR_UNLOCKED = 0x8D7 // 2263 + SYS_PUTC_UNLOCKED = 0x8D8 // 2264 + SYS_PUTCHAR_UNLOCKED = 0x8D9 // 2265 + SYS_SNPRINTF = 0x8DA // 2266 + SYS_VSNPRINTF = 0x8DB // 2267 + SYS_DLOPEN = 0x8DD // 2269 + SYS_DLSYM = 0x8DE // 2270 + SYS_DLCLOSE = 0x8DF // 2271 + SYS_DLERROR = 0x8E0 // 2272 + SYS___SET_EXCEPTION_HANDLER = 0x8E2 // 2274 + SYS___RESET_EXCEPTION_HANDLER = 0x8E3 // 2275 + SYS___VHM_EVENT = 0x8E4 // 2276 + SYS___ABS_H = 0x8E6 // 2278 + SYS___ABSF_H = 0x8E7 // 2279 + SYS___ABSL_H = 0x8E8 // 2280 + SYS___ACOS_H = 0x8E9 // 2281 + SYS___ACOSF_H = 0x8EA // 2282 + SYS___ACOSL_H = 0x8EB // 2283 + SYS___ACOSH_H = 0x8EC // 2284 + SYS___ASIN_H = 0x8ED // 2285 + SYS___ASINF_H = 0x8EE // 2286 + SYS___ASINL_H = 0x8EF // 2287 + SYS___ASINH_H = 0x8F0 // 2288 + SYS___ATAN_H = 0x8F1 // 2289 + SYS___ATANF_H = 0x8F2 // 2290 + SYS___ATANL_H = 0x8F3 // 2291 + SYS___ATANH_H = 0x8F4 // 2292 + SYS___ATANHF_H = 0x8F5 // 2293 + SYS___ATANHL_H = 0x8F6 // 2294 + SYS___ATAN2_H = 0x8F7 // 2295 + SYS___ATAN2F_H = 0x8F8 // 2296 + SYS___ATAN2L_H = 0x8F9 // 2297 + SYS___CBRT_H = 0x8FA // 2298 + SYS___COPYSIGNF_H = 0x8FB // 2299 + SYS___COPYSIGNL_H = 0x8FC // 2300 + SYS___COS_H = 0x8FD // 2301 + SYS___COSF_H = 0x8FE // 2302 + SYS___COSL_H = 0x8FF // 2303 + SYS___COSHF_H = 0x900 // 2304 + SYS___COSHL_H = 0x901 // 2305 + SYS___COTAN_H = 0x902 // 2306 + SYS___COTANF_H = 0x903 // 2307 + SYS___COTANL_H = 0x904 // 2308 + SYS___ERF_H = 0x905 // 2309 + SYS___ERFF_H = 0x906 // 2310 + SYS___ERFL_H = 0x907 // 2311 + SYS___ERFC_H = 0x908 // 2312 + SYS___ERFCF_H = 0x909 // 2313 + SYS___ERFCL_H = 0x90A // 2314 + SYS___EXP_H = 0x90B // 2315 + SYS___EXPF_H = 0x90C // 2316 + SYS___EXPL_H = 0x90D // 2317 + SYS___EXPM1_H = 0x90E // 2318 + SYS___FDIM_H = 0x90F // 2319 + SYS___FDIMF_H = 0x910 // 2320 + SYS___FDIML_H = 0x911 // 2321 + SYS___FMOD_H = 0x912 // 2322 + SYS___FMODF_H = 0x913 // 2323 + SYS___FMODL_H = 0x914 // 2324 + SYS___GAMMA_H = 0x915 // 2325 + SYS___HYPOT_H = 0x916 // 2326 + SYS___ILOGB_H = 0x917 // 2327 + SYS___LGAMMA_H = 0x918 // 2328 + SYS___LGAMMAF_H = 0x919 // 2329 + SYS___LOG_H = 0x91A // 2330 + SYS___LOGF_H = 0x91B // 2331 + SYS___LOGL_H = 0x91C // 2332 + SYS___LOGB_H = 0x91D // 2333 + SYS___LOG2_H = 0x91E // 2334 + SYS___LOG2F_H = 0x91F // 2335 + SYS___LOG2L_H = 0x920 // 2336 + SYS___LOG1P_H = 0x921 // 2337 + SYS___LOG10_H = 0x922 // 2338 + SYS___LOG10F_H = 0x923 // 2339 + SYS___LOG10L_H = 0x924 // 2340 + SYS___LROUND_H = 0x925 // 2341 + SYS___LROUNDF_H = 0x926 // 2342 + SYS___NEXTAFTER_H = 0x927 // 2343 + SYS___POW_H = 0x928 // 2344 + SYS___POWF_H = 0x929 // 2345 + SYS___POWL_H = 0x92A // 2346 + SYS___REMAINDER_H = 0x92B // 2347 + SYS___RINT_H = 0x92C // 2348 + SYS___SCALB_H = 0x92D // 2349 + SYS___SIN_H = 0x92E // 2350 + SYS___SINF_H = 0x92F // 2351 + SYS___SINL_H = 0x930 // 2352 + SYS___SINH_H = 0x931 // 2353 + SYS___SINHF_H = 0x932 // 2354 + SYS___SINHL_H = 0x933 // 2355 + SYS___SQRT_H = 0x934 // 2356 + SYS___SQRTF_H = 0x935 // 2357 + SYS___SQRTL_H = 0x936 // 2358 + SYS___TAN_H = 0x937 // 2359 + SYS___TANF_H = 0x938 // 2360 + SYS___TANL_H = 0x939 // 2361 + SYS___TANH_H = 0x93A // 2362 + SYS___TANHF_H = 0x93B // 2363 + SYS___TANHL_H = 0x93C // 2364 + SYS___TGAMMA_H = 0x93D // 2365 + SYS___TGAMMAF_H = 0x93E // 2366 + SYS___TRUNC_H = 0x93F // 2367 + SYS___TRUNCF_H = 0x940 // 2368 + SYS___TRUNCL_H = 0x941 // 2369 + SYS___COSH_H = 0x942 // 2370 + SYS___LE_DEBUG_SET_RESUME_MCH = 0x943 // 2371 + SYS_VFSCANF = 0x944 // 2372 + SYS_VSCANF = 0x946 // 2374 + SYS_VSSCANF = 0x948 // 2376 + SYS_VFWSCANF = 0x94A // 2378 + SYS_VWSCANF = 0x94C // 2380 + SYS_VSWSCANF = 0x94E // 2382 + SYS_IMAXABS = 0x950 // 2384 + SYS_IMAXDIV = 0x951 // 2385 + SYS_STRTOIMAX = 0x952 // 2386 + SYS_STRTOUMAX = 0x953 // 2387 + SYS_WCSTOIMAX = 0x954 // 2388 + SYS_WCSTOUMAX = 0x955 // 2389 + SYS_ATOLL = 0x956 // 2390 + SYS_STRTOF = 0x957 // 2391 + SYS_STRTOLD = 0x958 // 2392 + SYS_WCSTOF = 0x959 // 2393 + SYS_WCSTOLD = 0x95A // 2394 + SYS_INET6_RTH_SPACE = 0x95B // 2395 + SYS_INET6_RTH_INIT = 0x95C // 2396 + SYS_INET6_RTH_ADD = 0x95D // 2397 + SYS_INET6_RTH_REVERSE = 0x95E // 2398 + SYS_INET6_RTH_SEGMENTS = 0x95F // 2399 + SYS_INET6_RTH_GETADDR = 0x960 // 2400 + SYS_INET6_OPT_INIT = 0x961 // 2401 + SYS_INET6_OPT_APPEND = 0x962 // 2402 + SYS_INET6_OPT_FINISH = 0x963 // 2403 + SYS_INET6_OPT_SET_VAL = 0x964 // 2404 + SYS_INET6_OPT_NEXT = 0x965 // 2405 + SYS_INET6_OPT_FIND = 0x966 // 2406 + SYS_INET6_OPT_GET_VAL = 0x967 // 2407 + SYS___POW_I = 0x987 // 2439 + SYS___POW_I_B = 0x988 // 2440 + SYS___POW_I_H = 0x989 // 2441 + SYS___POW_II = 0x98A // 2442 + SYS___POW_II_B = 0x98B // 2443 + SYS___POW_II_H = 0x98C // 2444 + SYS_CABS = 0x98E // 2446 + SYS___CABS_B = 0x98F // 2447 + SYS___CABS_H = 0x990 // 2448 + SYS_CABSF = 0x991 // 2449 + SYS___CABSF_B = 0x992 // 2450 + SYS___CABSF_H = 0x993 // 2451 + SYS_CABSL = 0x994 // 2452 + SYS___CABSL_B = 0x995 // 2453 + SYS___CABSL_H = 0x996 // 2454 + SYS_CACOS = 0x997 // 2455 + SYS___CACOS_B = 0x998 // 2456 + SYS___CACOS_H = 0x999 // 2457 + SYS_CACOSF = 0x99A // 2458 + SYS___CACOSF_B = 0x99B // 2459 + SYS___CACOSF_H = 0x99C // 2460 + SYS_CACOSL = 0x99D // 2461 + SYS___CACOSL_B = 0x99E // 2462 + SYS___CACOSL_H = 0x99F // 2463 + SYS_CACOSH = 0x9A0 // 2464 + SYS___CACOSH_B = 0x9A1 // 2465 + SYS___CACOSH_H = 0x9A2 // 2466 + SYS_CACOSHF = 0x9A3 // 2467 + SYS___CACOSHF_B = 0x9A4 // 2468 + SYS___CACOSHF_H = 0x9A5 // 2469 + SYS_CACOSHL = 0x9A6 // 2470 + SYS___CACOSHL_B = 0x9A7 // 2471 + SYS___CACOSHL_H = 0x9A8 // 2472 + SYS_CARG = 0x9A9 // 2473 + SYS___CARG_B = 0x9AA // 2474 + SYS___CARG_H = 0x9AB // 2475 + SYS_CARGF = 0x9AC // 2476 + SYS___CARGF_B = 0x9AD // 2477 + SYS___CARGF_H = 0x9AE // 2478 + SYS_CARGL = 0x9AF // 2479 + SYS___CARGL_B = 0x9B0 // 2480 + SYS___CARGL_H = 0x9B1 // 2481 + SYS_CASIN = 0x9B2 // 2482 + SYS___CASIN_B = 0x9B3 // 2483 + SYS___CASIN_H = 0x9B4 // 2484 + SYS_CASINF = 0x9B5 // 2485 + SYS___CASINF_B = 0x9B6 // 2486 + SYS___CASINF_H = 0x9B7 // 2487 + SYS_CASINL = 0x9B8 // 2488 + SYS___CASINL_B = 0x9B9 // 2489 + SYS___CASINL_H = 0x9BA // 2490 + SYS_CASINH = 0x9BB // 2491 + SYS___CASINH_B = 0x9BC // 2492 + SYS___CASINH_H = 0x9BD // 2493 + SYS_CASINHF = 0x9BE // 2494 + SYS___CASINHF_B = 0x9BF // 2495 + SYS___CASINHF_H = 0x9C0 // 2496 + SYS_CASINHL = 0x9C1 // 2497 + SYS___CASINHL_B = 0x9C2 // 2498 + SYS___CASINHL_H = 0x9C3 // 2499 + SYS_CATAN = 0x9C4 // 2500 + SYS___CATAN_B = 0x9C5 // 2501 + SYS___CATAN_H = 0x9C6 // 2502 + SYS_CATANF = 0x9C7 // 2503 + SYS___CATANF_B = 0x9C8 // 2504 + SYS___CATANF_H = 0x9C9 // 2505 + SYS_CATANL = 0x9CA // 2506 + SYS___CATANL_B = 0x9CB // 2507 + SYS___CATANL_H = 0x9CC // 2508 + SYS_CATANH = 0x9CD // 2509 + SYS___CATANH_B = 0x9CE // 2510 + SYS___CATANH_H = 0x9CF // 2511 + SYS_CATANHF = 0x9D0 // 2512 + SYS___CATANHF_B = 0x9D1 // 2513 + SYS___CATANHF_H = 0x9D2 // 2514 + SYS_CATANHL = 0x9D3 // 2515 + SYS___CATANHL_B = 0x9D4 // 2516 + SYS___CATANHL_H = 0x9D5 // 2517 + SYS_CCOS = 0x9D6 // 2518 + SYS___CCOS_B = 0x9D7 // 2519 + SYS___CCOS_H = 0x9D8 // 2520 + SYS_CCOSF = 0x9D9 // 2521 + SYS___CCOSF_B = 0x9DA // 2522 + SYS___CCOSF_H = 0x9DB // 2523 + SYS_CCOSL = 0x9DC // 2524 + SYS___CCOSL_B = 0x9DD // 2525 + SYS___CCOSL_H = 0x9DE // 2526 + SYS_CCOSH = 0x9DF // 2527 + SYS___CCOSH_B = 0x9E0 // 2528 + SYS___CCOSH_H = 0x9E1 // 2529 + SYS_CCOSHF = 0x9E2 // 2530 + SYS___CCOSHF_B = 0x9E3 // 2531 + SYS___CCOSHF_H = 0x9E4 // 2532 + SYS_CCOSHL = 0x9E5 // 2533 + SYS___CCOSHL_B = 0x9E6 // 2534 + SYS___CCOSHL_H = 0x9E7 // 2535 + SYS_CEXP = 0x9E8 // 2536 + SYS___CEXP_B = 0x9E9 // 2537 + SYS___CEXP_H = 0x9EA // 2538 + SYS_CEXPF = 0x9EB // 2539 + SYS___CEXPF_B = 0x9EC // 2540 + SYS___CEXPF_H = 0x9ED // 2541 + SYS_CEXPL = 0x9EE // 2542 + SYS___CEXPL_B = 0x9EF // 2543 + SYS___CEXPL_H = 0x9F0 // 2544 + SYS_CIMAG = 0x9F1 // 2545 + SYS___CIMAG_B = 0x9F2 // 2546 + SYS___CIMAG_H = 0x9F3 // 2547 + SYS_CIMAGF = 0x9F4 // 2548 + SYS___CIMAGF_B = 0x9F5 // 2549 + SYS___CIMAGF_H = 0x9F6 // 2550 + SYS_CIMAGL = 0x9F7 // 2551 + SYS___CIMAGL_B = 0x9F8 // 2552 + SYS___CIMAGL_H = 0x9F9 // 2553 + SYS___CLOG = 0x9FA // 2554 + SYS___CLOG_B = 0x9FB // 2555 + SYS___CLOG_H = 0x9FC // 2556 + SYS_CLOGF = 0x9FD // 2557 + SYS___CLOGF_B = 0x9FE // 2558 + SYS___CLOGF_H = 0x9FF // 2559 + SYS_CLOGL = 0xA00 // 2560 + SYS___CLOGL_B = 0xA01 // 2561 + SYS___CLOGL_H = 0xA02 // 2562 + SYS_CONJ = 0xA03 // 2563 + SYS___CONJ_B = 0xA04 // 2564 + SYS___CONJ_H = 0xA05 // 2565 + SYS_CONJF = 0xA06 // 2566 + SYS___CONJF_B = 0xA07 // 2567 + SYS___CONJF_H = 0xA08 // 2568 + SYS_CONJL = 0xA09 // 2569 + SYS___CONJL_B = 0xA0A // 2570 + SYS___CONJL_H = 0xA0B // 2571 + SYS_CPOW = 0xA0C // 2572 + SYS___CPOW_B = 0xA0D // 2573 + SYS___CPOW_H = 0xA0E // 2574 + SYS_CPOWF = 0xA0F // 2575 + SYS___CPOWF_B = 0xA10 // 2576 + SYS___CPOWF_H = 0xA11 // 2577 + SYS_CPOWL = 0xA12 // 2578 + SYS___CPOWL_B = 0xA13 // 2579 + SYS___CPOWL_H = 0xA14 // 2580 + SYS_CPROJ = 0xA15 // 2581 + SYS___CPROJ_B = 0xA16 // 2582 + SYS___CPROJ_H = 0xA17 // 2583 + SYS_CPROJF = 0xA18 // 2584 + SYS___CPROJF_B = 0xA19 // 2585 + SYS___CPROJF_H = 0xA1A // 2586 + SYS_CPROJL = 0xA1B // 2587 + SYS___CPROJL_B = 0xA1C // 2588 + SYS___CPROJL_H = 0xA1D // 2589 + SYS_CREAL = 0xA1E // 2590 + SYS___CREAL_B = 0xA1F // 2591 + SYS___CREAL_H = 0xA20 // 2592 + SYS_CREALF = 0xA21 // 2593 + SYS___CREALF_B = 0xA22 // 2594 + SYS___CREALF_H = 0xA23 // 2595 + SYS_CREALL = 0xA24 // 2596 + SYS___CREALL_B = 0xA25 // 2597 + SYS___CREALL_H = 0xA26 // 2598 + SYS_CSIN = 0xA27 // 2599 + SYS___CSIN_B = 0xA28 // 2600 + SYS___CSIN_H = 0xA29 // 2601 + SYS_CSINF = 0xA2A // 2602 + SYS___CSINF_B = 0xA2B // 2603 + SYS___CSINF_H = 0xA2C // 2604 + SYS_CSINL = 0xA2D // 2605 + SYS___CSINL_B = 0xA2E // 2606 + SYS___CSINL_H = 0xA2F // 2607 + SYS_CSINH = 0xA30 // 2608 + SYS___CSINH_B = 0xA31 // 2609 + SYS___CSINH_H = 0xA32 // 2610 + SYS_CSINHF = 0xA33 // 2611 + SYS___CSINHF_B = 0xA34 // 2612 + SYS___CSINHF_H = 0xA35 // 2613 + SYS_CSINHL = 0xA36 // 2614 + SYS___CSINHL_B = 0xA37 // 2615 + SYS___CSINHL_H = 0xA38 // 2616 + SYS_CSQRT = 0xA39 // 2617 + SYS___CSQRT_B = 0xA3A // 2618 + SYS___CSQRT_H = 0xA3B // 2619 + SYS_CSQRTF = 0xA3C // 2620 + SYS___CSQRTF_B = 0xA3D // 2621 + SYS___CSQRTF_H = 0xA3E // 2622 + SYS_CSQRTL = 0xA3F // 2623 + SYS___CSQRTL_B = 0xA40 // 2624 + SYS___CSQRTL_H = 0xA41 // 2625 + SYS_CTAN = 0xA42 // 2626 + SYS___CTAN_B = 0xA43 // 2627 + SYS___CTAN_H = 0xA44 // 2628 + SYS_CTANF = 0xA45 // 2629 + SYS___CTANF_B = 0xA46 // 2630 + SYS___CTANF_H = 0xA47 // 2631 + SYS_CTANL = 0xA48 // 2632 + SYS___CTANL_B = 0xA49 // 2633 + SYS___CTANL_H = 0xA4A // 2634 + SYS_CTANH = 0xA4B // 2635 + SYS___CTANH_B = 0xA4C // 2636 + SYS___CTANH_H = 0xA4D // 2637 + SYS_CTANHF = 0xA4E // 2638 + SYS___CTANHF_B = 0xA4F // 2639 + SYS___CTANHF_H = 0xA50 // 2640 + SYS_CTANHL = 0xA51 // 2641 + SYS___CTANHL_B = 0xA52 // 2642 + SYS___CTANHL_H = 0xA53 // 2643 + SYS___ACOSHF_H = 0xA54 // 2644 + SYS___ACOSHL_H = 0xA55 // 2645 + SYS___ASINHF_H = 0xA56 // 2646 + SYS___ASINHL_H = 0xA57 // 2647 + SYS___CBRTF_H = 0xA58 // 2648 + SYS___CBRTL_H = 0xA59 // 2649 + SYS___COPYSIGN_B = 0xA5A // 2650 + SYS___EXPM1F_H = 0xA5B // 2651 + SYS___EXPM1L_H = 0xA5C // 2652 + SYS___EXP2_H = 0xA5D // 2653 + SYS___EXP2F_H = 0xA5E // 2654 + SYS___EXP2L_H = 0xA5F // 2655 + SYS___LOG1PF_H = 0xA60 // 2656 + SYS___LOG1PL_H = 0xA61 // 2657 + SYS___LGAMMAL_H = 0xA62 // 2658 + SYS_FMA = 0xA63 // 2659 + SYS___FMA_B = 0xA64 // 2660 + SYS___FMA_H = 0xA65 // 2661 + SYS_FMAF = 0xA66 // 2662 + SYS___FMAF_B = 0xA67 // 2663 + SYS___FMAF_H = 0xA68 // 2664 + SYS_FMAL = 0xA69 // 2665 + SYS___FMAL_B = 0xA6A // 2666 + SYS___FMAL_H = 0xA6B // 2667 + SYS_FMAX = 0xA6C // 2668 + SYS___FMAX_B = 0xA6D // 2669 + SYS___FMAX_H = 0xA6E // 2670 + SYS_FMAXF = 0xA6F // 2671 + SYS___FMAXF_B = 0xA70 // 2672 + SYS___FMAXF_H = 0xA71 // 2673 + SYS_FMAXL = 0xA72 // 2674 + SYS___FMAXL_B = 0xA73 // 2675 + SYS___FMAXL_H = 0xA74 // 2676 + SYS_FMIN = 0xA75 // 2677 + SYS___FMIN_B = 0xA76 // 2678 + SYS___FMIN_H = 0xA77 // 2679 + SYS_FMINF = 0xA78 // 2680 + SYS___FMINF_B = 0xA79 // 2681 + SYS___FMINF_H = 0xA7A // 2682 + SYS_FMINL = 0xA7B // 2683 + SYS___FMINL_B = 0xA7C // 2684 + SYS___FMINL_H = 0xA7D // 2685 + SYS_ILOGBF = 0xA7E // 2686 + SYS___ILOGBF_B = 0xA7F // 2687 + SYS___ILOGBF_H = 0xA80 // 2688 + SYS_ILOGBL = 0xA81 // 2689 + SYS___ILOGBL_B = 0xA82 // 2690 + SYS___ILOGBL_H = 0xA83 // 2691 + SYS_LLRINT = 0xA84 // 2692 + SYS___LLRINT_B = 0xA85 // 2693 + SYS___LLRINT_H = 0xA86 // 2694 + SYS_LLRINTF = 0xA87 // 2695 + SYS___LLRINTF_B = 0xA88 // 2696 + SYS___LLRINTF_H = 0xA89 // 2697 + SYS_LLRINTL = 0xA8A // 2698 + SYS___LLRINTL_B = 0xA8B // 2699 + SYS___LLRINTL_H = 0xA8C // 2700 + SYS_LLROUND = 0xA8D // 2701 + SYS___LLROUND_B = 0xA8E // 2702 + SYS___LLROUND_H = 0xA8F // 2703 + SYS_LLROUNDF = 0xA90 // 2704 + SYS___LLROUNDF_B = 0xA91 // 2705 + SYS___LLROUNDF_H = 0xA92 // 2706 + SYS_LLROUNDL = 0xA93 // 2707 + SYS___LLROUNDL_B = 0xA94 // 2708 + SYS___LLROUNDL_H = 0xA95 // 2709 + SYS_LOGBF = 0xA96 // 2710 + SYS___LOGBF_B = 0xA97 // 2711 + SYS___LOGBF_H = 0xA98 // 2712 + SYS_LOGBL = 0xA99 // 2713 + SYS___LOGBL_B = 0xA9A // 2714 + SYS___LOGBL_H = 0xA9B // 2715 + SYS_LRINT = 0xA9C // 2716 + SYS___LRINT_B = 0xA9D // 2717 + SYS___LRINT_H = 0xA9E // 2718 + SYS_LRINTF = 0xA9F // 2719 + SYS___LRINTF_B = 0xAA0 // 2720 + SYS___LRINTF_H = 0xAA1 // 2721 + SYS_LRINTL = 0xAA2 // 2722 + SYS___LRINTL_B = 0xAA3 // 2723 + SYS___LRINTL_H = 0xAA4 // 2724 + SYS_LROUNDL = 0xAA5 // 2725 + SYS___LROUNDL_B = 0xAA6 // 2726 + SYS___LROUNDL_H = 0xAA7 // 2727 + SYS_NAN = 0xAA8 // 2728 + SYS___NAN_B = 0xAA9 // 2729 + SYS_NANF = 0xAAA // 2730 + SYS___NANF_B = 0xAAB // 2731 + SYS_NANL = 0xAAC // 2732 + SYS___NANL_B = 0xAAD // 2733 + SYS_NEARBYINT = 0xAAE // 2734 + SYS___NEARBYINT_B = 0xAAF // 2735 + SYS___NEARBYINT_H = 0xAB0 // 2736 + SYS_NEARBYINTF = 0xAB1 // 2737 + SYS___NEARBYINTF_B = 0xAB2 // 2738 + SYS___NEARBYINTF_H = 0xAB3 // 2739 + SYS_NEARBYINTL = 0xAB4 // 2740 + SYS___NEARBYINTL_B = 0xAB5 // 2741 + SYS___NEARBYINTL_H = 0xAB6 // 2742 + SYS_NEXTAFTERF = 0xAB7 // 2743 + SYS___NEXTAFTERF_B = 0xAB8 // 2744 + SYS___NEXTAFTERF_H = 0xAB9 // 2745 + SYS_NEXTAFTERL = 0xABA // 2746 + SYS___NEXTAFTERL_B = 0xABB // 2747 + SYS___NEXTAFTERL_H = 0xABC // 2748 + SYS_NEXTTOWARD = 0xABD // 2749 + SYS___NEXTTOWARD_B = 0xABE // 2750 + SYS___NEXTTOWARD_H = 0xABF // 2751 + SYS_NEXTTOWARDF = 0xAC0 // 2752 + SYS___NEXTTOWARDF_B = 0xAC1 // 2753 + SYS___NEXTTOWARDF_H = 0xAC2 // 2754 + SYS_NEXTTOWARDL = 0xAC3 // 2755 + SYS___NEXTTOWARDL_B = 0xAC4 // 2756 + SYS___NEXTTOWARDL_H = 0xAC5 // 2757 + SYS___REMAINDERF_H = 0xAC6 // 2758 + SYS___REMAINDERL_H = 0xAC7 // 2759 + SYS___REMQUO_H = 0xAC8 // 2760 + SYS___REMQUOF_H = 0xAC9 // 2761 + SYS___REMQUOL_H = 0xACA // 2762 + SYS_RINTF = 0xACB // 2763 + SYS___RINTF_B = 0xACC // 2764 + SYS_RINTL = 0xACD // 2765 + SYS___RINTL_B = 0xACE // 2766 + SYS_ROUND = 0xACF // 2767 + SYS___ROUND_B = 0xAD0 // 2768 + SYS___ROUND_H = 0xAD1 // 2769 + SYS_ROUNDF = 0xAD2 // 2770 + SYS___ROUNDF_B = 0xAD3 // 2771 + SYS___ROUNDF_H = 0xAD4 // 2772 + SYS_ROUNDL = 0xAD5 // 2773 + SYS___ROUNDL_B = 0xAD6 // 2774 + SYS___ROUNDL_H = 0xAD7 // 2775 + SYS_SCALBLN = 0xAD8 // 2776 + SYS___SCALBLN_B = 0xAD9 // 2777 + SYS___SCALBLN_H = 0xADA // 2778 + SYS_SCALBLNF = 0xADB // 2779 + SYS___SCALBLNF_B = 0xADC // 2780 + SYS___SCALBLNF_H = 0xADD // 2781 + SYS_SCALBLNL = 0xADE // 2782 + SYS___SCALBLNL_B = 0xADF // 2783 + SYS___SCALBLNL_H = 0xAE0 // 2784 + SYS___SCALBN_B = 0xAE1 // 2785 + SYS___SCALBN_H = 0xAE2 // 2786 + SYS_SCALBNF = 0xAE3 // 2787 + SYS___SCALBNF_B = 0xAE4 // 2788 + SYS___SCALBNF_H = 0xAE5 // 2789 + SYS_SCALBNL = 0xAE6 // 2790 + SYS___SCALBNL_B = 0xAE7 // 2791 + SYS___SCALBNL_H = 0xAE8 // 2792 + SYS___TGAMMAL_H = 0xAE9 // 2793 + SYS_FECLEAREXCEPT = 0xAEA // 2794 + SYS_FEGETENV = 0xAEB // 2795 + SYS_FEGETEXCEPTFLAG = 0xAEC // 2796 + SYS_FEGETROUND = 0xAED // 2797 + SYS_FEHOLDEXCEPT = 0xAEE // 2798 + SYS_FERAISEEXCEPT = 0xAEF // 2799 + SYS_FESETENV = 0xAF0 // 2800 + SYS_FESETEXCEPTFLAG = 0xAF1 // 2801 + SYS_FESETROUND = 0xAF2 // 2802 + SYS_FETESTEXCEPT = 0xAF3 // 2803 + SYS_FEUPDATEENV = 0xAF4 // 2804 + SYS___COPYSIGN_H = 0xAF5 // 2805 + SYS___HYPOTF_H = 0xAF6 // 2806 + SYS___HYPOTL_H = 0xAF7 // 2807 + SYS___CLASS = 0xAFA // 2810 + SYS___CLASS_B = 0xAFB // 2811 + SYS___CLASS_H = 0xAFC // 2812 + SYS___ISBLANK_A = 0xB2E // 2862 + SYS___ISWBLANK_A = 0xB2F // 2863 + SYS___LROUND_FIXUP = 0xB30 // 2864 + SYS___LROUNDF_FIXUP = 0xB31 // 2865 + SYS_SCHED_YIELD = 0xB32 // 2866 + SYS_STRERROR_R = 0xB33 // 2867 + SYS_UNSETENV = 0xB34 // 2868 + SYS___LGAMMA_H_C99 = 0xB38 // 2872 + SYS___LGAMMA_B_C99 = 0xB39 // 2873 + SYS___LGAMMA_R_C99 = 0xB3A // 2874 + SYS___FTELL2 = 0xB3B // 2875 + SYS___FSEEK2 = 0xB3C // 2876 + SYS___STATIC_REINIT = 0xB3D // 2877 + SYS_PTHREAD_ATTR_GETSTACK = 0xB3E // 2878 + SYS_PTHREAD_ATTR_SETSTACK = 0xB3F // 2879 + SYS___TGAMMA_H_C99 = 0xB78 // 2936 + SYS___TGAMMAF_H_C99 = 0xB79 // 2937 + SYS___LE_TRACEBACK = 0xB7A // 2938 + SYS___MUST_STAY_CLEAN = 0xB7C // 2940 + SYS___O_ENV = 0xB7D // 2941 + SYS_ACOSD32 = 0xB7E // 2942 + SYS_ACOSD64 = 0xB7F // 2943 + SYS_ACOSD128 = 0xB80 // 2944 + SYS_ACOSHD32 = 0xB81 // 2945 + SYS_ACOSHD64 = 0xB82 // 2946 + SYS_ACOSHD128 = 0xB83 // 2947 + SYS_ASIND32 = 0xB84 // 2948 + SYS_ASIND64 = 0xB85 // 2949 + SYS_ASIND128 = 0xB86 // 2950 + SYS_ASINHD32 = 0xB87 // 2951 + SYS_ASINHD64 = 0xB88 // 2952 + SYS_ASINHD128 = 0xB89 // 2953 + SYS_ATAND32 = 0xB8A // 2954 + SYS_ATAND64 = 0xB8B // 2955 + SYS_ATAND128 = 0xB8C // 2956 + SYS_ATAN2D32 = 0xB8D // 2957 + SYS_ATAN2D64 = 0xB8E // 2958 + SYS_ATAN2D128 = 0xB8F // 2959 + SYS_ATANHD32 = 0xB90 // 2960 + SYS_ATANHD64 = 0xB91 // 2961 + SYS_ATANHD128 = 0xB92 // 2962 + SYS_CBRTD32 = 0xB93 // 2963 + SYS_CBRTD64 = 0xB94 // 2964 + SYS_CBRTD128 = 0xB95 // 2965 + SYS_CEILD32 = 0xB96 // 2966 + SYS_CEILD64 = 0xB97 // 2967 + SYS_CEILD128 = 0xB98 // 2968 + SYS___CLASS2 = 0xB99 // 2969 + SYS___CLASS2_B = 0xB9A // 2970 + SYS___CLASS2_H = 0xB9B // 2971 + SYS_COPYSIGND32 = 0xB9C // 2972 + SYS_COPYSIGND64 = 0xB9D // 2973 + SYS_COPYSIGND128 = 0xB9E // 2974 + SYS_COSD32 = 0xB9F // 2975 + SYS_COSD64 = 0xBA0 // 2976 + SYS_COSD128 = 0xBA1 // 2977 + SYS_COSHD32 = 0xBA2 // 2978 + SYS_COSHD64 = 0xBA3 // 2979 + SYS_COSHD128 = 0xBA4 // 2980 + SYS_ERFD32 = 0xBA5 // 2981 + SYS_ERFD64 = 0xBA6 // 2982 + SYS_ERFD128 = 0xBA7 // 2983 + SYS_ERFCD32 = 0xBA8 // 2984 + SYS_ERFCD64 = 0xBA9 // 2985 + SYS_ERFCD128 = 0xBAA // 2986 + SYS_EXPD32 = 0xBAB // 2987 + SYS_EXPD64 = 0xBAC // 2988 + SYS_EXPD128 = 0xBAD // 2989 + SYS_EXP2D32 = 0xBAE // 2990 + SYS_EXP2D64 = 0xBAF // 2991 + SYS_EXP2D128 = 0xBB0 // 2992 + SYS_EXPM1D32 = 0xBB1 // 2993 + SYS_EXPM1D64 = 0xBB2 // 2994 + SYS_EXPM1D128 = 0xBB3 // 2995 + SYS_FABSD32 = 0xBB4 // 2996 + SYS_FABSD64 = 0xBB5 // 2997 + SYS_FABSD128 = 0xBB6 // 2998 + SYS_FDIMD32 = 0xBB7 // 2999 + SYS_FDIMD64 = 0xBB8 // 3000 + SYS_FDIMD128 = 0xBB9 // 3001 + SYS_FE_DEC_GETROUND = 0xBBA // 3002 + SYS_FE_DEC_SETROUND = 0xBBB // 3003 + SYS_FLOORD32 = 0xBBC // 3004 + SYS_FLOORD64 = 0xBBD // 3005 + SYS_FLOORD128 = 0xBBE // 3006 + SYS_FMAD32 = 0xBBF // 3007 + SYS_FMAD64 = 0xBC0 // 3008 + SYS_FMAD128 = 0xBC1 // 3009 + SYS_FMAXD32 = 0xBC2 // 3010 + SYS_FMAXD64 = 0xBC3 // 3011 + SYS_FMAXD128 = 0xBC4 // 3012 + SYS_FMIND32 = 0xBC5 // 3013 + SYS_FMIND64 = 0xBC6 // 3014 + SYS_FMIND128 = 0xBC7 // 3015 + SYS_FMODD32 = 0xBC8 // 3016 + SYS_FMODD64 = 0xBC9 // 3017 + SYS_FMODD128 = 0xBCA // 3018 + SYS___FP_CAST_D = 0xBCB // 3019 + SYS_FREXPD32 = 0xBCC // 3020 + SYS_FREXPD64 = 0xBCD // 3021 + SYS_FREXPD128 = 0xBCE // 3022 + SYS_HYPOTD32 = 0xBCF // 3023 + SYS_HYPOTD64 = 0xBD0 // 3024 + SYS_HYPOTD128 = 0xBD1 // 3025 + SYS_ILOGBD32 = 0xBD2 // 3026 + SYS_ILOGBD64 = 0xBD3 // 3027 + SYS_ILOGBD128 = 0xBD4 // 3028 + SYS_LDEXPD32 = 0xBD5 // 3029 + SYS_LDEXPD64 = 0xBD6 // 3030 + SYS_LDEXPD128 = 0xBD7 // 3031 + SYS_LGAMMAD32 = 0xBD8 // 3032 + SYS_LGAMMAD64 = 0xBD9 // 3033 + SYS_LGAMMAD128 = 0xBDA // 3034 + SYS_LLRINTD32 = 0xBDB // 3035 + SYS_LLRINTD64 = 0xBDC // 3036 + SYS_LLRINTD128 = 0xBDD // 3037 + SYS_LLROUNDD32 = 0xBDE // 3038 + SYS_LLROUNDD64 = 0xBDF // 3039 + SYS_LLROUNDD128 = 0xBE0 // 3040 + SYS_LOGD32 = 0xBE1 // 3041 + SYS_LOGD64 = 0xBE2 // 3042 + SYS_LOGD128 = 0xBE3 // 3043 + SYS_LOG10D32 = 0xBE4 // 3044 + SYS_LOG10D64 = 0xBE5 // 3045 + SYS_LOG10D128 = 0xBE6 // 3046 + SYS_LOG1PD32 = 0xBE7 // 3047 + SYS_LOG1PD64 = 0xBE8 // 3048 + SYS_LOG1PD128 = 0xBE9 // 3049 + SYS_LOG2D32 = 0xBEA // 3050 + SYS_LOG2D64 = 0xBEB // 3051 + SYS_LOG2D128 = 0xBEC // 3052 + SYS_LOGBD32 = 0xBED // 3053 + SYS_LOGBD64 = 0xBEE // 3054 + SYS_LOGBD128 = 0xBEF // 3055 + SYS_LRINTD32 = 0xBF0 // 3056 + SYS_LRINTD64 = 0xBF1 // 3057 + SYS_LRINTD128 = 0xBF2 // 3058 + SYS_LROUNDD32 = 0xBF3 // 3059 + SYS_LROUNDD64 = 0xBF4 // 3060 + SYS_LROUNDD128 = 0xBF5 // 3061 + SYS_MODFD32 = 0xBF6 // 3062 + SYS_MODFD64 = 0xBF7 // 3063 + SYS_MODFD128 = 0xBF8 // 3064 + SYS_NAND32 = 0xBF9 // 3065 + SYS_NAND64 = 0xBFA // 3066 + SYS_NAND128 = 0xBFB // 3067 + SYS_NEARBYINTD32 = 0xBFC // 3068 + SYS_NEARBYINTD64 = 0xBFD // 3069 + SYS_NEARBYINTD128 = 0xBFE // 3070 + SYS_NEXTAFTERD32 = 0xBFF // 3071 + SYS_NEXTAFTERD64 = 0xC00 // 3072 + SYS_NEXTAFTERD128 = 0xC01 // 3073 + SYS_NEXTTOWARDD32 = 0xC02 // 3074 + SYS_NEXTTOWARDD64 = 0xC03 // 3075 + SYS_NEXTTOWARDD128 = 0xC04 // 3076 + SYS_POWD32 = 0xC05 // 3077 + SYS_POWD64 = 0xC06 // 3078 + SYS_POWD128 = 0xC07 // 3079 + SYS_QUANTIZED32 = 0xC08 // 3080 + SYS_QUANTIZED64 = 0xC09 // 3081 + SYS_QUANTIZED128 = 0xC0A // 3082 + SYS_REMAINDERD32 = 0xC0B // 3083 + SYS_REMAINDERD64 = 0xC0C // 3084 + SYS_REMAINDERD128 = 0xC0D // 3085 + SYS___REMQUOD32 = 0xC0E // 3086 + SYS___REMQUOD64 = 0xC0F // 3087 + SYS___REMQUOD128 = 0xC10 // 3088 + SYS_RINTD32 = 0xC11 // 3089 + SYS_RINTD64 = 0xC12 // 3090 + SYS_RINTD128 = 0xC13 // 3091 + SYS_ROUNDD32 = 0xC14 // 3092 + SYS_ROUNDD64 = 0xC15 // 3093 + SYS_ROUNDD128 = 0xC16 // 3094 + SYS_SAMEQUANTUMD32 = 0xC17 // 3095 + SYS_SAMEQUANTUMD64 = 0xC18 // 3096 + SYS_SAMEQUANTUMD128 = 0xC19 // 3097 + SYS_SCALBLND32 = 0xC1A // 3098 + SYS_SCALBLND64 = 0xC1B // 3099 + SYS_SCALBLND128 = 0xC1C // 3100 + SYS_SCALBND32 = 0xC1D // 3101 + SYS_SCALBND64 = 0xC1E // 3102 + SYS_SCALBND128 = 0xC1F // 3103 + SYS_SIND32 = 0xC20 // 3104 + SYS_SIND64 = 0xC21 // 3105 + SYS_SIND128 = 0xC22 // 3106 + SYS_SINHD32 = 0xC23 // 3107 + SYS_SINHD64 = 0xC24 // 3108 + SYS_SINHD128 = 0xC25 // 3109 + SYS_SQRTD32 = 0xC26 // 3110 + SYS_SQRTD64 = 0xC27 // 3111 + SYS_SQRTD128 = 0xC28 // 3112 + SYS_STRTOD32 = 0xC29 // 3113 + SYS_STRTOD64 = 0xC2A // 3114 + SYS_STRTOD128 = 0xC2B // 3115 + SYS_TAND32 = 0xC2C // 3116 + SYS_TAND64 = 0xC2D // 3117 + SYS_TAND128 = 0xC2E // 3118 + SYS_TANHD32 = 0xC2F // 3119 + SYS_TANHD64 = 0xC30 // 3120 + SYS_TANHD128 = 0xC31 // 3121 + SYS_TGAMMAD32 = 0xC32 // 3122 + SYS_TGAMMAD64 = 0xC33 // 3123 + SYS_TGAMMAD128 = 0xC34 // 3124 + SYS_TRUNCD32 = 0xC3E // 3134 + SYS_TRUNCD64 = 0xC3F // 3135 + SYS_TRUNCD128 = 0xC40 // 3136 + SYS_WCSTOD32 = 0xC41 // 3137 + SYS_WCSTOD64 = 0xC42 // 3138 + SYS_WCSTOD128 = 0xC43 // 3139 + SYS___CODEPAGE_INFO = 0xC64 // 3172 + SYS_POSIX_OPENPT = 0xC66 // 3174 + SYS_PSELECT = 0xC67 // 3175 + SYS_SOCKATMARK = 0xC68 // 3176 + SYS_AIO_FSYNC = 0xC69 // 3177 + SYS_LIO_LISTIO = 0xC6A // 3178 + SYS___ATANPID32 = 0xC6B // 3179 + SYS___ATANPID64 = 0xC6C // 3180 + SYS___ATANPID128 = 0xC6D // 3181 + SYS___COSPID32 = 0xC6E // 3182 + SYS___COSPID64 = 0xC6F // 3183 + SYS___COSPID128 = 0xC70 // 3184 + SYS___SINPID32 = 0xC71 // 3185 + SYS___SINPID64 = 0xC72 // 3186 + SYS___SINPID128 = 0xC73 // 3187 + SYS_SETIPV4SOURCEFILTER = 0xC76 // 3190 + SYS_GETIPV4SOURCEFILTER = 0xC77 // 3191 + SYS_SETSOURCEFILTER = 0xC78 // 3192 + SYS_GETSOURCEFILTER = 0xC79 // 3193 + SYS_FWRITE_UNLOCKED = 0xC7A // 3194 + SYS_FREAD_UNLOCKED = 0xC7B // 3195 + SYS_FGETS_UNLOCKED = 0xC7C // 3196 + SYS_GETS_UNLOCKED = 0xC7D // 3197 + SYS_FPUTS_UNLOCKED = 0xC7E // 3198 + SYS_PUTS_UNLOCKED = 0xC7F // 3199 + SYS_FGETC_UNLOCKED = 0xC80 // 3200 + SYS_FPUTC_UNLOCKED = 0xC81 // 3201 + SYS_DLADDR = 0xC82 // 3202 + SYS_SHM_OPEN = 0xC8C // 3212 + SYS_SHM_UNLINK = 0xC8D // 3213 + SYS___CLASS2F = 0xC91 // 3217 + SYS___CLASS2L = 0xC92 // 3218 + SYS___CLASS2F_B = 0xC93 // 3219 + SYS___CLASS2F_H = 0xC94 // 3220 + SYS___CLASS2L_B = 0xC95 // 3221 + SYS___CLASS2L_H = 0xC96 // 3222 + SYS___CLASS2D32 = 0xC97 // 3223 + SYS___CLASS2D64 = 0xC98 // 3224 + SYS___CLASS2D128 = 0xC99 // 3225 + SYS___TOCSNAME2 = 0xC9A // 3226 + SYS___D1TOP = 0xC9B // 3227 + SYS___D2TOP = 0xC9C // 3228 + SYS___D4TOP = 0xC9D // 3229 + SYS___PTOD1 = 0xC9E // 3230 + SYS___PTOD2 = 0xC9F // 3231 + SYS___PTOD4 = 0xCA0 // 3232 + SYS_CLEARERR_UNLOCKED = 0xCA1 // 3233 + SYS_FDELREC_UNLOCKED = 0xCA2 // 3234 + SYS_FEOF_UNLOCKED = 0xCA3 // 3235 + SYS_FERROR_UNLOCKED = 0xCA4 // 3236 + SYS_FFLUSH_UNLOCKED = 0xCA5 // 3237 + SYS_FGETPOS_UNLOCKED = 0xCA6 // 3238 + SYS_FGETWC_UNLOCKED = 0xCA7 // 3239 + SYS_FGETWS_UNLOCKED = 0xCA8 // 3240 + SYS_FILENO_UNLOCKED = 0xCA9 // 3241 + SYS_FLDATA_UNLOCKED = 0xCAA // 3242 + SYS_FLOCATE_UNLOCKED = 0xCAB // 3243 + SYS_FPRINTF_UNLOCKED = 0xCAC // 3244 + SYS_FPUTWC_UNLOCKED = 0xCAD // 3245 + SYS_FPUTWS_UNLOCKED = 0xCAE // 3246 + SYS_FSCANF_UNLOCKED = 0xCAF // 3247 + SYS_FSEEK_UNLOCKED = 0xCB0 // 3248 + SYS_FSEEKO_UNLOCKED = 0xCB1 // 3249 + SYS_FSETPOS_UNLOCKED = 0xCB3 // 3251 + SYS_FTELL_UNLOCKED = 0xCB4 // 3252 + SYS_FTELLO_UNLOCKED = 0xCB5 // 3253 + SYS_FUPDATE_UNLOCKED = 0xCB7 // 3255 + SYS_FWIDE_UNLOCKED = 0xCB8 // 3256 + SYS_FWPRINTF_UNLOCKED = 0xCB9 // 3257 + SYS_FWSCANF_UNLOCKED = 0xCBA // 3258 + SYS_GETWC_UNLOCKED = 0xCBB // 3259 + SYS_GETWCHAR_UNLOCKED = 0xCBC // 3260 + SYS_PERROR_UNLOCKED = 0xCBD // 3261 + SYS_PRINTF_UNLOCKED = 0xCBE // 3262 + SYS_PUTWC_UNLOCKED = 0xCBF // 3263 + SYS_PUTWCHAR_UNLOCKED = 0xCC0 // 3264 + SYS_REWIND_UNLOCKED = 0xCC1 // 3265 + SYS_SCANF_UNLOCKED = 0xCC2 // 3266 + SYS_UNGETC_UNLOCKED = 0xCC3 // 3267 + SYS_UNGETWC_UNLOCKED = 0xCC4 // 3268 + SYS_VFPRINTF_UNLOCKED = 0xCC5 // 3269 + SYS_VFSCANF_UNLOCKED = 0xCC7 // 3271 + SYS_VFWPRINTF_UNLOCKED = 0xCC9 // 3273 + SYS_VFWSCANF_UNLOCKED = 0xCCB // 3275 + SYS_VPRINTF_UNLOCKED = 0xCCD // 3277 + SYS_VSCANF_UNLOCKED = 0xCCF // 3279 + SYS_VWPRINTF_UNLOCKED = 0xCD1 // 3281 + SYS_VWSCANF_UNLOCKED = 0xCD3 // 3283 + SYS_WPRINTF_UNLOCKED = 0xCD5 // 3285 + SYS_WSCANF_UNLOCKED = 0xCD6 // 3286 + SYS_ASCTIME64 = 0xCD7 // 3287 + SYS_ASCTIME64_R = 0xCD8 // 3288 + SYS_CTIME64 = 0xCD9 // 3289 + SYS_CTIME64_R = 0xCDA // 3290 + SYS_DIFFTIME64 = 0xCDB // 3291 + SYS_GMTIME64 = 0xCDC // 3292 + SYS_GMTIME64_R = 0xCDD // 3293 + SYS_LOCALTIME64 = 0xCDE // 3294 + SYS_LOCALTIME64_R = 0xCDF // 3295 + SYS_MKTIME64 = 0xCE0 // 3296 + SYS_TIME64 = 0xCE1 // 3297 + SYS___LOGIN_APPLID = 0xCE2 // 3298 + SYS___PASSWD_APPLID = 0xCE3 // 3299 + SYS_PTHREAD_SECURITY_APPLID_NP = 0xCE4 // 3300 + SYS___GETTHENT = 0xCE5 // 3301 + SYS_FREEIFADDRS = 0xCE6 // 3302 + SYS_GETIFADDRS = 0xCE7 // 3303 + SYS_POSIX_FALLOCATE = 0xCE8 // 3304 + SYS_POSIX_MEMALIGN = 0xCE9 // 3305 + SYS_SIZEOF_ALLOC = 0xCEA // 3306 + SYS_RESIZE_ALLOC = 0xCEB // 3307 + SYS_FREAD_NOUPDATE = 0xCEC // 3308 + SYS_FREAD_NOUPDATE_UNLOCKED = 0xCED // 3309 + SYS_FGETPOS64 = 0xCEE // 3310 + SYS_FSEEK64 = 0xCEF // 3311 + SYS_FSEEKO64 = 0xCF0 // 3312 + SYS_FSETPOS64 = 0xCF1 // 3313 + SYS_FTELL64 = 0xCF2 // 3314 + SYS_FTELLO64 = 0xCF3 // 3315 + SYS_FGETPOS64_UNLOCKED = 0xCF4 // 3316 + SYS_FSEEK64_UNLOCKED = 0xCF5 // 3317 + SYS_FSEEKO64_UNLOCKED = 0xCF6 // 3318 + SYS_FSETPOS64_UNLOCKED = 0xCF7 // 3319 + SYS_FTELL64_UNLOCKED = 0xCF8 // 3320 + SYS_FTELLO64_UNLOCKED = 0xCF9 // 3321 + SYS_FOPEN_UNLOCKED = 0xCFA // 3322 + SYS_FREOPEN_UNLOCKED = 0xCFB // 3323 + SYS_FDOPEN_UNLOCKED = 0xCFC // 3324 + SYS_TMPFILE_UNLOCKED = 0xCFD // 3325 + SYS___MOSERVICES = 0xD3D // 3389 + SYS___GETTOD = 0xD3E // 3390 + SYS_C16RTOMB = 0xD40 // 3392 + SYS_C32RTOMB = 0xD41 // 3393 + SYS_MBRTOC16 = 0xD42 // 3394 + SYS_MBRTOC32 = 0xD43 // 3395 + SYS_QUANTEXPD32 = 0xD44 // 3396 + SYS_QUANTEXPD64 = 0xD45 // 3397 + SYS_QUANTEXPD128 = 0xD46 // 3398 + SYS___LOCALE_CTL = 0xD47 // 3399 + SYS___SMF_RECORD2 = 0xD48 // 3400 + SYS_FOPEN64 = 0xD49 // 3401 + SYS_FOPEN64_UNLOCKED = 0xD4A // 3402 + SYS_FREOPEN64 = 0xD4B // 3403 + SYS_FREOPEN64_UNLOCKED = 0xD4C // 3404 + SYS_TMPFILE64 = 0xD4D // 3405 + SYS_TMPFILE64_UNLOCKED = 0xD4E // 3406 + SYS_GETDATE64 = 0xD4F // 3407 + SYS_GETTIMEOFDAY64 = 0xD50 // 3408 + SYS_BIND2ADDRSEL = 0xD59 // 3417 + SYS_INET6_IS_SRCADDR = 0xD5A // 3418 + SYS___GETGRGID1 = 0xD5B // 3419 + SYS___GETGRNAM1 = 0xD5C // 3420 + SYS___FBUFSIZE = 0xD60 // 3424 + SYS___FPENDING = 0xD61 // 3425 + SYS___FLBF = 0xD62 // 3426 + SYS___FREADABLE = 0xD63 // 3427 + SYS___FWRITABLE = 0xD64 // 3428 + SYS___FREADING = 0xD65 // 3429 + SYS___FWRITING = 0xD66 // 3430 + SYS___FSETLOCKING = 0xD67 // 3431 + SYS__FLUSHLBF = 0xD68 // 3432 + SYS___FPURGE = 0xD69 // 3433 + SYS___FREADAHEAD = 0xD6A // 3434 + SYS___FSETERR = 0xD6B // 3435 + SYS___FPENDING_UNLOCKED = 0xD6C // 3436 + SYS___FREADING_UNLOCKED = 0xD6D // 3437 + SYS___FWRITING_UNLOCKED = 0xD6E // 3438 + SYS__FLUSHLBF_UNLOCKED = 0xD6F // 3439 + SYS___FPURGE_UNLOCKED = 0xD70 // 3440 + SYS___FREADAHEAD_UNLOCKED = 0xD71 // 3441 + SYS___LE_CEEGTJS = 0xD72 // 3442 + SYS___LE_RECORD_DUMP = 0xD73 // 3443 + SYS_FSTAT64 = 0xD74 // 3444 + SYS_LSTAT64 = 0xD75 // 3445 + SYS_STAT64 = 0xD76 // 3446 + SYS___READDIR2_64 = 0xD77 // 3447 + SYS___OPEN_STAT64 = 0xD78 // 3448 + SYS_FTW64 = 0xD79 // 3449 + SYS_NFTW64 = 0xD7A // 3450 + SYS_UTIME64 = 0xD7B // 3451 + SYS_UTIMES64 = 0xD7C // 3452 + SYS___GETIPC64 = 0xD7D // 3453 + SYS_MSGCTL64 = 0xD7E // 3454 + SYS_SEMCTL64 = 0xD7F // 3455 + SYS_SHMCTL64 = 0xD80 // 3456 + SYS_MSGXRCV64 = 0xD81 // 3457 + SYS___MGXR64 = 0xD81 // 3457 + SYS_W_GETPSENT64 = 0xD82 // 3458 + SYS_PTHREAD_COND_TIMEDWAIT64 = 0xD83 // 3459 + SYS_FTIME64 = 0xD85 // 3461 + SYS_GETUTXENT64 = 0xD86 // 3462 + SYS_GETUTXID64 = 0xD87 // 3463 + SYS_GETUTXLINE64 = 0xD88 // 3464 + SYS_PUTUTXLINE64 = 0xD89 // 3465 + SYS_NEWLOCALE = 0xD8A // 3466 + SYS_FREELOCALE = 0xD8B // 3467 + SYS_USELOCALE = 0xD8C // 3468 + SYS_DUPLOCALE = 0xD8D // 3469 + SYS___CHATTR64 = 0xD9C // 3484 + SYS___LCHATTR64 = 0xD9D // 3485 + SYS___FCHATTR64 = 0xD9E // 3486 + SYS_____CHATTR64_A = 0xD9F // 3487 + SYS_____LCHATTR64_A = 0xDA0 // 3488 + SYS___LE_CEEUSGD = 0xDA1 // 3489 + SYS___LE_IFAM_CON = 0xDA2 // 3490 + SYS___LE_IFAM_DSC = 0xDA3 // 3491 + SYS___LE_IFAM_GET = 0xDA4 // 3492 + SYS___LE_IFAM_QRY = 0xDA5 // 3493 + SYS_ALIGNED_ALLOC = 0xDA6 // 3494 + SYS_ACCEPT4 = 0xDA7 // 3495 + SYS___ACCEPT4_A = 0xDA8 // 3496 + SYS_COPYFILERANGE = 0xDA9 // 3497 + SYS_GETLINE = 0xDAA // 3498 + SYS___GETLINE_A = 0xDAB // 3499 + SYS_DIRFD = 0xDAC // 3500 + SYS_CLOCK_GETTIME = 0xDAD // 3501 + SYS_DUP3 = 0xDAE // 3502 + SYS_EPOLL_CREATE = 0xDAF // 3503 + SYS_EPOLL_CREATE1 = 0xDB0 // 3504 + SYS_EPOLL_CTL = 0xDB1 // 3505 + SYS_EPOLL_WAIT = 0xDB2 // 3506 + SYS_EPOLL_PWAIT = 0xDB3 // 3507 + SYS_EVENTFD = 0xDB4 // 3508 + SYS_STATFS = 0xDB5 // 3509 + SYS___STATFS_A = 0xDB6 // 3510 + SYS_FSTATFS = 0xDB7 // 3511 + SYS_INOTIFY_INIT = 0xDB8 // 3512 + SYS_INOTIFY_INIT1 = 0xDB9 // 3513 + SYS_INOTIFY_ADD_WATCH = 0xDBA // 3514 + SYS___INOTIFY_ADD_WATCH_A = 0xDBB // 3515 + SYS_INOTIFY_RM_WATCH = 0xDBC // 3516 + SYS_PIPE2 = 0xDBD // 3517 + SYS_PIVOT_ROOT = 0xDBE // 3518 + SYS___PIVOT_ROOT_A = 0xDBF // 3519 + SYS_PRCTL = 0xDC0 // 3520 + SYS_PRLIMIT = 0xDC1 // 3521 + SYS_SETHOSTNAME = 0xDC2 // 3522 + SYS___SETHOSTNAME_A = 0xDC3 // 3523 + SYS_SETRESUID = 0xDC4 // 3524 + SYS_SETRESGID = 0xDC5 // 3525 + SYS_PTHREAD_CONDATTR_GETCLOCK = 0xDC6 // 3526 + SYS_FLOCK = 0xDC7 // 3527 + SYS_FGETXATTR = 0xDC8 // 3528 + SYS___FGETXATTR_A = 0xDC9 // 3529 + SYS_FLISTXATTR = 0xDCA // 3530 + SYS___FLISTXATTR_A = 0xDCB // 3531 + SYS_FREMOVEXATTR = 0xDCC // 3532 + SYS___FREMOVEXATTR_A = 0xDCD // 3533 + SYS_FSETXATTR = 0xDCE // 3534 + SYS___FSETXATTR_A = 0xDCF // 3535 + SYS_GETXATTR = 0xDD0 // 3536 + SYS___GETXATTR_A = 0xDD1 // 3537 + SYS_LGETXATTR = 0xDD2 // 3538 + SYS___LGETXATTR_A = 0xDD3 // 3539 + SYS_LISTXATTR = 0xDD4 // 3540 + SYS___LISTXATTR_A = 0xDD5 // 3541 + SYS_LLISTXATTR = 0xDD6 // 3542 + SYS___LLISTXATTR_A = 0xDD7 // 3543 + SYS_LREMOVEXATTR = 0xDD8 // 3544 + SYS___LREMOVEXATTR_A = 0xDD9 // 3545 + SYS_LSETXATTR = 0xDDA // 3546 + SYS___LSETXATTR_A = 0xDDB // 3547 + SYS_REMOVEXATTR = 0xDDC // 3548 + SYS___REMOVEXATTR_A = 0xDDD // 3549 + SYS_SETXATTR = 0xDDE // 3550 + SYS___SETXATTR_A = 0xDDF // 3551 + SYS_FDATASYNC = 0xDE0 // 3552 + SYS_SYNCFS = 0xDE1 // 3553 + SYS_FUTIMES = 0xDE2 // 3554 + SYS_FUTIMESAT = 0xDE3 // 3555 + SYS___FUTIMESAT_A = 0xDE4 // 3556 + SYS_LUTIMES = 0xDE5 // 3557 + SYS___LUTIMES_A = 0xDE6 // 3558 + SYS_INET_ATON = 0xDE7 // 3559 + SYS_GETRANDOM = 0xDE8 // 3560 + SYS_GETTID = 0xDE9 // 3561 + SYS_MEMFD_CREATE = 0xDEA // 3562 + SYS___MEMFD_CREATE_A = 0xDEB // 3563 + SYS_FACCESSAT = 0xDEC // 3564 + SYS___FACCESSAT_A = 0xDED // 3565 + SYS_FCHMODAT = 0xDEE // 3566 + SYS___FCHMODAT_A = 0xDEF // 3567 + SYS_FCHOWNAT = 0xDF0 // 3568 + SYS___FCHOWNAT_A = 0xDF1 // 3569 + SYS_FSTATAT = 0xDF2 // 3570 + SYS___FSTATAT_A = 0xDF3 // 3571 + SYS_LINKAT = 0xDF4 // 3572 + SYS___LINKAT_A = 0xDF5 // 3573 + SYS_MKDIRAT = 0xDF6 // 3574 + SYS___MKDIRAT_A = 0xDF7 // 3575 + SYS_MKFIFOAT = 0xDF8 // 3576 + SYS___MKFIFOAT_A = 0xDF9 // 3577 + SYS_MKNODAT = 0xDFA // 3578 + SYS___MKNODAT_A = 0xDFB // 3579 + SYS_OPENAT = 0xDFC // 3580 + SYS___OPENAT_A = 0xDFD // 3581 + SYS_READLINKAT = 0xDFE // 3582 + SYS___READLINKAT_A = 0xDFF // 3583 + SYS_RENAMEAT = 0xE00 // 3584 + SYS___RENAMEAT_A = 0xE01 // 3585 + SYS_RENAMEAT2 = 0xE02 // 3586 + SYS___RENAMEAT2_A = 0xE03 // 3587 + SYS_SYMLINKAT = 0xE04 // 3588 + SYS___SYMLINKAT_A = 0xE05 // 3589 + SYS_UNLINKAT = 0xE06 // 3590 + SYS___UNLINKAT_A = 0xE07 // 3591 + SYS_SYSINFO = 0xE08 // 3592 + SYS_WAIT4 = 0xE0A // 3594 + SYS_CLONE = 0xE0B // 3595 + SYS_UNSHARE = 0xE0C // 3596 + SYS_SETNS = 0xE0D // 3597 + SYS_CAPGET = 0xE0E // 3598 + SYS_CAPSET = 0xE0F // 3599 + SYS_STRCHRNUL = 0xE10 // 3600 + SYS_PTHREAD_CONDATTR_SETCLOCK = 0xE12 // 3602 + SYS_OPEN_BY_HANDLE_AT = 0xE13 // 3603 + SYS___OPEN_BY_HANDLE_AT_A = 0xE14 // 3604 + SYS___INET_ATON_A = 0xE15 // 3605 + SYS_MOUNT1 = 0xE16 // 3606 + SYS___MOUNT1_A = 0xE17 // 3607 + SYS_UMOUNT1 = 0xE18 // 3608 + SYS___UMOUNT1_A = 0xE19 // 3609 + SYS_UMOUNT2 = 0xE1A // 3610 + SYS___UMOUNT2_A = 0xE1B // 3611 + SYS___PRCTL_A = 0xE1C // 3612 + SYS_LOCALTIME_R2 = 0xE1D // 3613 + SYS___LOCALTIME_R2_A = 0xE1E // 3614 + SYS_OPENAT2 = 0xE1F // 3615 + SYS___OPENAT2_A = 0xE20 // 3616 + SYS___LE_CEEMICT = 0xE21 // 3617 + SYS_GETENTROPY = 0xE22 // 3618 + SYS_NANOSLEEP = 0xE23 // 3619 + SYS_UTIMENSAT = 0xE24 // 3620 + SYS___UTIMENSAT_A = 0xE25 // 3621 + SYS_ASPRINTF = 0xE26 // 3622 + SYS___ASPRINTF_A = 0xE27 // 3623 + SYS_VASPRINTF = 0xE28 // 3624 + SYS___VASPRINTF_A = 0xE29 // 3625 + SYS_DPRINTF = 0xE2A // 3626 + SYS___DPRINTF_A = 0xE2B // 3627 + SYS_GETOPT_LONG = 0xE2C // 3628 + SYS___GETOPT_LONG_A = 0xE2D // 3629 + SYS_PSIGNAL = 0xE2E // 3630 + SYS___PSIGNAL_A = 0xE2F // 3631 + SYS_PSIGNAL_UNLOCKED = 0xE30 // 3632 + SYS___PSIGNAL_UNLOCKED_A = 0xE31 // 3633 + SYS_FSTATAT_O = 0xE32 // 3634 + SYS___FSTATAT_O_A = 0xE33 // 3635 + SYS_FSTATAT64 = 0xE34 // 3636 + SYS___FSTATAT64_A = 0xE35 // 3637 + SYS___CHATTRAT = 0xE36 // 3638 + SYS_____CHATTRAT_A = 0xE37 // 3639 + SYS___CHATTRAT64 = 0xE38 // 3640 + SYS_____CHATTRAT64_A = 0xE39 // 3641 + SYS_MADVISE = 0xE3A // 3642 + SYS___AUTHENTICATE = 0xE3B // 3643 + ) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index eff6bcd..0036746 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1178,7 +1178,8 @@ const ( PERF_SAMPLE_BRANCH_TYPE_SAVE_SHIFT = 0x10 PERF_SAMPLE_BRANCH_HW_INDEX_SHIFT = 0x11 PERF_SAMPLE_BRANCH_PRIV_SAVE_SHIFT = 0x12 - PERF_SAMPLE_BRANCH_MAX_SHIFT = 0x13 + PERF_SAMPLE_BRANCH_COUNTERS = 0x80000 + PERF_SAMPLE_BRANCH_MAX_SHIFT = 0x14 PERF_SAMPLE_BRANCH_USER = 0x1 PERF_SAMPLE_BRANCH_KERNEL = 0x2 PERF_SAMPLE_BRANCH_HV = 0x4 @@ -1198,7 +1199,7 @@ const ( PERF_SAMPLE_BRANCH_TYPE_SAVE = 0x10000 PERF_SAMPLE_BRANCH_HW_INDEX = 0x20000 PERF_SAMPLE_BRANCH_PRIV_SAVE = 0x40000 - PERF_SAMPLE_BRANCH_MAX = 0x80000 + PERF_SAMPLE_BRANCH_MAX = 0x100000 PERF_BR_UNKNOWN = 0x0 PERF_BR_COND = 0x1 PERF_BR_UNCOND = 0x2 @@ -2481,6 +2482,15 @@ type XDPMmapOffsets struct { Cr XDPRingOffset } +type XDPUmemReg struct { + Addr uint64 + Len uint64 + Chunk_size uint32 + Headroom uint32 + Flags uint32 + Tx_metadata_len uint32 +} + type XDPStatistics struct { Rx_dropped uint64 Rx_invalid_descs uint64 @@ -2935,7 +2945,7 @@ const ( BPF_TCP_LISTEN = 0xa BPF_TCP_CLOSING = 0xb BPF_TCP_NEW_SYN_RECV = 0xc - BPF_TCP_MAX_STATES = 0xd + BPF_TCP_MAX_STATES = 0xe TCP_BPF_IW = 0x3e9 TCP_BPF_SNDCWND_CLAMP = 0x3ea TCP_BPF_DELACK_MAX = 0x3eb @@ -3211,7 +3221,7 @@ const ( DEVLINK_CMD_LINECARD_NEW = 0x50 DEVLINK_CMD_LINECARD_DEL = 0x51 DEVLINK_CMD_SELFTESTS_GET = 0x52 - DEVLINK_CMD_MAX = 0x53 + DEVLINK_CMD_MAX = 0x54 DEVLINK_PORT_TYPE_NOTSET = 0x0 DEVLINK_PORT_TYPE_AUTO = 0x1 DEVLINK_PORT_TYPE_ETH = 0x2 @@ -4595,7 +4605,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x146 + NL80211_ATTR_MAX = 0x149 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4861,7 +4871,7 @@ const ( NL80211_BSS_FREQUENCY_OFFSET = 0x14 NL80211_BSS_INFORMATION_ELEMENTS = 0x6 NL80211_BSS_LAST_SEEN_BOOTTIME = 0xf - NL80211_BSS_MAX = 0x16 + NL80211_BSS_MAX = 0x18 NL80211_BSS_MLD_ADDR = 0x16 NL80211_BSS_MLO_LINK_ID = 0x15 NL80211_BSS_PAD = 0x10 @@ -4965,7 +4975,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x9a + NL80211_CMD_MAX = 0x9b NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5199,7 +5209,7 @@ const ( NL80211_FREQUENCY_ATTR_GO_CONCURRENT = 0xf NL80211_FREQUENCY_ATTR_INDOOR_ONLY = 0xe NL80211_FREQUENCY_ATTR_IR_CONCURRENT = 0xf - NL80211_FREQUENCY_ATTR_MAX = 0x1c + NL80211_FREQUENCY_ATTR_MAX = 0x1f NL80211_FREQUENCY_ATTR_MAX_TX_POWER = 0x6 NL80211_FREQUENCY_ATTR_NO_10MHZ = 0x11 NL80211_FREQUENCY_ATTR_NO_160MHZ = 0xc diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 438a30a..fd402da 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -477,14 +477,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index adceca3..eb7a5e1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -492,15 +492,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index eeaa00a..d78ac10 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -470,15 +470,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]uint8 Driver_name [64]uint8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 6739aa9..cd06d47 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -471,15 +471,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 9920ef6..2f28fe2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -472,15 +472,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index 2923b79..71d6cac 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -476,15 +476,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index ce2750e..8596d45 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -474,15 +474,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index 3038811..cd60ea1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -474,15 +474,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index efc6fed..b0ae420 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -476,15 +476,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index 9a654b7..8359728 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -482,15 +482,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]uint8 Driver_name [64]uint8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 40d358e..69eb6a5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -481,15 +481,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]uint8 Driver_name [64]uint8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 148c6ce..5f583cb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -481,15 +481,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]uint8 Driver_name [64]uint8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index 72ba815..15adc04 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -499,15 +499,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]uint8 Driver_name [64]uint8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 71e7655..cf3ce90 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -495,15 +495,6 @@ const ( BLKPG = 0x1269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index 4abbdb9..590b567 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -476,15 +476,6 @@ const ( BLKPG = 0x20001269 ) -type XDPUmemReg struct { - Addr uint64 - Len uint64 - Size uint32 - Headroom uint32 - Flags uint32 - _ [4]byte -} - type CryptoUserAlg struct { Name [64]int8 Driver_name [64]int8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index 54f31be..d9a13af 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -25,10 +25,13 @@ const ( SizeofIPv6Mreq = 20 SizeofICMPv6Filter = 32 SizeofIPv6MTUInfo = 32 + SizeofInet4Pktinfo = 8 + SizeofInet6Pktinfo = 20 SizeofLinger = 8 SizeofSockaddrInet4 = 16 SizeofSockaddrInet6 = 28 SizeofTCPInfo = 0x68 + SizeofUcred = 12 ) type ( @@ -69,12 +72,17 @@ type Utimbuf struct { } type Utsname struct { - Sysname [65]byte - Nodename [65]byte - Release [65]byte - Version [65]byte - Machine [65]byte - Domainname [65]byte + Sysname [16]byte + Nodename [32]byte + Release [8]byte + Version [8]byte + Machine [16]byte +} + +type Ucred struct { + Pid int32 + Uid uint32 + Gid uint32 } type RawSockaddrInet4 struct { @@ -325,7 +333,7 @@ type Statvfs_t struct { } type Statfs_t struct { - Type uint32 + Type uint64 Bsize uint64 Blocks uint64 Bfree uint64 @@ -336,6 +344,7 @@ type Statfs_t struct { Namelen uint64 Frsize uint64 Flags uint64 + _ [4]uint64 } type direntLE struct { @@ -412,3 +421,126 @@ type W_Mntent struct { Quiesceowner [8]byte _ [38]byte } + +type EpollEvent struct { + Events uint32 + _ int32 + Fd int32 + Pad int32 +} + +type InotifyEvent struct { + Wd int32 + Mask uint32 + Cookie uint32 + Len uint32 + Name string +} + +const ( + SizeofInotifyEvent = 0x10 +) + +type ConsMsg2 struct { + Cm2Format uint16 + Cm2R1 uint16 + Cm2Msglength uint32 + Cm2Msg *byte + Cm2R2 [4]byte + Cm2R3 [4]byte + Cm2Routcde *uint32 + Cm2Descr *uint32 + Cm2Msgflag uint32 + Cm2Token uint32 + Cm2Msgid *uint32 + Cm2R4 [4]byte + Cm2DomToken uint32 + Cm2DomMsgid *uint32 + Cm2ModCartptr *byte + Cm2ModConsidptr *byte + Cm2MsgCart [8]byte + Cm2MsgConsid [4]byte + Cm2R5 [12]byte +} + +const ( + CC_modify = 1 + CC_stop = 2 + CONSOLE_FORMAT_2 = 2 + CONSOLE_FORMAT_3 = 3 + CONSOLE_HRDCPY = 0x80000000 +) + +type OpenHow struct { + Flags uint64 + Mode uint64 + Resolve uint64 +} + +const SizeofOpenHow = 0x18 + +const ( + RESOLVE_CACHED = 0x20 + RESOLVE_BENEATH = 0x8 + RESOLVE_IN_ROOT = 0x10 + RESOLVE_NO_MAGICLINKS = 0x2 + RESOLVE_NO_SYMLINKS = 0x4 + RESOLVE_NO_XDEV = 0x1 +) + +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + _ [44]byte +} + +type SysvIpcPerm struct { + Uid uint32 + Gid uint32 + Cuid uint32 + Cgid uint32 + Mode int32 +} + +type SysvShmDesc struct { + Perm SysvIpcPerm + _ [4]byte + Lpid int32 + Cpid int32 + Nattch uint32 + _ [4]byte + _ [4]byte + _ [4]byte + _ int32 + _ uint8 + _ uint8 + _ uint16 + _ *byte + Segsz uint64 + Atime Time_t + Dtime Time_t + Ctime Time_t +} + +type SysvShmDesc64 struct { + Perm SysvIpcPerm + _ [4]byte + Lpid int32 + Cpid int32 + Nattch uint32 + _ [4]byte + _ [4]byte + _ [4]byte + _ int32 + _ byte + _ uint8 + _ uint16 + _ *byte + Segsz uint64 + Atime int64 + Dtime int64 + Ctime int64 +} diff --git a/vendor/golang.org/x/sys/windows/aliases.go b/vendor/golang.org/x/sys/windows/aliases.go index ce2d713..16f9056 100644 --- a/vendor/golang.org/x/sys/windows/aliases.go +++ b/vendor/golang.org/x/sys/windows/aliases.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build windows && go1.9 +//go:build windows package windows diff --git a/vendor/golang.org/x/sys/windows/empty.s b/vendor/golang.org/x/sys/windows/empty.s deleted file mode 100644 index ba64cac..0000000 --- a/vendor/golang.org/x/sys/windows/empty.s +++ /dev/null @@ -1,8 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.12 - -// This file is here to allow bodyless functions with go:linkname for Go 1.11 -// and earlier (see https://golang.org/issue/23311). diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 6395a03..6525c62 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -165,6 +165,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys CreateFile(name *uint16, access uint32, mode uint32, sa *SecurityAttributes, createmode uint32, attrs uint32, templatefile Handle) (handle Handle, err error) [failretval==InvalidHandle] = CreateFileW //sys CreateNamedPipe(name *uint16, flags uint32, pipeMode uint32, maxInstances uint32, outSize uint32, inSize uint32, defaultTimeout uint32, sa *SecurityAttributes) (handle Handle, err error) [failretval==InvalidHandle] = CreateNamedPipeW //sys ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) +//sys DisconnectNamedPipe(pipe Handle) (err error) //sys GetNamedPipeInfo(pipe Handle, flags *uint32, outSize *uint32, inSize *uint32, maxInstances *uint32) (err error) //sys GetNamedPipeHandleState(pipe Handle, state *uint32, curInstances *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32, userName *uint16, maxUserNameSize uint32) (err error) = GetNamedPipeHandleStateW //sys SetNamedPipeHandleState(pipe Handle, state *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32) (err error) = SetNamedPipeHandleState @@ -348,8 +349,19 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys SetProcessPriorityBoost(process Handle, disable bool) (err error) = kernel32.SetProcessPriorityBoost //sys GetProcessWorkingSetSizeEx(hProcess Handle, lpMinimumWorkingSetSize *uintptr, lpMaximumWorkingSetSize *uintptr, flags *uint32) //sys SetProcessWorkingSetSizeEx(hProcess Handle, dwMinimumWorkingSetSize uintptr, dwMaximumWorkingSetSize uintptr, flags uint32) (err error) +//sys ClearCommBreak(handle Handle) (err error) +//sys ClearCommError(handle Handle, lpErrors *uint32, lpStat *ComStat) (err error) +//sys EscapeCommFunction(handle Handle, dwFunc uint32) (err error) +//sys GetCommState(handle Handle, lpDCB *DCB) (err error) +//sys GetCommModemStatus(handle Handle, lpModemStat *uint32) (err error) //sys GetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) +//sys PurgeComm(handle Handle, dwFlags uint32) (err error) +//sys SetCommBreak(handle Handle) (err error) +//sys SetCommMask(handle Handle, dwEvtMask uint32) (err error) +//sys SetCommState(handle Handle, lpDCB *DCB) (err error) //sys SetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) +//sys SetupComm(handle Handle, dwInQueue uint32, dwOutQueue uint32) (err error) +//sys WaitCommEvent(handle Handle, lpEvtMask *uint32, lpOverlapped *Overlapped) (err error) //sys GetActiveProcessorCount(groupNumber uint16) (ret uint32) //sys GetMaximumProcessorCount(groupNumber uint16) (ret uint32) //sys EnumWindows(enumFunc uintptr, param unsafe.Pointer) (err error) = user32.EnumWindows @@ -1834,3 +1846,73 @@ func ResizePseudoConsole(pconsole Handle, size Coord) error { // accept arguments that can be casted to uintptr, and Coord can't. return resizePseudoConsole(pconsole, *((*uint32)(unsafe.Pointer(&size)))) } + +// DCB constants. See https://learn.microsoft.com/en-us/windows/win32/api/winbase/ns-winbase-dcb. +const ( + CBR_110 = 110 + CBR_300 = 300 + CBR_600 = 600 + CBR_1200 = 1200 + CBR_2400 = 2400 + CBR_4800 = 4800 + CBR_9600 = 9600 + CBR_14400 = 14400 + CBR_19200 = 19200 + CBR_38400 = 38400 + CBR_57600 = 57600 + CBR_115200 = 115200 + CBR_128000 = 128000 + CBR_256000 = 256000 + + DTR_CONTROL_DISABLE = 0x00000000 + DTR_CONTROL_ENABLE = 0x00000010 + DTR_CONTROL_HANDSHAKE = 0x00000020 + + RTS_CONTROL_DISABLE = 0x00000000 + RTS_CONTROL_ENABLE = 0x00001000 + RTS_CONTROL_HANDSHAKE = 0x00002000 + RTS_CONTROL_TOGGLE = 0x00003000 + + NOPARITY = 0 + ODDPARITY = 1 + EVENPARITY = 2 + MARKPARITY = 3 + SPACEPARITY = 4 + + ONESTOPBIT = 0 + ONE5STOPBITS = 1 + TWOSTOPBITS = 2 +) + +// EscapeCommFunction constants. See https://learn.microsoft.com/en-us/windows/win32/api/winbase/nf-winbase-escapecommfunction. +const ( + SETXOFF = 1 + SETXON = 2 + SETRTS = 3 + CLRRTS = 4 + SETDTR = 5 + CLRDTR = 6 + SETBREAK = 8 + CLRBREAK = 9 +) + +// PurgeComm constants. See https://learn.microsoft.com/en-us/windows/win32/api/winbase/nf-winbase-purgecomm. +const ( + PURGE_TXABORT = 0x0001 + PURGE_RXABORT = 0x0002 + PURGE_TXCLEAR = 0x0004 + PURGE_RXCLEAR = 0x0008 +) + +// SetCommMask constants. See https://learn.microsoft.com/en-us/windows/win32/api/winbase/nf-winbase-setcommmask. +const ( + EV_RXCHAR = 0x0001 + EV_RXFLAG = 0x0002 + EV_TXEMPTY = 0x0004 + EV_CTS = 0x0008 + EV_DSR = 0x0010 + EV_RLSD = 0x0020 + EV_BREAK = 0x0040 + EV_ERR = 0x0080 + EV_RING = 0x0100 +) diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 359780f..d8cb71d 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -3380,3 +3380,27 @@ type BLOB struct { Size uint32 BlobData *byte } + +type ComStat struct { + Flags uint32 + CBInQue uint32 + CBOutQue uint32 +} + +type DCB struct { + DCBlength uint32 + BaudRate uint32 + Flags uint32 + wReserved uint16 + XonLim uint16 + XoffLim uint16 + ByteSize uint8 + Parity uint8 + StopBits uint8 + XonChar byte + XoffChar byte + ErrorChar byte + EofChar byte + EvtChar byte + wReserved1 uint16 +} diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index e8791c8..5c6035d 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -188,6 +188,8 @@ var ( procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") procCancelIoEx = modkernel32.NewProc("CancelIoEx") + procClearCommBreak = modkernel32.NewProc("ClearCommBreak") + procClearCommError = modkernel32.NewProc("ClearCommError") procCloseHandle = modkernel32.NewProc("CloseHandle") procClosePseudoConsole = modkernel32.NewProc("ClosePseudoConsole") procConnectNamedPipe = modkernel32.NewProc("ConnectNamedPipe") @@ -212,7 +214,9 @@ var ( procDeleteProcThreadAttributeList = modkernel32.NewProc("DeleteProcThreadAttributeList") procDeleteVolumeMountPointW = modkernel32.NewProc("DeleteVolumeMountPointW") procDeviceIoControl = modkernel32.NewProc("DeviceIoControl") + procDisconnectNamedPipe = modkernel32.NewProc("DisconnectNamedPipe") procDuplicateHandle = modkernel32.NewProc("DuplicateHandle") + procEscapeCommFunction = modkernel32.NewProc("EscapeCommFunction") procExitProcess = modkernel32.NewProc("ExitProcess") procExpandEnvironmentStringsW = modkernel32.NewProc("ExpandEnvironmentStringsW") procFindClose = modkernel32.NewProc("FindClose") @@ -236,6 +240,8 @@ var ( procGenerateConsoleCtrlEvent = modkernel32.NewProc("GenerateConsoleCtrlEvent") procGetACP = modkernel32.NewProc("GetACP") procGetActiveProcessorCount = modkernel32.NewProc("GetActiveProcessorCount") + procGetCommModemStatus = modkernel32.NewProc("GetCommModemStatus") + procGetCommState = modkernel32.NewProc("GetCommState") procGetCommTimeouts = modkernel32.NewProc("GetCommTimeouts") procGetCommandLineW = modkernel32.NewProc("GetCommandLineW") procGetComputerNameExW = modkernel32.NewProc("GetComputerNameExW") @@ -322,6 +328,7 @@ var ( procProcess32NextW = modkernel32.NewProc("Process32NextW") procProcessIdToSessionId = modkernel32.NewProc("ProcessIdToSessionId") procPulseEvent = modkernel32.NewProc("PulseEvent") + procPurgeComm = modkernel32.NewProc("PurgeComm") procQueryDosDeviceW = modkernel32.NewProc("QueryDosDeviceW") procQueryFullProcessImageNameW = modkernel32.NewProc("QueryFullProcessImageNameW") procQueryInformationJobObject = modkernel32.NewProc("QueryInformationJobObject") @@ -335,6 +342,9 @@ var ( procResetEvent = modkernel32.NewProc("ResetEvent") procResizePseudoConsole = modkernel32.NewProc("ResizePseudoConsole") procResumeThread = modkernel32.NewProc("ResumeThread") + procSetCommBreak = modkernel32.NewProc("SetCommBreak") + procSetCommMask = modkernel32.NewProc("SetCommMask") + procSetCommState = modkernel32.NewProc("SetCommState") procSetCommTimeouts = modkernel32.NewProc("SetCommTimeouts") procSetConsoleCursorPosition = modkernel32.NewProc("SetConsoleCursorPosition") procSetConsoleMode = modkernel32.NewProc("SetConsoleMode") @@ -342,7 +352,6 @@ var ( procSetDefaultDllDirectories = modkernel32.NewProc("SetDefaultDllDirectories") procSetDllDirectoryW = modkernel32.NewProc("SetDllDirectoryW") procSetEndOfFile = modkernel32.NewProc("SetEndOfFile") - procSetFileValidData = modkernel32.NewProc("SetFileValidData") procSetEnvironmentVariableW = modkernel32.NewProc("SetEnvironmentVariableW") procSetErrorMode = modkernel32.NewProc("SetErrorMode") procSetEvent = modkernel32.NewProc("SetEvent") @@ -351,6 +360,7 @@ var ( procSetFileInformationByHandle = modkernel32.NewProc("SetFileInformationByHandle") procSetFilePointer = modkernel32.NewProc("SetFilePointer") procSetFileTime = modkernel32.NewProc("SetFileTime") + procSetFileValidData = modkernel32.NewProc("SetFileValidData") procSetHandleInformation = modkernel32.NewProc("SetHandleInformation") procSetInformationJobObject = modkernel32.NewProc("SetInformationJobObject") procSetNamedPipeHandleState = modkernel32.NewProc("SetNamedPipeHandleState") @@ -361,6 +371,7 @@ var ( procSetStdHandle = modkernel32.NewProc("SetStdHandle") procSetVolumeLabelW = modkernel32.NewProc("SetVolumeLabelW") procSetVolumeMountPointW = modkernel32.NewProc("SetVolumeMountPointW") + procSetupComm = modkernel32.NewProc("SetupComm") procSizeofResource = modkernel32.NewProc("SizeofResource") procSleepEx = modkernel32.NewProc("SleepEx") procTerminateJobObject = modkernel32.NewProc("TerminateJobObject") @@ -379,6 +390,7 @@ var ( procVirtualQueryEx = modkernel32.NewProc("VirtualQueryEx") procVirtualUnlock = modkernel32.NewProc("VirtualUnlock") procWTSGetActiveConsoleSessionId = modkernel32.NewProc("WTSGetActiveConsoleSessionId") + procWaitCommEvent = modkernel32.NewProc("WaitCommEvent") procWaitForMultipleObjects = modkernel32.NewProc("WaitForMultipleObjects") procWaitForSingleObject = modkernel32.NewProc("WaitForSingleObject") procWriteConsoleW = modkernel32.NewProc("WriteConsoleW") @@ -1641,6 +1653,22 @@ func CancelIoEx(s Handle, o *Overlapped) (err error) { return } +func ClearCommBreak(handle Handle) (err error) { + r1, _, e1 := syscall.Syscall(procClearCommBreak.Addr(), 1, uintptr(handle), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + +func ClearCommError(handle Handle, lpErrors *uint32, lpStat *ComStat) (err error) { + r1, _, e1 := syscall.Syscall(procClearCommError.Addr(), 3, uintptr(handle), uintptr(unsafe.Pointer(lpErrors)), uintptr(unsafe.Pointer(lpStat))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func CloseHandle(handle Handle) (err error) { r1, _, e1 := syscall.Syscall(procCloseHandle.Addr(), 1, uintptr(handle), 0, 0) if r1 == 0 { @@ -1845,6 +1873,14 @@ func DeviceIoControl(handle Handle, ioControlCode uint32, inBuffer *byte, inBuff return } +func DisconnectNamedPipe(pipe Handle) (err error) { + r1, _, e1 := syscall.Syscall(procDisconnectNamedPipe.Addr(), 1, uintptr(pipe), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) { var _p0 uint32 if bInheritHandle { @@ -1857,6 +1893,14 @@ func DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetP return } +func EscapeCommFunction(handle Handle, dwFunc uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEscapeCommFunction.Addr(), 2, uintptr(handle), uintptr(dwFunc), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ExitProcess(exitcode uint32) { syscall.Syscall(procExitProcess.Addr(), 1, uintptr(exitcode), 0, 0) return @@ -2058,6 +2102,22 @@ func GetActiveProcessorCount(groupNumber uint16) (ret uint32) { return } +func GetCommModemStatus(handle Handle, lpModemStat *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procGetCommModemStatus.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(lpModemStat)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + +func GetCommState(handle Handle, lpDCB *DCB) (err error) { + r1, _, e1 := syscall.Syscall(procGetCommState.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(lpDCB)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) { r1, _, e1 := syscall.Syscall(procGetCommTimeouts.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(timeouts)), 0) if r1 == 0 { @@ -2810,6 +2870,14 @@ func PulseEvent(event Handle) (err error) { return } +func PurgeComm(handle Handle, dwFlags uint32) (err error) { + r1, _, e1 := syscall.Syscall(procPurgeComm.Addr(), 2, uintptr(handle), uintptr(dwFlags), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func QueryDosDevice(deviceName *uint16, targetPath *uint16, max uint32) (n uint32, err error) { r0, _, e1 := syscall.Syscall(procQueryDosDeviceW.Addr(), 3, uintptr(unsafe.Pointer(deviceName)), uintptr(unsafe.Pointer(targetPath)), uintptr(max)) n = uint32(r0) @@ -2924,6 +2992,30 @@ func ResumeThread(thread Handle) (ret uint32, err error) { return } +func SetCommBreak(handle Handle) (err error) { + r1, _, e1 := syscall.Syscall(procSetCommBreak.Addr(), 1, uintptr(handle), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + +func SetCommMask(handle Handle, dwEvtMask uint32) (err error) { + r1, _, e1 := syscall.Syscall(procSetCommMask.Addr(), 2, uintptr(handle), uintptr(dwEvtMask), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + +func SetCommState(handle Handle, lpDCB *DCB) (err error) { + r1, _, e1 := syscall.Syscall(procSetCommState.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(lpDCB)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func SetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) { r1, _, e1 := syscall.Syscall(procSetCommTimeouts.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(timeouts)), 0) if r1 == 0 { @@ -2989,14 +3081,6 @@ func SetEndOfFile(handle Handle) (err error) { return } -func SetFileValidData(handle Handle, validDataLength int64) (err error) { - r1, _, e1 := syscall.Syscall(procSetFileValidData.Addr(), 2, uintptr(handle), uintptr(validDataLength), 0) - if r1 == 0 { - err = errnoErr(e1) - } - return -} - func SetEnvironmentVariable(name *uint16, value *uint16) (err error) { r1, _, e1 := syscall.Syscall(procSetEnvironmentVariableW.Addr(), 2, uintptr(unsafe.Pointer(name)), uintptr(unsafe.Pointer(value)), 0) if r1 == 0 { @@ -3060,6 +3144,14 @@ func SetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetim return } +func SetFileValidData(handle Handle, validDataLength int64) (err error) { + r1, _, e1 := syscall.Syscall(procSetFileValidData.Addr(), 2, uintptr(handle), uintptr(validDataLength), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func SetHandleInformation(handle Handle, mask uint32, flags uint32) (err error) { r1, _, e1 := syscall.Syscall(procSetHandleInformation.Addr(), 3, uintptr(handle), uintptr(mask), uintptr(flags)) if r1 == 0 { @@ -3145,6 +3237,14 @@ func SetVolumeMountPoint(volumeMountPoint *uint16, volumeName *uint16) (err erro return } +func SetupComm(handle Handle, dwInQueue uint32, dwOutQueue uint32) (err error) { + r1, _, e1 := syscall.Syscall(procSetupComm.Addr(), 3, uintptr(handle), uintptr(dwInQueue), uintptr(dwOutQueue)) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func SizeofResource(module Handle, resInfo Handle) (size uint32, err error) { r0, _, e1 := syscall.Syscall(procSizeofResource.Addr(), 2, uintptr(module), uintptr(resInfo), 0) size = uint32(r0) @@ -3291,6 +3391,14 @@ func WTSGetActiveConsoleSessionId() (sessionID uint32) { return } +func WaitCommEvent(handle Handle, lpEvtMask *uint32, lpOverlapped *Overlapped) (err error) { + r1, _, e1 := syscall.Syscall(procWaitCommEvent.Addr(), 3, uintptr(handle), uintptr(unsafe.Pointer(lpEvtMask)), uintptr(unsafe.Pointer(lpOverlapped))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func waitForMultipleObjects(count uint32, handles uintptr, waitAll bool, waitMilliseconds uint32) (event uint32, err error) { var _p0 uint32 if waitAll { diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go index 03543bd..137cc8d 100644 --- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go +++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go @@ -47,7 +47,7 @@ import ( func Find(importPath, srcDir string) (filename, path string) { cmd := exec.Command("go", "list", "-json", "-export", "--", importPath) cmd.Dir = srcDir - out, err := cmd.CombinedOutput() + out, err := cmd.Output() if err != nil { return "", "" } diff --git a/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go b/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go index 18a002f..333676b 100644 --- a/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go +++ b/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go @@ -8,42 +8,46 @@ package packagesdriver import ( "context" "fmt" - "go/types" "strings" "golang.org/x/tools/internal/gocommand" ) -var debug = false - -func GetSizesGolist(ctx context.Context, inv gocommand.Invocation, gocmdRunner *gocommand.Runner) (types.Sizes, error) { +func GetSizesForArgsGolist(ctx context.Context, inv gocommand.Invocation, gocmdRunner *gocommand.Runner) (string, string, error) { inv.Verb = "list" inv.Args = []string{"-f", "{{context.GOARCH}} {{context.Compiler}}", "--", "unsafe"} stdout, stderr, friendlyErr, rawErr := gocmdRunner.RunRaw(ctx, inv) var goarch, compiler string if rawErr != nil { - if rawErrMsg := rawErr.Error(); strings.Contains(rawErrMsg, "cannot find main module") || strings.Contains(rawErrMsg, "go.mod file not found") { - // User's running outside of a module. All bets are off. Get GOARCH and guess compiler is gc. + rawErrMsg := rawErr.Error() + if strings.Contains(rawErrMsg, "cannot find main module") || + strings.Contains(rawErrMsg, "go.mod file not found") { + // User's running outside of a module. + // All bets are off. Get GOARCH and guess compiler is gc. // TODO(matloob): Is this a problem in practice? inv.Verb = "env" inv.Args = []string{"GOARCH"} envout, enverr := gocmdRunner.Run(ctx, inv) if enverr != nil { - return nil, enverr + return "", "", enverr } goarch = strings.TrimSpace(envout.String()) compiler = "gc" + } else if friendlyErr != nil { + return "", "", friendlyErr } else { - return nil, friendlyErr + // This should be unreachable, but be defensive + // in case RunRaw's error results are inconsistent. + return "", "", rawErr } } else { fields := strings.Fields(stdout.String()) if len(fields) < 2 { - return nil, fmt.Errorf("could not parse GOARCH and Go compiler in format \" \":\nstdout: <<%s>>\nstderr: <<%s>>", + return "", "", fmt.Errorf("could not parse GOARCH and Go compiler in format \" \":\nstdout: <<%s>>\nstderr: <<%s>>", stdout.String(), stderr.String()) } goarch = fields[0] compiler = fields[1] } - return types.SizesFor(compiler, goarch), nil + return compiler, goarch, nil } diff --git a/vendor/golang.org/x/tools/go/packages/doc.go b/vendor/golang.org/x/tools/go/packages/doc.go index da4ab89..a8d7b06 100644 --- a/vendor/golang.org/x/tools/go/packages/doc.go +++ b/vendor/golang.org/x/tools/go/packages/doc.go @@ -5,12 +5,20 @@ /* Package packages loads Go packages for inspection and analysis. -The Load function takes as input a list of patterns and return a list of Package -structs describing individual packages matched by those patterns. -The LoadMode controls the amount of detail in the loaded packages. - -Load passes most patterns directly to the underlying build tool, -but all patterns with the prefix "query=", where query is a +The [Load] function takes as input a list of patterns and returns a +list of [Package] values describing individual packages matched by those +patterns. +A [Config] specifies configuration options, the most important of which is +the [LoadMode], which controls the amount of detail in the loaded packages. + +Load passes most patterns directly to the underlying build tool. +The default build tool is the go command. +Its supported patterns are described at +https://pkg.go.dev/cmd/go#hdr-Package_lists_and_patterns. +Other build systems may be supported by providing a "driver"; +see [The driver protocol]. + +All patterns with the prefix "query=", where query is a non-empty string of letters from [a-z], are reserved and may be interpreted as query operators. @@ -35,7 +43,7 @@ The Package struct provides basic information about the package, including - Imports, a map from source import strings to the Packages they name; - Types, the type information for the package's exported symbols; - Syntax, the parsed syntax trees for the package's source code; and - - TypeInfo, the result of a complete type-check of the package syntax trees. + - TypesInfo, the result of a complete type-check of the package syntax trees. (See the documentation for type Package for the complete list of fields and more detailed descriptions.) @@ -64,9 +72,31 @@ reported about the loaded packages. See the documentation for type LoadMode for details. Most tools should pass their command-line arguments (after any flags) -uninterpreted to the loader, so that the loader can interpret them +uninterpreted to [Load], so that it can interpret them according to the conventions of the underlying build system. + See the Example function for typical usage. + +# The driver protocol + +[Load] may be used to load Go packages even in Go projects that use +alternative build systems, by installing an appropriate "driver" +program for the build system and specifying its location in the +GOPACKAGESDRIVER environment variable. +For example, +https://github.com/bazelbuild/rules_go/wiki/Editor-and-tool-integration +explains how to use the driver for Bazel. + +The driver program is responsible for interpreting patterns in its +preferred notation and reporting information about the packages that +those patterns identify. Drivers must also support the special "file=" +and "pattern=" patterns described above. + +The patterns are provided as positional command-line arguments. A +JSON-encoded [DriverRequest] message providing additional information +is written to the driver's standard input. The driver must write a +JSON-encoded [DriverResponse] message to its standard output. (This +message differs from the JSON schema produced by 'go list'.) */ package packages // import "golang.org/x/tools/go/packages" diff --git a/vendor/golang.org/x/tools/go/packages/external.go b/vendor/golang.org/x/tools/go/packages/external.go index 7242a0a..4335c1e 100644 --- a/vendor/golang.org/x/tools/go/packages/external.go +++ b/vendor/golang.org/x/tools/go/packages/external.go @@ -2,46 +2,85 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// This file enables an external tool to intercept package requests. -// If the tool is present then its results are used in preference to -// the go list command. - package packages +// This file defines the protocol that enables an external "driver" +// tool to supply package metadata in place of 'go list'. + import ( "bytes" "encoding/json" "fmt" - exec "golang.org/x/sys/execabs" "os" + "os/exec" "strings" ) -// The Driver Protocol +// DriverRequest defines the schema of a request for package metadata +// from an external driver program. The JSON-encoded DriverRequest +// message is provided to the driver program's standard input. The +// query patterns are provided as command-line arguments. // -// The driver, given the inputs to a call to Load, returns metadata about the packages specified. -// This allows for different build systems to support go/packages by telling go/packages how the -// packages' source is organized. -// The driver is a binary, either specified by the GOPACKAGESDRIVER environment variable or in -// the path as gopackagesdriver. It's given the inputs to load in its argv. See the package -// documentation in doc.go for the full description of the patterns that need to be supported. -// A driver receives as a JSON-serialized driverRequest struct in standard input and will -// produce a JSON-serialized driverResponse (see definition in packages.go) in its standard output. - -// driverRequest is used to provide the portion of Load's Config that is needed by a driver. -type driverRequest struct { +// See the package documentation for an overview. +type DriverRequest struct { Mode LoadMode `json:"mode"` + // Env specifies the environment the underlying build system should be run in. Env []string `json:"env"` + // BuildFlags are flags that should be passed to the underlying build system. BuildFlags []string `json:"build_flags"` + // Tests specifies whether the patterns should also return test packages. Tests bool `json:"tests"` + // Overlay maps file paths (relative to the driver's working directory) to the byte contents // of overlay files. Overlay map[string][]byte `json:"overlay"` } +// DriverResponse defines the schema of a response from an external +// driver program, providing the results of a query for package +// metadata. The driver program must write a JSON-encoded +// DriverResponse message to its standard output. +// +// See the package documentation for an overview. +type DriverResponse struct { + // NotHandled is returned if the request can't be handled by the current + // driver. If an external driver returns a response with NotHandled, the + // rest of the DriverResponse is ignored, and go/packages will fallback + // to the next driver. If go/packages is extended in the future to support + // lists of multiple drivers, go/packages will fall back to the next driver. + NotHandled bool + + // Compiler and Arch are the arguments pass of types.SizesFor + // to get a types.Sizes to use when type checking. + Compiler string + Arch string + + // Roots is the set of package IDs that make up the root packages. + // We have to encode this separately because when we encode a single package + // we cannot know if it is one of the roots as that requires knowledge of the + // graph it is part of. + Roots []string `json:",omitempty"` + + // Packages is the full set of packages in the graph. + // The packages are not connected into a graph. + // The Imports if populated will be stubs that only have their ID set. + // Imports will be connected and then type and syntax information added in a + // later pass (see refine). + Packages []*Package + + // GoVersion is the minor version number used by the driver + // (e.g. the go command on the PATH) when selecting .go files. + // Zero means unknown. + GoVersion int +} + +// driver is the type for functions that query the build system for the +// packages named by the patterns. +type driver func(cfg *Config, patterns ...string) (*DriverResponse, error) + // findExternalDriver returns the file path of a tool that supplies // the build system package structure, or "" if not found." // If GOPACKAGESDRIVER is set in the environment findExternalTool returns its @@ -64,8 +103,8 @@ func findExternalDriver(cfg *Config) driver { return nil } } - return func(cfg *Config, words ...string) (*driverResponse, error) { - req, err := json.Marshal(driverRequest{ + return func(cfg *Config, words ...string) (*DriverResponse, error) { + req, err := json.Marshal(DriverRequest{ Mode: cfg.Mode, Env: cfg.Env, BuildFlags: cfg.BuildFlags, @@ -92,7 +131,7 @@ func findExternalDriver(cfg *Config) driver { fmt.Fprintf(os.Stderr, "%s stderr: <<%s>>\n", cmdDebugStr(cmd), stderr) } - var response driverResponse + var response DriverResponse if err := json.Unmarshal(buf.Bytes(), &response); err != nil { return nil, err } diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index e84f19d..22305d9 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -9,10 +9,9 @@ import ( "context" "encoding/json" "fmt" - "go/types" - "io/ioutil" "log" "os" + "os/exec" "path" "path/filepath" "reflect" @@ -22,7 +21,6 @@ import ( "sync" "unicode" - exec "golang.org/x/sys/execabs" "golang.org/x/tools/go/internal/packagesdriver" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/packagesinternal" @@ -37,23 +35,23 @@ type goTooOldError struct { error } -// responseDeduper wraps a driverResponse, deduplicating its contents. +// responseDeduper wraps a DriverResponse, deduplicating its contents. type responseDeduper struct { seenRoots map[string]bool seenPackages map[string]*Package - dr *driverResponse + dr *DriverResponse } func newDeduper() *responseDeduper { return &responseDeduper{ - dr: &driverResponse{}, + dr: &DriverResponse{}, seenRoots: map[string]bool{}, seenPackages: map[string]*Package{}, } } -// addAll fills in r with a driverResponse. -func (r *responseDeduper) addAll(dr *driverResponse) { +// addAll fills in r with a DriverResponse. +func (r *responseDeduper) addAll(dr *DriverResponse) { for _, pkg := range dr.Packages { r.addPackage(pkg) } @@ -130,7 +128,7 @@ func (state *golistState) mustGetEnv() map[string]string { // goListDriver uses the go list command to interpret the patterns and produce // the build system package structure. // See driver for more details. -func goListDriver(cfg *Config, patterns ...string) (*driverResponse, error) { +func goListDriver(cfg *Config, patterns ...string) (_ *DriverResponse, err error) { // Make sure that any asynchronous go commands are killed when we return. parentCtx := cfg.Context if parentCtx == nil { @@ -148,16 +146,18 @@ func goListDriver(cfg *Config, patterns ...string) (*driverResponse, error) { } // Fill in response.Sizes asynchronously if necessary. - var sizeserr error - var sizeswg sync.WaitGroup if cfg.Mode&NeedTypesSizes != 0 || cfg.Mode&NeedTypes != 0 { - sizeswg.Add(1) + errCh := make(chan error) go func() { - var sizes types.Sizes - sizes, sizeserr = packagesdriver.GetSizesGolist(ctx, state.cfgInvocation(), cfg.gocmdRunner) - // types.SizesFor always returns nil or a *types.StdSizes. - response.dr.Sizes, _ = sizes.(*types.StdSizes) - sizeswg.Done() + compiler, arch, err := packagesdriver.GetSizesForArgsGolist(ctx, state.cfgInvocation(), cfg.gocmdRunner) + response.dr.Compiler = compiler + response.dr.Arch = arch + errCh <- err + }() + defer func() { + if sizesErr := <-errCh; sizesErr != nil { + err = sizesErr + } }() } @@ -210,87 +210,10 @@ extractQueries: } } - // Only use go/packages' overlay processing if we're using a Go version - // below 1.16. Otherwise, go list handles it. - if goVersion, err := state.getGoVersion(); err == nil && goVersion < 16 { - modifiedPkgs, needPkgs, err := state.processGolistOverlay(response) - if err != nil { - return nil, err - } - - var containsCandidates []string - if len(containFiles) > 0 { - containsCandidates = append(containsCandidates, modifiedPkgs...) - containsCandidates = append(containsCandidates, needPkgs...) - } - if err := state.addNeededOverlayPackages(response, needPkgs); err != nil { - return nil, err - } - // Check candidate packages for containFiles. - if len(containFiles) > 0 { - for _, id := range containsCandidates { - pkg, ok := response.seenPackages[id] - if !ok { - response.addPackage(&Package{ - ID: id, - Errors: []Error{{ - Kind: ListError, - Msg: fmt.Sprintf("package %s expected but not seen", id), - }}, - }) - continue - } - for _, f := range containFiles { - for _, g := range pkg.GoFiles { - if sameFile(f, g) { - response.addRoot(id) - } - } - } - } - } - // Add root for any package that matches a pattern. This applies only to - // packages that are modified by overlays, since they are not added as - // roots automatically. - for _, pattern := range restPatterns { - match := matchPattern(pattern) - for _, pkgID := range modifiedPkgs { - pkg, ok := response.seenPackages[pkgID] - if !ok { - continue - } - if match(pkg.PkgPath) { - response.addRoot(pkg.ID) - } - } - } - } - - sizeswg.Wait() - if sizeserr != nil { - return nil, sizeserr - } + // (We may yet return an error due to defer.) return response.dr, nil } -func (state *golistState) addNeededOverlayPackages(response *responseDeduper, pkgs []string) error { - if len(pkgs) == 0 { - return nil - } - dr, err := state.createDriverResponse(pkgs...) - if err != nil { - return err - } - for _, pkg := range dr.Packages { - response.addPackage(pkg) - } - _, needPkgs, err := state.processGolistOverlay(response) - if err != nil { - return err - } - return state.addNeededOverlayPackages(response, needPkgs) -} - func (state *golistState) runContainsQueries(response *responseDeduper, queries []string) error { for _, query := range queries { // TODO(matloob): Do only one query per directory. @@ -342,7 +265,7 @@ func (state *golistState) runContainsQueries(response *responseDeduper, queries // adhocPackage attempts to load or construct an ad-hoc package for a given // query, if the original call to the driver produced inadequate results. -func (state *golistState) adhocPackage(pattern, query string) (*driverResponse, error) { +func (state *golistState) adhocPackage(pattern, query string) (*DriverResponse, error) { response, err := state.createDriverResponse(query) if err != nil { return nil, err @@ -433,7 +356,7 @@ func otherFiles(p *jsonPackage) [][]string { // createDriverResponse uses the "go list" command to expand the pattern // words and return a response for the specified packages. -func (state *golistState) createDriverResponse(words ...string) (*driverResponse, error) { +func (state *golistState) createDriverResponse(words ...string) (*DriverResponse, error) { // go list uses the following identifiers in ImportPath and Imports: // // "p" -- importable package or main (command) @@ -460,7 +383,7 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse pkgs := make(map[string]*Package) additionalErrors := make(map[string][]Error) // Decode the JSON and convert it to Package form. - response := &driverResponse{ + response := &DriverResponse{ GoVersion: goVersion, } for dec := json.NewDecoder(buf); dec.More(); { @@ -671,6 +594,9 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse // Temporary work-around for golang/go#39986. Parse filenames out of // error messages. This happens if there are unrecoverable syntax // errors in the source, so we can't match on a specific error message. + // + // TODO(rfindley): remove this heuristic, in favor of considering + // InvalidGoFiles from the list driver. if err := p.Error; err != nil && state.shouldAddFilenameFromError(p) { addFilenameFromPos := func(pos string) bool { split := strings.Split(pos, ":") @@ -1107,7 +1033,7 @@ func (state *golistState) writeOverlays() (filename string, cleanup func(), err if len(state.cfg.Overlay) == 0 { return "", func() {}, nil } - dir, err := ioutil.TempDir("", "gopackages-*") + dir, err := os.MkdirTemp("", "gopackages-*") if err != nil { return "", nil, err } @@ -1126,7 +1052,7 @@ func (state *golistState) writeOverlays() (filename string, cleanup func(), err // Create a unique filename for the overlaid files, to avoid // creating nested directories. noSeparator := strings.Join(strings.Split(filepath.ToSlash(k), "/"), "") - f, err := ioutil.TempFile(dir, fmt.Sprintf("*-%s", noSeparator)) + f, err := os.CreateTemp(dir, fmt.Sprintf("*-%s", noSeparator)) if err != nil { return "", func() {}, err } @@ -1144,7 +1070,7 @@ func (state *golistState) writeOverlays() (filename string, cleanup func(), err } // Write out the overlay file that contains the filepath mappings. filename = filepath.Join(dir, "overlay.json") - if err := ioutil.WriteFile(filename, b, 0665); err != nil { + if err := os.WriteFile(filename, b, 0665); err != nil { return "", func() {}, err } return filename, cleanup, nil diff --git a/vendor/golang.org/x/tools/go/packages/golist_overlay.go b/vendor/golang.org/x/tools/go/packages/golist_overlay.go index 9576b47..d823c47 100644 --- a/vendor/golang.org/x/tools/go/packages/golist_overlay.go +++ b/vendor/golang.org/x/tools/go/packages/golist_overlay.go @@ -6,314 +6,11 @@ package packages import ( "encoding/json" - "fmt" - "go/parser" - "go/token" - "os" "path/filepath" - "regexp" - "sort" - "strconv" - "strings" "golang.org/x/tools/internal/gocommand" ) -// processGolistOverlay provides rudimentary support for adding -// files that don't exist on disk to an overlay. The results can be -// sometimes incorrect. -// TODO(matloob): Handle unsupported cases, including the following: -// - determining the correct package to add given a new import path -func (state *golistState) processGolistOverlay(response *responseDeduper) (modifiedPkgs, needPkgs []string, err error) { - havePkgs := make(map[string]string) // importPath -> non-test package ID - needPkgsSet := make(map[string]bool) - modifiedPkgsSet := make(map[string]bool) - - pkgOfDir := make(map[string][]*Package) - for _, pkg := range response.dr.Packages { - // This is an approximation of import path to id. This can be - // wrong for tests, vendored packages, and a number of other cases. - havePkgs[pkg.PkgPath] = pkg.ID - dir, err := commonDir(pkg.GoFiles) - if err != nil { - return nil, nil, err - } - if dir != "" { - pkgOfDir[dir] = append(pkgOfDir[dir], pkg) - } - } - - // If no new imports are added, it is safe to avoid loading any needPkgs. - // Otherwise, it's hard to tell which package is actually being loaded - // (due to vendoring) and whether any modified package will show up - // in the transitive set of dependencies (because new imports are added, - // potentially modifying the transitive set of dependencies). - var overlayAddsImports bool - - // If both a package and its test package are created by the overlay, we - // need the real package first. Process all non-test files before test - // files, and make the whole process deterministic while we're at it. - var overlayFiles []string - for opath := range state.cfg.Overlay { - overlayFiles = append(overlayFiles, opath) - } - sort.Slice(overlayFiles, func(i, j int) bool { - iTest := strings.HasSuffix(overlayFiles[i], "_test.go") - jTest := strings.HasSuffix(overlayFiles[j], "_test.go") - if iTest != jTest { - return !iTest // non-tests are before tests. - } - return overlayFiles[i] < overlayFiles[j] - }) - for _, opath := range overlayFiles { - contents := state.cfg.Overlay[opath] - base := filepath.Base(opath) - dir := filepath.Dir(opath) - var pkg *Package // if opath belongs to both a package and its test variant, this will be the test variant - var testVariantOf *Package // if opath is a test file, this is the package it is testing - var fileExists bool - isTestFile := strings.HasSuffix(opath, "_test.go") - pkgName, ok := extractPackageName(opath, contents) - if !ok { - // Don't bother adding a file that doesn't even have a parsable package statement - // to the overlay. - continue - } - // If all the overlay files belong to a different package, change the - // package name to that package. - maybeFixPackageName(pkgName, isTestFile, pkgOfDir[dir]) - nextPackage: - for _, p := range response.dr.Packages { - if pkgName != p.Name && p.ID != "command-line-arguments" { - continue - } - for _, f := range p.GoFiles { - if !sameFile(filepath.Dir(f), dir) { - continue - } - // Make sure to capture information on the package's test variant, if needed. - if isTestFile && !hasTestFiles(p) { - // TODO(matloob): Are there packages other than the 'production' variant - // of a package that this can match? This shouldn't match the test main package - // because the file is generated in another directory. - testVariantOf = p - continue nextPackage - } else if !isTestFile && hasTestFiles(p) { - // We're examining a test variant, but the overlaid file is - // a non-test file. Because the overlay implementation - // (currently) only adds a file to one package, skip this - // package, so that we can add the file to the production - // variant of the package. (https://golang.org/issue/36857 - // tracks handling overlays on both the production and test - // variant of a package). - continue nextPackage - } - if pkg != nil && p != pkg && pkg.PkgPath == p.PkgPath { - // We have already seen the production version of the - // for which p is a test variant. - if hasTestFiles(p) { - testVariantOf = pkg - } - } - pkg = p - if filepath.Base(f) == base { - fileExists = true - } - } - } - // The overlay could have included an entirely new package or an - // ad-hoc package. An ad-hoc package is one that we have manually - // constructed from inadequate `go list` results for a file= query. - // It will have the ID command-line-arguments. - if pkg == nil || pkg.ID == "command-line-arguments" { - // Try to find the module or gopath dir the file is contained in. - // Then for modules, add the module opath to the beginning. - pkgPath, ok, err := state.getPkgPath(dir) - if err != nil { - return nil, nil, err - } - if !ok { - break - } - var forTest string // only set for x tests - isXTest := strings.HasSuffix(pkgName, "_test") - if isXTest { - forTest = pkgPath - pkgPath += "_test" - } - id := pkgPath - if isTestFile { - if isXTest { - id = fmt.Sprintf("%s [%s.test]", pkgPath, forTest) - } else { - id = fmt.Sprintf("%s [%s.test]", pkgPath, pkgPath) - } - } - if pkg != nil { - // TODO(rstambler): We should change the package's path and ID - // here. The only issue is that this messes with the roots. - } else { - // Try to reclaim a package with the same ID, if it exists in the response. - for _, p := range response.dr.Packages { - if reclaimPackage(p, id, opath, contents) { - pkg = p - break - } - } - // Otherwise, create a new package. - if pkg == nil { - pkg = &Package{ - PkgPath: pkgPath, - ID: id, - Name: pkgName, - Imports: make(map[string]*Package), - } - response.addPackage(pkg) - havePkgs[pkg.PkgPath] = id - // Add the production package's sources for a test variant. - if isTestFile && !isXTest && testVariantOf != nil { - pkg.GoFiles = append(pkg.GoFiles, testVariantOf.GoFiles...) - pkg.CompiledGoFiles = append(pkg.CompiledGoFiles, testVariantOf.CompiledGoFiles...) - // Add the package under test and its imports to the test variant. - pkg.forTest = testVariantOf.PkgPath - for k, v := range testVariantOf.Imports { - pkg.Imports[k] = &Package{ID: v.ID} - } - } - if isXTest { - pkg.forTest = forTest - } - } - } - } - if !fileExists { - pkg.GoFiles = append(pkg.GoFiles, opath) - // TODO(matloob): Adding the file to CompiledGoFiles can exhibit the wrong behavior - // if the file will be ignored due to its build tags. - pkg.CompiledGoFiles = append(pkg.CompiledGoFiles, opath) - modifiedPkgsSet[pkg.ID] = true - } - imports, err := extractImports(opath, contents) - if err != nil { - // Let the parser or type checker report errors later. - continue - } - for _, imp := range imports { - // TODO(rstambler): If the package is an x test and the import has - // a test variant, make sure to replace it. - if _, found := pkg.Imports[imp]; found { - continue - } - overlayAddsImports = true - id, ok := havePkgs[imp] - if !ok { - var err error - id, err = state.resolveImport(dir, imp) - if err != nil { - return nil, nil, err - } - } - pkg.Imports[imp] = &Package{ID: id} - // Add dependencies to the non-test variant version of this package as well. - if testVariantOf != nil { - testVariantOf.Imports[imp] = &Package{ID: id} - } - } - } - - // toPkgPath guesses the package path given the id. - toPkgPath := func(sourceDir, id string) (string, error) { - if i := strings.IndexByte(id, ' '); i >= 0 { - return state.resolveImport(sourceDir, id[:i]) - } - return state.resolveImport(sourceDir, id) - } - - // Now that new packages have been created, do another pass to determine - // the new set of missing packages. - for _, pkg := range response.dr.Packages { - for _, imp := range pkg.Imports { - if len(pkg.GoFiles) == 0 { - return nil, nil, fmt.Errorf("cannot resolve imports for package %q with no Go files", pkg.PkgPath) - } - pkgPath, err := toPkgPath(filepath.Dir(pkg.GoFiles[0]), imp.ID) - if err != nil { - return nil, nil, err - } - if _, ok := havePkgs[pkgPath]; !ok { - needPkgsSet[pkgPath] = true - } - } - } - - if overlayAddsImports { - needPkgs = make([]string, 0, len(needPkgsSet)) - for pkg := range needPkgsSet { - needPkgs = append(needPkgs, pkg) - } - } - modifiedPkgs = make([]string, 0, len(modifiedPkgsSet)) - for pkg := range modifiedPkgsSet { - modifiedPkgs = append(modifiedPkgs, pkg) - } - return modifiedPkgs, needPkgs, err -} - -// resolveImport finds the ID of a package given its import path. -// In particular, it will find the right vendored copy when in GOPATH mode. -func (state *golistState) resolveImport(sourceDir, importPath string) (string, error) { - env, err := state.getEnv() - if err != nil { - return "", err - } - if env["GOMOD"] != "" { - return importPath, nil - } - - searchDir := sourceDir - for { - vendorDir := filepath.Join(searchDir, "vendor") - exists, ok := state.vendorDirs[vendorDir] - if !ok { - info, err := os.Stat(vendorDir) - exists = err == nil && info.IsDir() - state.vendorDirs[vendorDir] = exists - } - - if exists { - vendoredPath := filepath.Join(vendorDir, importPath) - if info, err := os.Stat(vendoredPath); err == nil && info.IsDir() { - // We should probably check for .go files here, but shame on anyone who fools us. - path, ok, err := state.getPkgPath(vendoredPath) - if err != nil { - return "", err - } - if ok { - return path, nil - } - } - } - - // We know we've hit the top of the filesystem when we Dir / and get /, - // or C:\ and get C:\, etc. - next := filepath.Dir(searchDir) - if next == searchDir { - break - } - searchDir = next - } - return importPath, nil -} - -func hasTestFiles(p *Package) bool { - for _, f := range p.GoFiles { - if strings.HasSuffix(f, "_test.go") { - return true - } - } - return false -} - // determineRootDirs returns a mapping from absolute directories that could // contain code to their corresponding import path prefixes. func (state *golistState) determineRootDirs() (map[string]string, error) { @@ -384,192 +81,3 @@ func (state *golistState) determineRootDirsGOPATH() (map[string]string, error) { } return m, nil } - -func extractImports(filename string, contents []byte) ([]string, error) { - f, err := parser.ParseFile(token.NewFileSet(), filename, contents, parser.ImportsOnly) // TODO(matloob): reuse fileset? - if err != nil { - return nil, err - } - var res []string - for _, imp := range f.Imports { - quotedPath := imp.Path.Value - path, err := strconv.Unquote(quotedPath) - if err != nil { - return nil, err - } - res = append(res, path) - } - return res, nil -} - -// reclaimPackage attempts to reuse a package that failed to load in an overlay. -// -// If the package has errors and has no Name, GoFiles, or Imports, -// then it's possible that it doesn't yet exist on disk. -func reclaimPackage(pkg *Package, id string, filename string, contents []byte) bool { - // TODO(rstambler): Check the message of the actual error? - // It differs between $GOPATH and module mode. - if pkg.ID != id { - return false - } - if len(pkg.Errors) != 1 { - return false - } - if pkg.Name != "" || pkg.ExportFile != "" { - return false - } - if len(pkg.GoFiles) > 0 || len(pkg.CompiledGoFiles) > 0 || len(pkg.OtherFiles) > 0 { - return false - } - if len(pkg.Imports) > 0 { - return false - } - pkgName, ok := extractPackageName(filename, contents) - if !ok { - return false - } - pkg.Name = pkgName - pkg.Errors = nil - return true -} - -func extractPackageName(filename string, contents []byte) (string, bool) { - // TODO(rstambler): Check the message of the actual error? - // It differs between $GOPATH and module mode. - f, err := parser.ParseFile(token.NewFileSet(), filename, contents, parser.PackageClauseOnly) // TODO(matloob): reuse fileset? - if err != nil { - return "", false - } - return f.Name.Name, true -} - -// commonDir returns the directory that all files are in, "" if files is empty, -// or an error if they aren't in the same directory. -func commonDir(files []string) (string, error) { - seen := make(map[string]bool) - for _, f := range files { - seen[filepath.Dir(f)] = true - } - if len(seen) > 1 { - return "", fmt.Errorf("files (%v) are in more than one directory: %v", files, seen) - } - for k := range seen { - // seen has only one element; return it. - return k, nil - } - return "", nil // no files -} - -// It is possible that the files in the disk directory dir have a different package -// name from newName, which is deduced from the overlays. If they all have a different -// package name, and they all have the same package name, then that name becomes -// the package name. -// It returns true if it changes the package name, false otherwise. -func maybeFixPackageName(newName string, isTestFile bool, pkgsOfDir []*Package) { - names := make(map[string]int) - for _, p := range pkgsOfDir { - names[p.Name]++ - } - if len(names) != 1 { - // some files are in different packages - return - } - var oldName string - for k := range names { - oldName = k - } - if newName == oldName { - return - } - // We might have a case where all of the package names in the directory are - // the same, but the overlay file is for an x test, which belongs to its - // own package. If the x test does not yet exist on disk, we may not yet - // have its package name on disk, but we should not rename the packages. - // - // We use a heuristic to determine if this file belongs to an x test: - // The test file should have a package name whose package name has a _test - // suffix or looks like "newName_test". - maybeXTest := strings.HasPrefix(oldName+"_test", newName) || strings.HasSuffix(newName, "_test") - if isTestFile && maybeXTest { - return - } - for _, p := range pkgsOfDir { - p.Name = newName - } -} - -// This function is copy-pasted from -// https://github.com/golang/go/blob/9706f510a5e2754595d716bd64be8375997311fb/src/cmd/go/internal/search/search.go#L360. -// It should be deleted when we remove support for overlays from go/packages. -// -// NOTE: This does not handle any ./... or ./ style queries, as this function -// doesn't know the working directory. -// -// matchPattern(pattern)(name) reports whether -// name matches pattern. Pattern is a limited glob -// pattern in which '...' means 'any string' and there -// is no other special syntax. -// Unfortunately, there are two special cases. Quoting "go help packages": -// -// First, /... at the end of the pattern can match an empty string, -// so that net/... matches both net and packages in its subdirectories, like net/http. -// Second, any slash-separated pattern element containing a wildcard never -// participates in a match of the "vendor" element in the path of a vendored -// package, so that ./... does not match packages in subdirectories of -// ./vendor or ./mycode/vendor, but ./vendor/... and ./mycode/vendor/... do. -// Note, however, that a directory named vendor that itself contains code -// is not a vendored package: cmd/vendor would be a command named vendor, -// and the pattern cmd/... matches it. -func matchPattern(pattern string) func(name string) bool { - // Convert pattern to regular expression. - // The strategy for the trailing /... is to nest it in an explicit ? expression. - // The strategy for the vendor exclusion is to change the unmatchable - // vendor strings to a disallowed code point (vendorChar) and to use - // "(anything but that codepoint)*" as the implementation of the ... wildcard. - // This is a bit complicated but the obvious alternative, - // namely a hand-written search like in most shell glob matchers, - // is too easy to make accidentally exponential. - // Using package regexp guarantees linear-time matching. - - const vendorChar = "\x00" - - if strings.Contains(pattern, vendorChar) { - return func(name string) bool { return false } - } - - re := regexp.QuoteMeta(pattern) - re = replaceVendor(re, vendorChar) - switch { - case strings.HasSuffix(re, `/`+vendorChar+`/\.\.\.`): - re = strings.TrimSuffix(re, `/`+vendorChar+`/\.\.\.`) + `(/vendor|/` + vendorChar + `/\.\.\.)` - case re == vendorChar+`/\.\.\.`: - re = `(/vendor|/` + vendorChar + `/\.\.\.)` - case strings.HasSuffix(re, `/\.\.\.`): - re = strings.TrimSuffix(re, `/\.\.\.`) + `(/\.\.\.)?` - } - re = strings.ReplaceAll(re, `\.\.\.`, `[^`+vendorChar+`]*`) - - reg := regexp.MustCompile(`^` + re + `$`) - - return func(name string) bool { - if strings.Contains(name, vendorChar) { - return false - } - return reg.MatchString(replaceVendor(name, vendorChar)) - } -} - -// replaceVendor returns the result of replacing -// non-trailing vendor path elements in x with repl. -func replaceVendor(x, repl string) string { - if !strings.Contains(x, "vendor") { - return x - } - elem := strings.Split(x, "/") - for i := 0; i < len(elem)-1; i++ { - if elem[i] == "vendor" { - elem[i] = repl - } - } - return strings.Join(elem, "/") -} diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index 632be72..3ea1b3f 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -9,6 +9,7 @@ package packages import ( "context" "encoding/json" + "errors" "fmt" "go/ast" "go/parser" @@ -16,7 +17,6 @@ import ( "go/token" "go/types" "io" - "io/ioutil" "log" "os" "path/filepath" @@ -25,11 +25,13 @@ import ( "sync" "time" + "golang.org/x/sync/errgroup" + "golang.org/x/tools/go/gcexportdata" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/packagesinternal" - "golang.org/x/tools/internal/typeparams" "golang.org/x/tools/internal/typesinternal" + "golang.org/x/tools/internal/versions" ) // A LoadMode controls the amount of detail to return when loading. @@ -127,9 +129,8 @@ type Config struct { Mode LoadMode // Context specifies the context for the load operation. - // If the context is cancelled, the loader may stop early - // and return an ErrCancelled error. - // If Context is nil, the load cannot be cancelled. + // Cancelling the context may cause [Load] to abort and + // return an error. Context context.Context // Logf is the logger for the config. @@ -207,48 +208,13 @@ type Config struct { Overlay map[string][]byte } -// driver is the type for functions that query the build system for the -// packages named by the patterns. -type driver func(cfg *Config, patterns ...string) (*driverResponse, error) - -// driverResponse contains the results for a driver query. -type driverResponse struct { - // NotHandled is returned if the request can't be handled by the current - // driver. If an external driver returns a response with NotHandled, the - // rest of the driverResponse is ignored, and go/packages will fallback - // to the next driver. If go/packages is extended in the future to support - // lists of multiple drivers, go/packages will fall back to the next driver. - NotHandled bool - - // Sizes, if not nil, is the types.Sizes to use when type checking. - Sizes *types.StdSizes - - // Roots is the set of package IDs that make up the root packages. - // We have to encode this separately because when we encode a single package - // we cannot know if it is one of the roots as that requires knowledge of the - // graph it is part of. - Roots []string `json:",omitempty"` - - // Packages is the full set of packages in the graph. - // The packages are not connected into a graph. - // The Imports if populated will be stubs that only have their ID set. - // Imports will be connected and then type and syntax information added in a - // later pass (see refine). - Packages []*Package - - // GoVersion is the minor version number used by the driver - // (e.g. the go command on the PATH) when selecting .go files. - // Zero means unknown. - GoVersion int -} - // Load loads and returns the Go packages named by the given patterns. // // Config specifies loading options; // nil behaves the same as an empty Config. // -// Load returns an error if any of the patterns was invalid -// as defined by the underlying build system. +// If any of the patterns was invalid as defined by the +// underlying build system, Load returns an error. // It may return an empty list of packages without an error, // for instance for an empty expansion of a valid wildcard. // Errors associated with a particular package are recorded in the @@ -257,31 +223,145 @@ type driverResponse struct { // proceeding with further analysis. The PrintErrors function is // provided for convenient display of all errors. func Load(cfg *Config, patterns ...string) ([]*Package, error) { - l := newLoader(cfg) - response, err := defaultDriver(&l.Config, patterns...) + ld := newLoader(cfg) + response, external, err := defaultDriver(&ld.Config, patterns...) if err != nil { return nil, err } - l.sizes = response.Sizes - return l.refine(response) + + ld.sizes = types.SizesFor(response.Compiler, response.Arch) + if ld.sizes == nil && ld.Config.Mode&(NeedTypes|NeedTypesSizes|NeedTypesInfo) != 0 { + // Type size information is needed but unavailable. + if external { + // An external driver may fail to populate the Compiler/GOARCH fields, + // especially since they are relatively new (see #63700). + // Provide a sensible fallback in this case. + ld.sizes = types.SizesFor("gc", runtime.GOARCH) + if ld.sizes == nil { // gccgo-only arch + ld.sizes = types.SizesFor("gc", "amd64") + } + } else { + // Go list should never fail to deliver accurate size information. + // Reject the whole Load since the error is the same for every package. + return nil, fmt.Errorf("can't determine type sizes for compiler %q on GOARCH %q", + response.Compiler, response.Arch) + } + } + + return ld.refine(response) } // defaultDriver is a driver that implements go/packages' fallback behavior. // It will try to request to an external driver, if one exists. If there's // no external driver, or the driver returns a response with NotHandled set, // defaultDriver will fall back to the go list driver. -func defaultDriver(cfg *Config, patterns ...string) (*driverResponse, error) { - driver := findExternalDriver(cfg) - if driver == nil { - driver = goListDriver +// The boolean result indicates that an external driver handled the request. +func defaultDriver(cfg *Config, patterns ...string) (*DriverResponse, bool, error) { + const ( + // windowsArgMax specifies the maximum command line length for + // the Windows' CreateProcess function. + windowsArgMax = 32767 + // maxEnvSize is a very rough estimation of the maximum environment + // size of a user. + maxEnvSize = 16384 + // safeArgMax specifies the maximum safe command line length to use + // by the underlying driver excl. the environment. We choose the Windows' + // ARG_MAX as the starting point because it's one of the lowest ARG_MAX + // constants out of the different supported platforms, + // e.g., https://www.in-ulm.de/~mascheck/various/argmax/#results. + safeArgMax = windowsArgMax - maxEnvSize + ) + chunks, err := splitIntoChunks(patterns, safeArgMax) + if err != nil { + return nil, false, err } - response, err := driver(cfg, patterns...) + + if driver := findExternalDriver(cfg); driver != nil { + response, err := callDriverOnChunks(driver, cfg, chunks) + if err != nil { + return nil, false, err + } else if !response.NotHandled { + return response, true, nil + } + // (fall through) + } + + response, err := callDriverOnChunks(goListDriver, cfg, chunks) if err != nil { - return response, err - } else if response.NotHandled { - return goListDriver(cfg, patterns...) + return nil, false, err } - return response, nil + return response, false, err +} + +// splitIntoChunks chunks the slice so that the total number of characters +// in a chunk is no longer than argMax. +func splitIntoChunks(patterns []string, argMax int) ([][]string, error) { + if argMax <= 0 { + return nil, errors.New("failed to split patterns into chunks, negative safe argMax value") + } + var chunks [][]string + charsInChunk := 0 + nextChunkStart := 0 + for i, v := range patterns { + vChars := len(v) + if vChars > argMax { + // a single pattern is longer than the maximum safe ARG_MAX, hardly should happen + return nil, errors.New("failed to split patterns into chunks, a pattern is too long") + } + charsInChunk += vChars + 1 // +1 is for a whitespace between patterns that has to be counted too + if charsInChunk > argMax { + chunks = append(chunks, patterns[nextChunkStart:i]) + nextChunkStart = i + charsInChunk = vChars + } + } + // add the last chunk + if nextChunkStart < len(patterns) { + chunks = append(chunks, patterns[nextChunkStart:]) + } + return chunks, nil +} + +func callDriverOnChunks(driver driver, cfg *Config, chunks [][]string) (*DriverResponse, error) { + if len(chunks) == 0 { + return driver(cfg) + } + responses := make([]*DriverResponse, len(chunks)) + errNotHandled := errors.New("driver returned NotHandled") + var g errgroup.Group + for i, chunk := range chunks { + i := i + chunk := chunk + g.Go(func() (err error) { + responses[i], err = driver(cfg, chunk...) + if responses[i] != nil && responses[i].NotHandled { + err = errNotHandled + } + return err + }) + } + if err := g.Wait(); err != nil { + if errors.Is(err, errNotHandled) { + return &DriverResponse{NotHandled: true}, nil + } + return nil, err + } + return mergeResponses(responses...), nil +} + +func mergeResponses(responses ...*DriverResponse) *DriverResponse { + if len(responses) == 0 { + return nil + } + response := newDeduper() + response.dr.NotHandled = false + response.dr.Compiler = responses[0].Compiler + response.dr.Arch = responses[0].Arch + response.dr.GoVersion = responses[0].GoVersion + for _, v := range responses { + response.addAll(v) + } + return response.dr } // A Package describes a loaded Go package. @@ -347,6 +427,10 @@ type Package struct { // The NeedTypes LoadMode bit sets this field for packages matching the // patterns; type information for dependencies may be missing or incomplete, // unless NeedDeps and NeedImports are also set. + // + // Each call to [Load] returns a consistent set of type + // symbols, as defined by the comment at [types.Identical]. + // Avoid mixing type information from two or more calls to [Load]. Types *types.Package // Fset provides position information for Types, TypesInfo, and Syntax. @@ -410,12 +494,6 @@ func init() { packagesinternal.GetDepsErrors = func(p interface{}) []*packagesinternal.PackageError { return p.(*Package).depsErrors } - packagesinternal.GetGoCmdRunner = func(config interface{}) *gocommand.Runner { - return config.(*Config).gocmdRunner - } - packagesinternal.SetGoCmdRunner = func(config interface{}, runner *gocommand.Runner) { - config.(*Config).gocmdRunner = runner - } packagesinternal.SetModFile = func(config interface{}, value string) { config.(*Config).modFile = value } @@ -552,7 +630,7 @@ type loaderPackage struct { type loader struct { pkgs map[string]*loaderPackage Config - sizes types.Sizes + sizes types.Sizes // non-nil if needed by mode parseCache map[string]*parseValue parseCacheMu sync.Mutex exportMu sync.Mutex // enforces mutual exclusion of exportdata operations @@ -630,9 +708,9 @@ func newLoader(cfg *Config) *loader { return ld } -// refine connects the supplied packages into a graph and then adds type and +// refine connects the supplied packages into a graph and then adds type // and syntax information as requested by the LoadMode. -func (ld *loader) refine(response *driverResponse) ([]*Package, error) { +func (ld *loader) refine(response *DriverResponse) ([]*Package, error) { roots := response.Roots rootMap := make(map[string]int, len(roots)) for i, root := range roots { @@ -677,39 +755,38 @@ func (ld *loader) refine(response *driverResponse) ([]*Package, error) { } } - // Materialize the import graph. - - const ( - white = 0 // new - grey = 1 // in progress - black = 2 // complete - ) - - // visit traverses the import graph, depth-first, - // and materializes the graph as Packages.Imports. - // - // Valid imports are saved in the Packages.Import map. - // Invalid imports (cycles and missing nodes) are saved in the importErrors map. - // Thus, even in the presence of both kinds of errors, the Import graph remains a DAG. - // - // visit returns whether the package needs src or has a transitive - // dependency on a package that does. These are the only packages - // for which we load source code. - var stack []*loaderPackage - var visit func(lpkg *loaderPackage) bool - var srcPkgs []*loaderPackage - visit = func(lpkg *loaderPackage) bool { - switch lpkg.color { - case black: - return lpkg.needsrc - case grey: - panic("internal error: grey node") - } - lpkg.color = grey - stack = append(stack, lpkg) // push - stubs := lpkg.Imports // the structure form has only stubs with the ID in the Imports - // If NeedImports isn't set, the imports fields will all be zeroed out. - if ld.Mode&NeedImports != 0 { + if ld.Mode&NeedImports != 0 { + // Materialize the import graph. + + const ( + white = 0 // new + grey = 1 // in progress + black = 2 // complete + ) + + // visit traverses the import graph, depth-first, + // and materializes the graph as Packages.Imports. + // + // Valid imports are saved in the Packages.Import map. + // Invalid imports (cycles and missing nodes) are saved in the importErrors map. + // Thus, even in the presence of both kinds of errors, + // the Import graph remains a DAG. + // + // visit returns whether the package needs src or has a transitive + // dependency on a package that does. These are the only packages + // for which we load source code. + var stack []*loaderPackage + var visit func(lpkg *loaderPackage) bool + visit = func(lpkg *loaderPackage) bool { + switch lpkg.color { + case black: + return lpkg.needsrc + case grey: + panic("internal error: grey node") + } + lpkg.color = grey + stack = append(stack, lpkg) // push + stubs := lpkg.Imports // the structure form has only stubs with the ID in the Imports lpkg.Imports = make(map[string]*Package, len(stubs)) for importPath, ipkg := range stubs { var importErr error @@ -733,40 +810,39 @@ func (ld *loader) refine(response *driverResponse) ([]*Package, error) { } lpkg.Imports[importPath] = imp.Package } - } - if lpkg.needsrc { - srcPkgs = append(srcPkgs, lpkg) - } - if ld.Mode&NeedTypesSizes != 0 { - lpkg.TypesSizes = ld.sizes - } - stack = stack[:len(stack)-1] // pop - lpkg.color = black - return lpkg.needsrc - } + // Complete type information is required for the + // immediate dependencies of each source package. + if lpkg.needsrc && ld.Mode&NeedTypes != 0 { + for _, ipkg := range lpkg.Imports { + ld.pkgs[ipkg.ID].needtypes = true + } + } - if ld.Mode&NeedImports == 0 { - // We do this to drop the stub import packages that we are not even going to try to resolve. - for _, lpkg := range initial { - lpkg.Imports = nil + // NeedTypeSizes causes TypeSizes to be set even + // on packages for which types aren't needed. + if ld.Mode&NeedTypesSizes != 0 { + lpkg.TypesSizes = ld.sizes + } + stack = stack[:len(stack)-1] // pop + lpkg.color = black + + return lpkg.needsrc } - } else { + // For each initial package, create its import DAG. for _, lpkg := range initial { visit(lpkg) } - } - if ld.Mode&NeedImports != 0 && ld.Mode&NeedTypes != 0 { - for _, lpkg := range srcPkgs { - // Complete type information is required for the - // immediate dependencies of each source package. - for _, ipkg := range lpkg.Imports { - imp := ld.pkgs[ipkg.ID] - imp.needtypes = true - } + + } else { + // !NeedImports: drop the stub (ID-only) import packages + // that we are not even going to try to resolve. + for _, lpkg := range initial { + lpkg.Imports = nil } } + // Load type data and syntax if needed, starting at // the initial packages (roots of the import DAG). if ld.Mode&NeedTypes != 0 || ld.Mode&NeedSyntax != 0 { @@ -781,6 +857,12 @@ func (ld *loader) refine(response *driverResponse) ([]*Package, error) { wg.Wait() } + // If the context is done, return its error and + // throw out [likely] incomplete packages. + if err := ld.Context.Err(); err != nil { + return nil, err + } + result := make([]*Package, len(initial)) for i, lpkg := range initial { result[i] = lpkg.Package @@ -876,6 +958,14 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { lpkg.Types = types.NewPackage(lpkg.PkgPath, lpkg.Name) lpkg.Fset = ld.Fset + // Start shutting down if the context is done and do not load + // source or export data files. + // Packages that import this one will have ld.Context.Err() != nil. + // ld.Context.Err() will be returned later by refine. + if ld.Context.Err() != nil { + return + } + // Subtle: we populate all Types fields with an empty Package // before loading export data so that export data processing // never has to create a types.Package for an indirect dependency, @@ -995,15 +1085,23 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { return } + // Start shutting down if the context is done and do not type check. + // Packages that import this one will have ld.Context.Err() != nil. + // ld.Context.Err() will be returned later by refine. + if ld.Context.Err() != nil { + return + } + lpkg.TypesInfo = &types.Info{ Types: make(map[ast.Expr]types.TypeAndValue), Defs: make(map[*ast.Ident]types.Object), Uses: make(map[*ast.Ident]types.Object), Implicits: make(map[ast.Node]types.Object), + Instances: make(map[*ast.Ident]types.Instance), Scopes: make(map[ast.Node]*types.Scope), Selections: make(map[*ast.SelectorExpr]*types.Selection), } - typeparams.InitInstanceInfo(lpkg.TypesInfo) + versions.InitFileVersions(lpkg.TypesInfo) lpkg.TypesSizes = ld.sizes importer := importerFunc(func(path string) (*types.Package, error) { @@ -1041,7 +1139,10 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { IgnoreFuncBodies: ld.Mode&NeedDeps == 0 && !lpkg.initial, Error: appendError, - Sizes: ld.sizes, + Sizes: ld.sizes, // may be nil + } + if lpkg.Module != nil && lpkg.Module.GoVersion != "" { + tc.GoVersion = "go" + lpkg.Module.GoVersion } if (ld.Mode & typecheckCgo) != 0 { if !typesinternal.SetUsesCgo(tc) { @@ -1052,10 +1153,24 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { return } } - types.NewChecker(tc, ld.Fset, lpkg.Types, lpkg.TypesInfo).Files(lpkg.Syntax) + typErr := types.NewChecker(tc, ld.Fset, lpkg.Types, lpkg.TypesInfo).Files(lpkg.Syntax) lpkg.importErrors = nil // no longer needed + // In go/types go1.21 and go1.22, Checker.Files failed fast with a + // a "too new" error, without calling tc.Error and without + // proceeding to type-check the package (#66525). + // We rely on the runtimeVersion error to give the suggested remedy. + if typErr != nil && len(lpkg.Errors) == 0 && len(lpkg.Syntax) > 0 { + if msg := typErr.Error(); strings.HasPrefix(msg, "package requires newer Go version") { + appendError(types.Error{ + Fset: ld.Fset, + Pos: lpkg.Syntax[0].Package, + Msg: msg, + }) + } + } + // If !Cgo, the type-checker uses FakeImportC mode, so // it doesn't invoke the importer for import "C", // nor report an error for the import, @@ -1077,6 +1192,12 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { } } + // If types.Checker.Files had an error that was unreported, + // make sure to report the unknown error so the package is illTyped. + if typErr != nil && len(lpkg.Errors) == 0 { + appendError(typErr) + } + // Record accumulated errors. illTyped := len(lpkg.Errors) > 0 if !illTyped { @@ -1122,7 +1243,7 @@ func (ld *loader) parseFile(filename string) (*ast.File, error) { var err error if src == nil { ioLimit <- true // wait - src, err = ioutil.ReadFile(filename) + src, err = os.ReadFile(filename) <-ioLimit // signal } if err != nil { @@ -1148,11 +1269,6 @@ func (ld *loader) parseFiles(filenames []string) ([]*ast.File, []error) { parsed := make([]*ast.File, n) errors := make([]error, n) for i, file := range filenames { - if ld.Config.Context.Err() != nil { - parsed[i] = nil - errors[i] = ld.Config.Context.Err() - continue - } wg.Add(1) go func(i int, filename string) { parsed[i], errors[i] = ld.parseFile(filename) diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go new file mode 100644 index 0000000..a2386c3 --- /dev/null +++ b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go @@ -0,0 +1,753 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package objectpath defines a naming scheme for types.Objects +// (that is, named entities in Go programs) relative to their enclosing +// package. +// +// Type-checker objects are canonical, so they are usually identified by +// their address in memory (a pointer), but a pointer has meaning only +// within one address space. By contrast, objectpath names allow the +// identity of an object to be sent from one program to another, +// establishing a correspondence between types.Object variables that are +// distinct but logically equivalent. +// +// A single object may have multiple paths. In this example, +// +// type A struct{ X int } +// type B A +// +// the field X has two paths due to its membership of both A and B. +// The For(obj) function always returns one of these paths, arbitrarily +// but consistently. +package objectpath + +import ( + "fmt" + "go/types" + "strconv" + "strings" + + "golang.org/x/tools/internal/aliases" + "golang.org/x/tools/internal/typesinternal" +) + +// TODO(adonovan): think about generic aliases. + +// A Path is an opaque name that identifies a types.Object +// relative to its package. Conceptually, the name consists of a +// sequence of destructuring operations applied to the package scope +// to obtain the original object. +// The name does not include the package itself. +type Path string + +// Encoding +// +// An object path is a textual and (with training) human-readable encoding +// of a sequence of destructuring operators, starting from a types.Package. +// The sequences represent a path through the package/object/type graph. +// We classify these operators by their type: +// +// PO package->object Package.Scope.Lookup +// OT object->type Object.Type +// TT type->type Type.{Elem,Key,Params,Results,Underlying} [EKPRU] +// TO type->object Type.{At,Field,Method,Obj} [AFMO] +// +// All valid paths start with a package and end at an object +// and thus may be defined by the regular language: +// +// objectpath = PO (OT TT* TO)* +// +// The concrete encoding follows directly: +// - The only PO operator is Package.Scope.Lookup, which requires an identifier. +// - The only OT operator is Object.Type, +// which we encode as '.' because dot cannot appear in an identifier. +// - The TT operators are encoded as [EKPRUTC]; +// one of these (TypeParam) requires an integer operand, +// which is encoded as a string of decimal digits. +// - The TO operators are encoded as [AFMO]; +// three of these (At,Field,Method) require an integer operand, +// which is encoded as a string of decimal digits. +// These indices are stable across different representations +// of the same package, even source and export data. +// The indices used are implementation specific and may not correspond to +// the argument to the go/types function. +// +// In the example below, +// +// package p +// +// type T interface { +// f() (a string, b struct{ X int }) +// } +// +// field X has the path "T.UM0.RA1.F0", +// representing the following sequence of operations: +// +// p.Lookup("T") T +// .Type().Underlying().Method(0). f +// .Type().Results().At(1) b +// .Type().Field(0) X +// +// The encoding is not maximally compact---every R or P is +// followed by an A, for example---but this simplifies the +// encoder and decoder. +const ( + // object->type operators + opType = '.' // .Type() (Object) + + // type->type operators + opElem = 'E' // .Elem() (Pointer, Slice, Array, Chan, Map) + opKey = 'K' // .Key() (Map) + opParams = 'P' // .Params() (Signature) + opResults = 'R' // .Results() (Signature) + opUnderlying = 'U' // .Underlying() (Named) + opTypeParam = 'T' // .TypeParams.At(i) (Named, Signature) + opConstraint = 'C' // .Constraint() (TypeParam) + + // type->object operators + opAt = 'A' // .At(i) (Tuple) + opField = 'F' // .Field(i) (Struct) + opMethod = 'M' // .Method(i) (Named or Interface; not Struct: "promoted" names are ignored) + opObj = 'O' // .Obj() (Named, TypeParam) +) + +// For is equivalent to new(Encoder).For(obj). +// +// It may be more efficient to reuse a single Encoder across several calls. +func For(obj types.Object) (Path, error) { + return new(Encoder).For(obj) +} + +// An Encoder amortizes the cost of encoding the paths of multiple objects. +// The zero value of an Encoder is ready to use. +type Encoder struct { + scopeMemo map[*types.Scope][]types.Object // memoization of scopeObjects +} + +// For returns the path to an object relative to its package, +// or an error if the object is not accessible from the package's Scope. +// +// The For function guarantees to return a path only for the following objects: +// - package-level types +// - exported package-level non-types +// - methods +// - parameter and result variables +// - struct fields +// These objects are sufficient to define the API of their package. +// The objects described by a package's export data are drawn from this set. +// +// The set of objects accessible from a package's Scope depends on +// whether the package was produced by type-checking syntax, or +// reading export data; the latter may have a smaller Scope since +// export data trims objects that are not reachable from an exported +// declaration. For example, the For function will return a path for +// an exported method of an unexported type that is not reachable +// from any public declaration; this path will cause the Object +// function to fail if called on a package loaded from export data. +// TODO(adonovan): is this a bug or feature? Should this package +// compute accessibility in the same way? +// +// For does not return a path for predeclared names, imported package +// names, local names, and unexported package-level names (except +// types). +// +// Example: given this definition, +// +// package p +// +// type T interface { +// f() (a string, b struct{ X int }) +// } +// +// For(X) would return a path that denotes the following sequence of operations: +// +// p.Scope().Lookup("T") (TypeName T) +// .Type().Underlying().Method(0). (method Func f) +// .Type().Results().At(1) (field Var b) +// .Type().Field(0) (field Var X) +// +// where p is the package (*types.Package) to which X belongs. +func (enc *Encoder) For(obj types.Object) (Path, error) { + pkg := obj.Pkg() + + // This table lists the cases of interest. + // + // Object Action + // ------ ------ + // nil reject + // builtin reject + // pkgname reject + // label reject + // var + // package-level accept + // func param/result accept + // local reject + // struct field accept + // const + // package-level accept + // local reject + // func + // package-level accept + // init functions reject + // concrete method accept + // interface method accept + // type + // package-level accept + // local reject + // + // The only accessible package-level objects are members of pkg itself. + // + // The cases are handled in four steps: + // + // 1. reject nil and builtin + // 2. accept package-level objects + // 3. reject obviously invalid objects + // 4. search the API for the path to the param/result/field/method. + + // 1. reference to nil or builtin? + if pkg == nil { + return "", fmt.Errorf("predeclared %s has no path", obj) + } + scope := pkg.Scope() + + // 2. package-level object? + if scope.Lookup(obj.Name()) == obj { + // Only exported objects (and non-exported types) have a path. + // Non-exported types may be referenced by other objects. + if _, ok := obj.(*types.TypeName); !ok && !obj.Exported() { + return "", fmt.Errorf("no path for non-exported %v", obj) + } + return Path(obj.Name()), nil + } + + // 3. Not a package-level object. + // Reject obviously non-viable cases. + switch obj := obj.(type) { + case *types.TypeName: + if _, ok := aliases.Unalias(obj.Type()).(*types.TypeParam); !ok { + // With the exception of type parameters, only package-level type names + // have a path. + return "", fmt.Errorf("no path for %v", obj) + } + case *types.Const, // Only package-level constants have a path. + *types.Label, // Labels are function-local. + *types.PkgName: // PkgNames are file-local. + return "", fmt.Errorf("no path for %v", obj) + + case *types.Var: + // Could be: + // - a field (obj.IsField()) + // - a func parameter or result + // - a local var. + // Sadly there is no way to distinguish + // a param/result from a local + // so we must proceed to the find. + + case *types.Func: + // A func, if not package-level, must be a method. + if recv := obj.Type().(*types.Signature).Recv(); recv == nil { + return "", fmt.Errorf("func is not a method: %v", obj) + } + + if path, ok := enc.concreteMethod(obj); ok { + // Fast path for concrete methods that avoids looping over scope. + return path, nil + } + + default: + panic(obj) + } + + // 4. Search the API for the path to the var (field/param/result) or method. + + // First inspect package-level named types. + // In the presence of path aliases, these give + // the best paths because non-types may + // refer to types, but not the reverse. + empty := make([]byte, 0, 48) // initial space + objs := enc.scopeObjects(scope) + for _, o := range objs { + tname, ok := o.(*types.TypeName) + if !ok { + continue // handle non-types in second pass + } + + path := append(empty, o.Name()...) + path = append(path, opType) + + T := o.Type() + + if tname.IsAlias() { + // type alias + if r := find(obj, T, path, nil); r != nil { + return Path(r), nil + } + } else { + if named, _ := T.(*types.Named); named != nil { + if r := findTypeParam(obj, named.TypeParams(), path, nil); r != nil { + // generic named type + return Path(r), nil + } + } + // defined (named) type + if r := find(obj, T.Underlying(), append(path, opUnderlying), nil); r != nil { + return Path(r), nil + } + } + } + + // Then inspect everything else: + // non-types, and declared methods of defined types. + for _, o := range objs { + path := append(empty, o.Name()...) + if _, ok := o.(*types.TypeName); !ok { + if o.Exported() { + // exported non-type (const, var, func) + if r := find(obj, o.Type(), append(path, opType), nil); r != nil { + return Path(r), nil + } + } + continue + } + + // Inspect declared methods of defined types. + if T, ok := aliases.Unalias(o.Type()).(*types.Named); ok { + path = append(path, opType) + // The method index here is always with respect + // to the underlying go/types data structures, + // which ultimately derives from source order + // and must be preserved by export data. + for i := 0; i < T.NumMethods(); i++ { + m := T.Method(i) + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return Path(path2), nil // found declared method + } + if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + return Path(r), nil + } + } + } + } + + return "", fmt.Errorf("can't find path for %v in %s", obj, pkg.Path()) +} + +func appendOpArg(path []byte, op byte, arg int) []byte { + path = append(path, op) + path = strconv.AppendInt(path, int64(arg), 10) + return path +} + +// concreteMethod returns the path for meth, which must have a non-nil receiver. +// The second return value indicates success and may be false if the method is +// an interface method or if it is an instantiated method. +// +// This function is just an optimization that avoids the general scope walking +// approach. You are expected to fall back to the general approach if this +// function fails. +func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) { + // Concrete methods can only be declared on package-scoped named types. For + // that reason we can skip the expensive walk over the package scope: the + // path will always be package -> named type -> method. We can trivially get + // the type name from the receiver, and only have to look over the type's + // methods to find the method index. + // + // Methods on generic types require special consideration, however. Consider + // the following package: + // + // L1: type S[T any] struct{} + // L2: func (recv S[A]) Foo() { recv.Bar() } + // L3: func (recv S[B]) Bar() { } + // L4: type Alias = S[int] + // L5: func _[T any]() { var s S[int]; s.Foo() } + // + // The receivers of methods on generic types are instantiations. L2 and L3 + // instantiate S with the type-parameters A and B, which are scoped to the + // respective methods. L4 and L5 each instantiate S with int. Each of these + // instantiations has its own method set, full of methods (and thus objects) + // with receivers whose types are the respective instantiations. In other + // words, we have + // + // S[A].Foo, S[A].Bar + // S[B].Foo, S[B].Bar + // S[int].Foo, S[int].Bar + // + // We may thus be trying to produce object paths for any of these objects. + // + // S[A].Foo and S[B].Bar are the origin methods, and their paths are S.Foo + // and S.Bar, which are the paths that this function naturally produces. + // + // S[A].Bar, S[B].Foo, and both methods on S[int] are instantiations that + // don't correspond to the origin methods. For S[int], this is significant. + // The most precise object path for S[int].Foo, for example, is Alias.Foo, + // not S.Foo. Our function, however, would produce S.Foo, which would + // resolve to a different object. + // + // For S[A].Bar and S[B].Foo it could be argued that S.Bar and S.Foo are + // still the correct paths, since only the origin methods have meaningful + // paths. But this is likely only true for trivial cases and has edge cases. + // Since this function is only an optimization, we err on the side of giving + // up, deferring to the slower but definitely correct algorithm. Most users + // of objectpath will only be giving us origin methods, anyway, as referring + // to instantiated methods is usually not useful. + + if meth.Origin() != meth { + return "", false + } + + _, named := typesinternal.ReceiverNamed(meth.Type().(*types.Signature).Recv()) + if named == nil { + return "", false + } + + if types.IsInterface(named) { + // Named interfaces don't have to be package-scoped + // + // TODO(dominikh): opt: if scope.Lookup(name) == named, then we can apply this optimization to interface + // methods, too, I think. + return "", false + } + + // Preallocate space for the name, opType, opMethod, and some digits. + name := named.Obj().Name() + path := make([]byte, 0, len(name)+8) + path = append(path, name...) + path = append(path, opType) + + // Method indices are w.r.t. the go/types data structures, + // ultimately deriving from source order, + // which is preserved by export data. + for i := 0; i < named.NumMethods(); i++ { + if named.Method(i) == meth { + path = appendOpArg(path, opMethod, i) + return Path(path), true + } + } + + // Due to golang/go#59944, go/types fails to associate the receiver with + // certain methods on cgo types. + // + // TODO(rfindley): replace this panic once golang/go#59944 is fixed in all Go + // versions gopls supports. + return "", false + // panic(fmt.Sprintf("couldn't find method %s on type %s; methods: %#v", meth, named, enc.namedMethods(named))) +} + +// find finds obj within type T, returning the path to it, or nil if not found. +// +// The seen map is used to short circuit cycles through type parameters. If +// nil, it will be allocated as necessary. +func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName]bool) []byte { + switch T := T.(type) { + case *aliases.Alias: + return find(obj, aliases.Unalias(T), path, seen) + case *types.Basic, *types.Named: + // Named types belonging to pkg were handled already, + // so T must belong to another package. No path. + return nil + case *types.Pointer: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Slice: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Array: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Chan: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Map: + if r := find(obj, T.Key(), append(path, opKey), seen); r != nil { + return r + } + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Signature: + if r := findTypeParam(obj, T.TypeParams(), path, seen); r != nil { + return r + } + if r := find(obj, T.Params(), append(path, opParams), seen); r != nil { + return r + } + return find(obj, T.Results(), append(path, opResults), seen) + case *types.Struct: + for i := 0; i < T.NumFields(); i++ { + fld := T.Field(i) + path2 := appendOpArg(path, opField, i) + if fld == obj { + return path2 // found field var + } + if r := find(obj, fld.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *types.Tuple: + for i := 0; i < T.Len(); i++ { + v := T.At(i) + path2 := appendOpArg(path, opAt, i) + if v == obj { + return path2 // found param/result var + } + if r := find(obj, v.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *types.Interface: + for i := 0; i < T.NumMethods(); i++ { + m := T.Method(i) + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return path2 // found interface method + } + if r := find(obj, m.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *types.TypeParam: + name := T.Obj() + if name == obj { + return append(path, opObj) + } + if seen[name] { + return nil + } + if seen == nil { + seen = make(map[*types.TypeName]bool) + } + seen[name] = true + if r := find(obj, T.Constraint(), append(path, opConstraint), seen); r != nil { + return r + } + return nil + } + panic(T) +} + +func findTypeParam(obj types.Object, list *types.TypeParamList, path []byte, seen map[*types.TypeName]bool) []byte { + for i := 0; i < list.Len(); i++ { + tparam := list.At(i) + path2 := appendOpArg(path, opTypeParam, i) + if r := find(obj, tparam, path2, seen); r != nil { + return r + } + } + return nil +} + +// Object returns the object denoted by path p within the package pkg. +func Object(pkg *types.Package, p Path) (types.Object, error) { + pathstr := string(p) + if pathstr == "" { + return nil, fmt.Errorf("empty path") + } + + var pkgobj, suffix string + if dot := strings.IndexByte(pathstr, opType); dot < 0 { + pkgobj = pathstr + } else { + pkgobj = pathstr[:dot] + suffix = pathstr[dot:] // suffix starts with "." + } + + obj := pkg.Scope().Lookup(pkgobj) + if obj == nil { + return nil, fmt.Errorf("package %s does not contain %q", pkg.Path(), pkgobj) + } + + // abstraction of *types.{Pointer,Slice,Array,Chan,Map} + type hasElem interface { + Elem() types.Type + } + // abstraction of *types.{Named,Signature} + type hasTypeParams interface { + TypeParams() *types.TypeParamList + } + // abstraction of *types.{Named,TypeParam} + type hasObj interface { + Obj() *types.TypeName + } + + // The loop state is the pair (t, obj), + // exactly one of which is non-nil, initially obj. + // All suffixes start with '.' (the only object->type operation), + // followed by optional type->type operations, + // then a type->object operation. + // The cycle then repeats. + var t types.Type + for suffix != "" { + code := suffix[0] + suffix = suffix[1:] + + // Codes [AFM] have an integer operand. + var index int + switch code { + case opAt, opField, opMethod, opTypeParam: + rest := strings.TrimLeft(suffix, "0123456789") + numerals := suffix[:len(suffix)-len(rest)] + suffix = rest + i, err := strconv.Atoi(numerals) + if err != nil { + return nil, fmt.Errorf("invalid path: bad numeric operand %q for code %q", numerals, code) + } + index = int(i) + case opObj: + // no operand + default: + // The suffix must end with a type->object operation. + if suffix == "" { + return nil, fmt.Errorf("invalid path: ends with %q, want [AFMO]", code) + } + } + + if code == opType { + if t != nil { + return nil, fmt.Errorf("invalid path: unexpected %q in type context", opType) + } + t = obj.Type() + obj = nil + continue + } + + if t == nil { + return nil, fmt.Errorf("invalid path: code %q in object context", code) + } + + // Inv: t != nil, obj == nil + + t = aliases.Unalias(t) + switch code { + case opElem: + hasElem, ok := t.(hasElem) // Pointer, Slice, Array, Chan, Map + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want pointer, slice, array, chan or map)", code, t, t) + } + t = hasElem.Elem() + + case opKey: + mapType, ok := t.(*types.Map) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want map)", code, t, t) + } + t = mapType.Key() + + case opParams: + sig, ok := t.(*types.Signature) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) + } + t = sig.Params() + + case opResults: + sig, ok := t.(*types.Signature) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) + } + t = sig.Results() + + case opUnderlying: + named, ok := t.(*types.Named) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named)", code, t, t) + } + t = named.Underlying() + + case opTypeParam: + hasTypeParams, ok := t.(hasTypeParams) // Named, Signature + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or signature)", code, t, t) + } + tparams := hasTypeParams.TypeParams() + if n := tparams.Len(); index >= n { + return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) + } + t = tparams.At(index) + + case opConstraint: + tparam, ok := t.(*types.TypeParam) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want type parameter)", code, t, t) + } + t = tparam.Constraint() + + case opAt: + tuple, ok := t.(*types.Tuple) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want tuple)", code, t, t) + } + if n := tuple.Len(); index >= n { + return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) + } + obj = tuple.At(index) + t = nil + + case opField: + structType, ok := t.(*types.Struct) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want struct)", code, t, t) + } + if n := structType.NumFields(); index >= n { + return nil, fmt.Errorf("field index %d out of range [0-%d)", index, n) + } + obj = structType.Field(index) + t = nil + + case opMethod: + switch t := t.(type) { + case *types.Interface: + if index >= t.NumMethods() { + return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) + } + obj = t.Method(index) // Id-ordered + + case *types.Named: + if index >= t.NumMethods() { + return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) + } + obj = t.Method(index) + + default: + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want interface or named)", code, t, t) + } + t = nil + + case opObj: + hasObj, ok := t.(hasObj) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or type param)", code, t, t) + } + obj = hasObj.Obj() + t = nil + + default: + return nil, fmt.Errorf("invalid path: unknown code %q", code) + } + } + + if obj.Pkg() != pkg { + return nil, fmt.Errorf("path denotes %s, which belongs to a different package", obj) + } + + return obj, nil // success +} + +// scopeObjects is a memoization of scope objects. +// Callers must not modify the result. +func (enc *Encoder) scopeObjects(scope *types.Scope) []types.Object { + m := enc.scopeMemo + if m == nil { + m = make(map[*types.Scope][]types.Object) + enc.scopeMemo = m + } + objs, ok := m[scope] + if !ok { + names := scope.Names() // allocates and sorts + objs = make([]types.Object, len(names)) + for i, name := range names { + objs[i] = scope.Lookup(name) + } + m[scope] = objs + } + return objs +} diff --git a/vendor/golang.org/x/tools/internal/aliases/aliases.go b/vendor/golang.org/x/tools/internal/aliases/aliases.go new file mode 100644 index 0000000..c24c2ee --- /dev/null +++ b/vendor/golang.org/x/tools/internal/aliases/aliases.go @@ -0,0 +1,32 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package aliases + +import ( + "go/token" + "go/types" +) + +// Package aliases defines backward compatible shims +// for the types.Alias type representation added in 1.22. +// This defines placeholders for x/tools until 1.26. + +// NewAlias creates a new TypeName in Package pkg that +// is an alias for the type rhs. +// +// The enabled parameter determines whether the resulting [TypeName]'s +// type is an [types.Alias]. Its value must be the result of a call to +// [Enabled], which computes the effective value of +// GODEBUG=gotypesalias=... by invoking the type checker. The Enabled +// function is expensive and should be called once per task (e.g. +// package import), not once per call to NewAlias. +func NewAlias(enabled bool, pos token.Pos, pkg *types.Package, name string, rhs types.Type) *types.TypeName { + if enabled { + tname := types.NewTypeName(pos, pkg, name, nil) + newAlias(tname, rhs) + return tname + } + return types.NewTypeName(pos, pkg, name, rhs) +} diff --git a/vendor/golang.org/x/tools/internal/aliases/aliases_go121.go b/vendor/golang.org/x/tools/internal/aliases/aliases_go121.go new file mode 100644 index 0000000..c027b9f --- /dev/null +++ b/vendor/golang.org/x/tools/internal/aliases/aliases_go121.go @@ -0,0 +1,31 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.22 +// +build !go1.22 + +package aliases + +import ( + "go/types" +) + +// Alias is a placeholder for a go/types.Alias for <=1.21. +// It will never be created by go/types. +type Alias struct{} + +func (*Alias) String() string { panic("unreachable") } +func (*Alias) Underlying() types.Type { panic("unreachable") } +func (*Alias) Obj() *types.TypeName { panic("unreachable") } +func Rhs(alias *Alias) types.Type { panic("unreachable") } + +// Unalias returns the type t for go <=1.21. +func Unalias(t types.Type) types.Type { return t } + +func newAlias(name *types.TypeName, rhs types.Type) *Alias { panic("unreachable") } + +// Enabled reports whether [NewAlias] should create [types.Alias] types. +// +// Before go1.22, this function always returns false. +func Enabled() bool { return false } diff --git a/vendor/golang.org/x/tools/internal/aliases/aliases_go122.go b/vendor/golang.org/x/tools/internal/aliases/aliases_go122.go new file mode 100644 index 0000000..b329954 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/aliases/aliases_go122.go @@ -0,0 +1,63 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.22 +// +build go1.22 + +package aliases + +import ( + "go/ast" + "go/parser" + "go/token" + "go/types" +) + +// Alias is an alias of types.Alias. +type Alias = types.Alias + +// Rhs returns the type on the right-hand side of the alias declaration. +func Rhs(alias *Alias) types.Type { + if alias, ok := any(alias).(interface{ Rhs() types.Type }); ok { + return alias.Rhs() // go1.23+ + } + + // go1.22's Alias didn't have the Rhs method, + // so Unalias is the best we can do. + return Unalias(alias) +} + +// Unalias is a wrapper of types.Unalias. +func Unalias(t types.Type) types.Type { return types.Unalias(t) } + +// newAlias is an internal alias around types.NewAlias. +// Direct usage is discouraged as the moment. +// Try to use NewAlias instead. +func newAlias(tname *types.TypeName, rhs types.Type) *Alias { + a := types.NewAlias(tname, rhs) + // TODO(go.dev/issue/65455): Remove kludgy workaround to set a.actual as a side-effect. + Unalias(a) + return a +} + +// Enabled reports whether [NewAlias] should create [types.Alias] types. +// +// This function is expensive! Call it sparingly. +func Enabled() bool { + // The only reliable way to compute the answer is to invoke go/types. + // We don't parse the GODEBUG environment variable, because + // (a) it's tricky to do so in a manner that is consistent + // with the godebug package; in particular, a simple + // substring check is not good enough. The value is a + // rightmost-wins list of options. But more importantly: + // (b) it is impossible to detect changes to the effective + // setting caused by os.Setenv("GODEBUG"), as happens in + // many tests. Therefore any attempt to cache the result + // is just incorrect. + fset := token.NewFileSet() + f, _ := parser.ParseFile(fset, "a.go", "package p; type A = int", 0) + pkg, _ := new(types.Config).Check("p", fset, []*ast.File{f}, nil) + _, enabled := pkg.Scope().Lookup("A").Type().(*types.Alias) + return enabled +} diff --git a/vendor/golang.org/x/tools/internal/event/keys/util.go b/vendor/golang.org/x/tools/internal/event/keys/util.go new file mode 100644 index 0000000..c0e8e73 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/event/keys/util.go @@ -0,0 +1,21 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package keys + +import ( + "sort" + "strings" +) + +// Join returns a canonical join of the keys in S: +// a sorted comma-separated string list. +func Join[S ~[]T, T ~string](s S) string { + strs := make([]string, 0, len(s)) + for _, v := range s { + strs = append(strs, string(v)) + } + sort.Strings(strs) + return strings.Join(strs, ",") +} diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go deleted file mode 100644 index ff2f2ec..0000000 --- a/vendor/golang.org/x/tools/internal/event/tag/tag.go +++ /dev/null @@ -1,59 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag provides the labels used for telemetry throughout gopls. -package tag - -import ( - "golang.org/x/tools/internal/event/keys" -) - -var ( - // create the label keys we use - Method = keys.NewString("method", "") - StatusCode = keys.NewString("status.code", "") - StatusMessage = keys.NewString("status.message", "") - RPCID = keys.NewString("id", "") - RPCDirection = keys.NewString("direction", "") - File = keys.NewString("file", "") - Directory = keys.New("directory", "") - URI = keys.New("URI", "") - Package = keys.NewString("package", "") // Package ID - PackagePath = keys.NewString("package_path", "") - Query = keys.New("query", "") - Snapshot = keys.NewUInt64("snapshot", "") - Operation = keys.NewString("operation", "") - - Position = keys.New("position", "") - Category = keys.NewString("category", "") - PackageCount = keys.NewInt("packages", "") - Files = keys.New("files", "") - Port = keys.NewInt("port", "") - Type = keys.New("type", "") - HoverKind = keys.NewString("hoverkind", "") - - NewServer = keys.NewString("new_server", "A new server was added") - EndServer = keys.NewString("end_server", "A server was shut down") - - ServerID = keys.NewString("server", "The server ID an event is related to") - Logfile = keys.NewString("logfile", "") - DebugAddress = keys.NewString("debug_address", "") - GoplsPath = keys.NewString("gopls_path", "") - ClientID = keys.NewString("client_id", "") - - Level = keys.NewInt("level", "The logging level") -) - -var ( - // create the stats we measure - Started = keys.NewInt64("started", "Count of started RPCs.") - ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes) - SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes) - Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds) -) - -const ( - Inbound = "in" - Outbound = "out" -) diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go index b122371..39df911 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go @@ -29,7 +29,6 @@ import ( "go/token" "go/types" "io" - "io/ioutil" "os" "os/exec" "path/filepath" @@ -221,7 +220,7 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func switch hdr { case "$$B\n": var data []byte - data, err = ioutil.ReadAll(buf) + data, err = io.ReadAll(buf) if err != nil { break } @@ -260,13 +259,6 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func return } -func deref(typ types.Type) types.Type { - if p, _ := typ.(*types.Pointer); p != nil { - return p.Elem() - } - return typ -} - type byPath []*types.Package func (a byPath) Len() int { return len(a) } diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go index 3fc7989..deeb67f 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go @@ -22,17 +22,23 @@ import ( "strconv" "strings" + "golang.org/x/tools/go/types/objectpath" + "golang.org/x/tools/internal/aliases" "golang.org/x/tools/internal/tokeninternal" - "golang.org/x/tools/internal/typeparams" ) // IExportShallow encodes "shallow" export data for the specified package. // -// No promises are made about the encoding other than that it can be -// decoded by the same version of IIExportShallow. If you plan to save -// export data in the file system, be sure to include a cryptographic -// digest of the executable in the key to avoid version skew. -func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { +// No promises are made about the encoding other than that it can be decoded by +// the same version of IIExportShallow. If you plan to save export data in the +// file system, be sure to include a cryptographic digest of the executable in +// the key to avoid version skew. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during export. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IExportShallow(fset *token.FileSet, pkg *types.Package, reportf ReportFunc) ([]byte, error) { // In principle this operation can only fail if out.Write fails, // but that's impossible for bytes.Buffer---and as a matter of // fact iexportCommon doesn't even check for I/O errors. @@ -47,19 +53,27 @@ func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { // IImportShallow decodes "shallow" types.Package data encoded by // IExportShallow in the same executable. This function cannot import data from // cmd/compile or gcexportdata.Write. -func IImportShallow(fset *token.FileSet, getPackage GetPackageFunc, data []byte, path string, insert InsertType) (*types.Package, error) { +// +// The importer calls getPackages to obtain package symbols for all +// packages mentioned in the export data, including the one being +// decoded. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during import. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IImportShallow(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, path string, reportf ReportFunc) (*types.Package, error) { const bundle = false - pkgs, err := iimportCommon(fset, getPackage, data, bundle, path, insert) + const shallow = true + pkgs, err := iimportCommon(fset, getPackages, data, bundle, path, shallow, reportf) if err != nil { return nil, err } return pkgs[0], nil } -// InsertType is the type of a function that creates a types.TypeName -// object for a named type and inserts it into the scope of the -// specified Package. -type InsertType = func(pkg *types.Package, name string) +// ReportFunc is the type of a function used to report formatted bugs. +type ReportFunc = func(string, ...interface{}) // Current bundled export format version. Increase with each format change. // 0: initial implementation @@ -313,8 +327,9 @@ type iexporter struct { out *bytes.Buffer version int - shallow bool // don't put types from other packages in the index - localpkg *types.Package // (nil in bundle mode) + shallow bool // don't put types from other packages in the index + objEncoder *objectpath.Encoder // encodes objects from other packages in shallow mode; lazily allocated + localpkg *types.Package // (nil in bundle mode) // allPkgs tracks all packages that have been referenced by // the export data, so we can ensure to include them in the @@ -354,6 +369,17 @@ func (p *iexporter) trace(format string, args ...interface{}) { fmt.Printf(strings.Repeat("..", p.indent)+format+"\n", args...) } +// objectpathEncoder returns the lazily allocated objectpath.Encoder to use +// when encoding objects in other packages during shallow export. +// +// Using a shared Encoder amortizes some of cost of objectpath search. +func (p *iexporter) objectpathEncoder() *objectpath.Encoder { + if p.objEncoder == nil { + p.objEncoder = new(objectpath.Encoder) + } + return p.objEncoder +} + // stringOff returns the offset of s within the string section. // If not already present, it's added to the end. func (p *iexporter) stringOff(s string) uint64 { @@ -413,7 +439,6 @@ type exportWriter struct { p *iexporter data intWriter - currPkg *types.Package prevFile string prevLine int64 prevColumn int64 @@ -436,11 +461,10 @@ func (p *iexporter) doDecl(obj types.Object) { }() } w := p.newWriter() - w.setPkg(obj.Pkg(), false) switch obj := obj.(type) { case *types.Var: - w.tag('V') + w.tag(varTag) w.pos(obj.Pos()) w.typ(obj.Type(), obj.Pkg()) @@ -457,10 +481,10 @@ func (p *iexporter) doDecl(obj types.Object) { } // Function. - if typeparams.ForSignature(sig).Len() == 0 { - w.tag('F') + if sig.TypeParams().Len() == 0 { + w.tag(funcTag) } else { - w.tag('G') + w.tag(genericFuncTag) } w.pos(obj.Pos()) // The tparam list of the function type is the declaration of the type @@ -470,27 +494,27 @@ func (p *iexporter) doDecl(obj types.Object) { // // While importing the type parameters, tparamList computes and records // their export name, so that it can be later used when writing the index. - if tparams := typeparams.ForSignature(sig); tparams.Len() > 0 { + if tparams := sig.TypeParams(); tparams.Len() > 0 { w.tparamList(obj.Name(), tparams, obj.Pkg()) } w.signature(sig) case *types.Const: - w.tag('C') + w.tag(constTag) w.pos(obj.Pos()) w.value(obj.Type(), obj.Val()) case *types.TypeName: t := obj.Type() - if tparam, ok := t.(*typeparams.TypeParam); ok { - w.tag('P') + if tparam, ok := aliases.Unalias(t).(*types.TypeParam); ok { + w.tag(typeParamTag) w.pos(obj.Pos()) constraint := tparam.Constraint() if p.version >= iexportVersionGo1_18 { implicit := false - if iface, _ := constraint.(*types.Interface); iface != nil { - implicit = typeparams.IsImplicit(iface) + if iface, _ := aliases.Unalias(constraint).(*types.Interface); iface != nil { + implicit = iface.IsImplicit() } w.bool(implicit) } @@ -499,8 +523,13 @@ func (p *iexporter) doDecl(obj types.Object) { } if obj.IsAlias() { - w.tag('A') + w.tag(aliasTag) w.pos(obj.Pos()) + if alias, ok := t.(*aliases.Alias); ok { + // Preserve materialized aliases, + // even of non-exported types. + t = aliases.Rhs(alias) + } w.typ(t, obj.Pkg()) break } @@ -511,20 +540,20 @@ func (p *iexporter) doDecl(obj types.Object) { panic(internalErrorf("%s is not a defined type", t)) } - if typeparams.ForNamed(named).Len() == 0 { - w.tag('T') + if named.TypeParams().Len() == 0 { + w.tag(typeTag) } else { - w.tag('U') + w.tag(genericTypeTag) } w.pos(obj.Pos()) - if typeparams.ForNamed(named).Len() > 0 { + if named.TypeParams().Len() > 0 { // While importing the type parameters, tparamList computes and records // their export name, so that it can be later used when writing the index. - w.tparamList(obj.Name(), typeparams.ForNamed(named), obj.Pkg()) + w.tparamList(obj.Name(), named.TypeParams(), obj.Pkg()) } - underlying := obj.Type().Underlying() + underlying := named.Underlying() w.typ(underlying, obj.Pkg()) if types.IsInterface(t) { @@ -541,7 +570,7 @@ func (p *iexporter) doDecl(obj types.Object) { // Receiver type parameters are type arguments of the receiver type, so // their name must be qualified before exporting recv. - if rparams := typeparams.RecvTypeParams(sig); rparams.Len() > 0 { + if rparams := sig.RecvTypeParams(); rparams.Len() > 0 { prefix := obj.Name() + "." + m.Name() for i := 0; i < rparams.Len(); i++ { rparam := rparams.At(i) @@ -673,6 +702,9 @@ func (w *exportWriter) qualifiedType(obj *types.TypeName) { w.pkg(obj.Pkg()) } +// TODO(rfindley): what does 'pkg' even mean here? It would be better to pass +// it in explicitly into signatures and structs that may use it for +// constructing fields. func (w *exportWriter) typ(t types.Type, pkg *types.Package) { w.data.uint64(w.p.typOff(t, pkg)) } @@ -712,20 +744,25 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { }() } switch t := t.(type) { + case *aliases.Alias: + // TODO(adonovan): support parameterized aliases, following *types.Named. + w.startType(aliasType) + w.qualifiedType(t.Obj()) + case *types.Named: - if targs := typeparams.NamedTypeArgs(t); targs.Len() > 0 { + if targs := t.TypeArgs(); targs.Len() > 0 { w.startType(instanceType) // TODO(rfindley): investigate if this position is correct, and if it // matters. w.pos(t.Obj().Pos()) w.typeList(targs, pkg) - w.typ(typeparams.NamedTypeOrigin(t), pkg) + w.typ(t.Origin(), pkg) return } w.startType(definedType) w.qualifiedType(t.Obj()) - case *typeparams.TypeParam: + case *types.TypeParam: w.startType(typeParamType) w.qualifiedType(t.Obj()) @@ -764,37 +801,60 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { case *types.Signature: w.startType(signatureType) - w.setPkg(pkg, true) + w.pkg(pkg) w.signature(t) case *types.Struct: w.startType(structType) n := t.NumFields() + // Even for struct{} we must emit some qualifying package, because that's + // what the compiler does, and thus that's what the importer expects. + fieldPkg := pkg if n > 0 { - w.setPkg(t.Field(0).Pkg(), true) // qualifying package for field objects - } else { - w.setPkg(pkg, true) + fieldPkg = t.Field(0).Pkg() + } + if fieldPkg == nil { + // TODO(rfindley): improve this very hacky logic. + // + // The importer expects a package to be set for all struct types, even + // those with no fields. A better encoding might be to set NumFields + // before pkg. setPkg panics with a nil package, which may be possible + // to reach with invalid packages (and perhaps valid packages, too?), so + // (arbitrarily) set the localpkg if available. + // + // Alternatively, we may be able to simply guarantee that pkg != nil, by + // reconsidering the encoding of constant values. + if w.p.shallow { + fieldPkg = w.p.localpkg + } else { + panic(internalErrorf("no package to set for empty struct")) + } } + w.pkg(fieldPkg) w.uint64(uint64(n)) + for i := 0; i < n; i++ { f := t.Field(i) + if w.p.shallow { + w.objectPath(f) + } w.pos(f.Pos()) w.string(f.Name()) // unexported fields implicitly qualified by prior setPkg - w.typ(f.Type(), pkg) + w.typ(f.Type(), fieldPkg) w.bool(f.Anonymous()) w.string(t.Tag(i)) // note (or tag) } case *types.Interface: w.startType(interfaceType) - w.setPkg(pkg, true) + w.pkg(pkg) n := t.NumEmbeddeds() w.uint64(uint64(n)) for i := 0; i < n; i++ { ft := t.EmbeddedType(i) tPkg := pkg - if named, _ := ft.(*types.Named); named != nil { + if named, _ := aliases.Unalias(ft).(*types.Named); named != nil { w.pos(named.Obj().Pos()) } else { w.pos(token.NoPos) @@ -802,17 +862,23 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { w.typ(ft, tPkg) } + // See comment for struct fields. In shallow mode we change the encoding + // for interface methods that are promoted from other packages. + n = t.NumExplicitMethods() w.uint64(uint64(n)) for i := 0; i < n; i++ { m := t.ExplicitMethod(i) + if w.p.shallow { + w.objectPath(m) + } w.pos(m.Pos()) w.string(m.Name()) sig, _ := m.Type().(*types.Signature) w.signature(sig) } - case *typeparams.Union: + case *types.Union: w.startType(unionType) nt := t.Len() w.uint64(uint64(nt)) @@ -827,12 +893,61 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { } } -func (w *exportWriter) setPkg(pkg *types.Package, write bool) { - if write { - w.pkg(pkg) +// objectPath writes the package and objectPath to use to look up obj in a +// different package, when encoding in "shallow" mode. +// +// When doing a shallow import, the importer creates only the local package, +// and requests package symbols for dependencies from the client. +// However, certain types defined in the local package may hold objects defined +// (perhaps deeply) within another package. +// +// For example, consider the following: +// +// package a +// func F() chan * map[string] struct { X int } +// +// package b +// import "a" +// var B = a.F() +// +// In this example, the type of b.B holds fields defined in package a. +// In order to have the correct canonical objects for the field defined in the +// type of B, they are encoded as objectPaths and later looked up in the +// importer. The same problem applies to interface methods. +func (w *exportWriter) objectPath(obj types.Object) { + if obj.Pkg() == nil || obj.Pkg() == w.p.localpkg { + // obj.Pkg() may be nil for the builtin error.Error. + // In this case, or if obj is declared in the local package, no need to + // encode. + w.string("") + return } - - w.currPkg = pkg + objectPath, err := w.p.objectpathEncoder().For(obj) + if err != nil { + // Fall back to the empty string, which will cause the importer to create a + // new object, which matches earlier behavior. Creating a new object is + // sufficient for many purposes (such as type checking), but causes certain + // references algorithms to fail (golang/go#60819). However, we didn't + // notice this problem during months of gopls@v0.12.0 testing. + // + // TODO(golang/go#61674): this workaround is insufficient, as in the case + // where the field forwarded from an instantiated type that may not appear + // in the export data of the original package: + // + // // package a + // type A[P any] struct{ F P } + // + // // package b + // type B a.A[int] + // + // We need to update references algorithms not to depend on this + // de-duplication, at which point we may want to simply remove the + // workaround here. + w.string("") + return + } + w.string(string(objectPath)) + w.pkg(obj.Pkg()) } func (w *exportWriter) signature(sig *types.Signature) { @@ -843,14 +958,14 @@ func (w *exportWriter) signature(sig *types.Signature) { } } -func (w *exportWriter) typeList(ts *typeparams.TypeList, pkg *types.Package) { +func (w *exportWriter) typeList(ts *types.TypeList, pkg *types.Package) { w.uint64(uint64(ts.Len())) for i := 0; i < ts.Len(); i++ { w.typ(ts.At(i), pkg) } } -func (w *exportWriter) tparamList(prefix string, list *typeparams.TypeParamList, pkg *types.Package) { +func (w *exportWriter) tparamList(prefix string, list *types.TypeParamList, pkg *types.Package) { ll := uint64(list.Len()) w.uint64(ll) for i := 0; i < list.Len(); i++ { @@ -868,7 +983,7 @@ const blankMarker = "$" // differs from its actual object name: it is prefixed with a qualifier, and // blank type parameter names are disambiguated by their index in the type // parameter list. -func tparamExportName(prefix string, tparam *typeparams.TypeParam) string { +func tparamExportName(prefix string, tparam *types.TypeParam) string { assert(prefix != "") name := tparam.Obj().Name() if name == "_" { @@ -1205,6 +1320,13 @@ type internalError string func (e internalError) Error() string { return "gcimporter: " + string(e) } +// TODO(adonovan): make this call panic, so that it's symmetric with errorf. +// Otherwise it's easy to forget to do anything with the error. +// +// TODO(adonovan): also, consider switching the names "errorf" and +// "internalErrorf" as the former is used for bugs, whose cause is +// internal inconsistency, whereas the latter is used for ordinary +// situations like bad input, whose cause is external. func internalErrorf(format string, args ...interface{}) error { return internalError(fmt.Sprintf(format, args...)) } diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go index 94a5eba..136aa03 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go @@ -21,7 +21,9 @@ import ( "sort" "strings" - "golang.org/x/tools/internal/typeparams" + "golang.org/x/tools/go/types/objectpath" + "golang.org/x/tools/internal/aliases" + "golang.org/x/tools/internal/typesinternal" ) type intReader struct { @@ -78,6 +80,20 @@ const ( typeParamType instanceType unionType + aliasType +) + +// Object tags +const ( + varTag = 'V' + funcTag = 'F' + genericFuncTag = 'G' + constTag = 'C' + aliasTag = 'A' + genericAliasTag = 'B' + typeParamTag = 'P' + typeTag = 'T' + genericTypeTag = 'U' ) // IImportData imports a package from the serialized package data @@ -85,7 +101,7 @@ const ( // If the export data version is not recognized or the format is otherwise // compromised, an error is returned. func IImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (int, *types.Package, error) { - pkgs, err := iimportCommon(fset, GetPackageFromMap(imports), data, false, path, nil) + pkgs, err := iimportCommon(fset, GetPackagesFromMap(imports), data, false, path, false, nil) if err != nil { return 0, nil, err } @@ -94,33 +110,49 @@ func IImportData(fset *token.FileSet, imports map[string]*types.Package, data [] // IImportBundle imports a set of packages from the serialized package bundle. func IImportBundle(fset *token.FileSet, imports map[string]*types.Package, data []byte) ([]*types.Package, error) { - return iimportCommon(fset, GetPackageFromMap(imports), data, true, "", nil) + return iimportCommon(fset, GetPackagesFromMap(imports), data, true, "", false, nil) } -// A GetPackageFunc is a function that gets the package with the given path -// from the importer state, creating it (with the specified name) if necessary. -// It is an abstraction of the map historically used to memoize package creation. -// -// Two calls with the same path must return the same package. +// A GetPackagesFunc function obtains the non-nil symbols for a set of +// packages, creating and recursively importing them as needed. An +// implementation should store each package symbol is in the Pkg +// field of the items array. // -// If the given getPackage func returns nil, the import will fail. -type GetPackageFunc = func(path, name string) *types.Package +// Any error causes importing to fail. This can be used to quickly read +// the import manifest of an export data file without fully decoding it. +type GetPackagesFunc = func(items []GetPackagesItem) error + +// A GetPackagesItem is a request from the importer for the package +// symbol of the specified name and path. +type GetPackagesItem struct { + Name, Path string + Pkg *types.Package // to be filled in by GetPackagesFunc call + + // private importer state + pathOffset uint64 + nameIndex map[string]uint64 +} -// GetPackageFromMap returns a GetPackageFunc that retrieves packages from the -// given map of package path -> package. +// GetPackagesFromMap returns a GetPackagesFunc that retrieves +// packages from the given map of package path to package. // -// The resulting func may mutate m: if a requested package is not found, a new -// package will be inserted into m. -func GetPackageFromMap(m map[string]*types.Package) GetPackageFunc { - return func(path, name string) *types.Package { - if _, ok := m[path]; !ok { - m[path] = types.NewPackage(path, name) +// The returned function may mutate m: each requested package that is not +// found is created with types.NewPackage and inserted into m. +func GetPackagesFromMap(m map[string]*types.Package) GetPackagesFunc { + return func(items []GetPackagesItem) error { + for i, item := range items { + pkg, ok := m[item.Path] + if !ok { + pkg = types.NewPackage(item.Path, item.Name) + m[item.Path] = pkg + } + items[i].Pkg = pkg } - return m[path] + return nil } } -func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, bundle bool, path string, insert InsertType) (pkgs []*types.Package, err error) { +func iimportCommon(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, bundle bool, path string, shallow bool, reportf ReportFunc) (pkgs []*types.Package, err error) { const currentVersion = iexportVersionCurrent version := int64(-1) if !debug { @@ -159,7 +191,7 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, sLen := int64(r.uint64()) var fLen int64 var fileOffset []uint64 - if insert != nil { + if shallow { // Shallow mode uses a different position encoding. fLen = int64(r.uint64()) fileOffset = make([]uint64, r.uint64()) @@ -178,7 +210,9 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, p := iimporter{ version: int(version), ipath: path, - insert: insert, + aliases: aliases.Enabled(), + shallow: shallow, + reportf: reportf, stringData: stringData, stringCache: make(map[uint64]string), @@ -205,8 +239,10 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, p.typCache[uint64(i)] = pt } - pkgList := make([]*types.Package, r.uint64()) - for i := range pkgList { + // Gather the relevant packages from the manifest. + items := make([]GetPackagesItem, r.uint64()) + uniquePkgPaths := make(map[string]bool) + for i := range items { pkgPathOff := r.uint64() pkgPath := p.stringAt(pkgPathOff) pkgName := p.stringAt(r.uint64()) @@ -215,29 +251,48 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, if pkgPath == "" { pkgPath = path } - pkg := getPackage(pkgPath, pkgName) - if pkg == nil { - errorf("internal error: getPackage returned nil package for %s", pkgPath) - } else if pkg.Name() != pkgName { - errorf("conflicting names %s and %s for package %q", pkg.Name(), pkgName, path) - } - if i == 0 && !bundle { - p.localpkg = pkg - } - - p.pkgCache[pkgPathOff] = pkg + items[i].Name = pkgName + items[i].Path = pkgPath + items[i].pathOffset = pkgPathOff // Read index for package. nameIndex := make(map[string]uint64) nSyms := r.uint64() - // In shallow mode we don't expect an index for other packages. - assert(nSyms == 0 || p.localpkg == pkg || p.insert == nil) + // In shallow mode, only the current package (i=0) has an index. + assert(!(shallow && i > 0 && nSyms != 0)) for ; nSyms > 0; nSyms-- { name := p.stringAt(r.uint64()) nameIndex[name] = r.uint64() } - p.pkgIndex[pkg] = nameIndex + items[i].nameIndex = nameIndex + + uniquePkgPaths[pkgPath] = true + } + // Debugging #63822; hypothesis: there are duplicate PkgPaths. + if len(uniquePkgPaths) != len(items) { + reportf("found duplicate PkgPaths while reading export data manifest: %v", items) + } + + // Request packages all at once from the client, + // enabling a parallel implementation. + if err := getPackages(items); err != nil { + return nil, err // don't wrap this error + } + + // Check the results and complete the index. + pkgList := make([]*types.Package, len(items)) + for i, item := range items { + pkg := item.Pkg + if pkg == nil { + errorf("internal error: getPackages returned nil package for %q", item.Path) + } else if pkg.Path() != item.Path { + errorf("internal error: getPackages returned wrong path %q, want %q", pkg.Path(), item.Path) + } else if pkg.Name() != item.Name { + errorf("internal error: getPackages returned wrong name %s for package %q, want %s", pkg.Name(), item.Path, item.Name) + } + p.pkgCache[item.pathOffset] = pkg + p.pkgIndex[pkg] = item.nameIndex pkgList[i] = pkg } @@ -284,23 +339,30 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, } // SetConstraint can't be called if the constraint type is not yet complete. - // When type params are created in the 'P' case of (*importReader).obj(), + // When type params are created in the typeParamTag case of (*importReader).obj(), // the associated constraint type may not be complete due to recursion. // Therefore, we defer calling SetConstraint there, and call it here instead // after all types are complete. for _, d := range p.later { - typeparams.SetTypeParamConstraint(d.t, d.constraint) + d.t.SetConstraint(d.constraint) } for _, typ := range p.interfaceList { typ.Complete() } + // Workaround for golang/go#61561. See the doc for instanceList for details. + for _, typ := range p.instanceList { + if iface, _ := typ.Underlying().(*types.Interface); iface != nil { + iface.Complete() + } + } + return pkgs, nil } type setConstraintArgs struct { - t *typeparams.TypeParam + t *types.TypeParam constraint types.Type } @@ -308,8 +370,9 @@ type iimporter struct { version int ipath string - localpkg *types.Package - insert func(pkg *types.Package, name string) // "shallow" mode only + aliases bool + shallow bool + reportf ReportFunc // if non-nil, used to report bugs stringData []byte stringCache map[uint64]string @@ -326,6 +389,12 @@ type iimporter struct { fake fakeFileSet interfaceList []*types.Interface + // Workaround for the go/types bug golang/go#61561: instances produced during + // instantiation may contain incomplete interfaces. Here we only complete the + // underlying type of the instance, which is the most common case but doesn't + // handle parameterized interface literals defined deeper in the type. + instanceList []types.Type // instances for later completion (see golang/go#61561) + // Arguments for calls to SetConstraint that are deferred due to recursive types later []setConstraintArgs @@ -357,13 +426,9 @@ func (p *iimporter) doDecl(pkg *types.Package, name string) { off, ok := p.pkgIndex[pkg][name] if !ok { - // In "shallow" mode, call back to the application to - // find the object and insert it into the package scope. - if p.insert != nil { - assert(pkg != p.localpkg) - p.insert(pkg, name) // "can't fail" - return - } + // In deep mode, the index should be complete. In shallow + // mode, we should have already recursively loaded necessary + // dependencies so the above Lookup succeeds. errorf("%v.%v not in index", pkg, name) } @@ -475,7 +540,7 @@ func canReuse(def *types.Named, rhs types.Type) bool { if def == nil { return true } - iface, _ := rhs.(*types.Interface) + iface, _ := aliases.Unalias(rhs).(*types.Interface) if iface == nil { return true } @@ -497,25 +562,29 @@ func (r *importReader) obj(name string) { pos := r.pos() switch tag { - case 'A': + case aliasTag: typ := r.typ() - - r.declare(types.NewTypeName(pos, r.currPkg, name, typ)) - - case 'C': + // TODO(adonovan): support generic aliases: + // if tag == genericAliasTag { + // tparams := r.tparamList() + // alias.SetTypeParams(tparams) + // } + r.declare(aliases.NewAlias(r.p.aliases, pos, r.currPkg, name, typ)) + + case constTag: typ, val := r.value() r.declare(types.NewConst(pos, r.currPkg, name, typ, val)) - case 'F', 'G': - var tparams []*typeparams.TypeParam - if tag == 'G' { + case funcTag, genericFuncTag: + var tparams []*types.TypeParam + if tag == genericFuncTag { tparams = r.tparamList() } sig := r.signature(nil, nil, tparams) r.declare(types.NewFunc(pos, r.currPkg, name, sig)) - case 'T', 'U': + case typeTag, genericTypeTag: // Types can be recursive. We need to setup a stub // declaration before recursing. obj := types.NewTypeName(pos, r.currPkg, name, nil) @@ -523,9 +592,9 @@ func (r *importReader) obj(name string) { // Declare obj before calling r.tparamList, so the new type name is recognized // if used in the constraint of one of its own typeparams (see #48280). r.declare(obj) - if tag == 'U' { + if tag == genericTypeTag { tparams := r.tparamList() - typeparams.SetForNamed(named, tparams) + named.SetTypeParams(tparams) } underlying := r.p.typAt(r.uint64(), named).Underlying() @@ -540,14 +609,13 @@ func (r *importReader) obj(name string) { // If the receiver has any targs, set those as the // rparams of the method (since those are the // typeparams being used in the method sig/body). - base := baseType(recv.Type()) - assert(base != nil) - targs := typeparams.NamedTypeArgs(base) - var rparams []*typeparams.TypeParam + _, recvNamed := typesinternal.ReceiverNamed(recv) + targs := recvNamed.TypeArgs() + var rparams []*types.TypeParam if targs.Len() > 0 { - rparams = make([]*typeparams.TypeParam, targs.Len()) + rparams = make([]*types.TypeParam, targs.Len()) for i := range rparams { - rparams[i] = targs.At(i).(*typeparams.TypeParam) + rparams[i] = aliases.Unalias(targs.At(i)).(*types.TypeParam) } } msig := r.signature(recv, rparams, nil) @@ -556,7 +624,7 @@ func (r *importReader) obj(name string) { } } - case 'P': + case typeParamTag: // We need to "declare" a typeparam in order to have a name that // can be referenced recursively (if needed) in the type param's // bound. @@ -565,7 +633,7 @@ func (r *importReader) obj(name string) { } name0 := tparamName(name) tn := types.NewTypeName(pos, r.currPkg, name0, nil) - t := typeparams.NewTypeParam(tn, nil) + t := types.NewTypeParam(tn, nil) // To handle recursive references to the typeparam within its // bound, save the partial type in tparamIndex before reading the bounds. @@ -577,11 +645,11 @@ func (r *importReader) obj(name string) { } constraint := r.typ() if implicit { - iface, _ := constraint.(*types.Interface) + iface, _ := aliases.Unalias(constraint).(*types.Interface) if iface == nil { errorf("non-interface constraint marked implicit") } - typeparams.MarkImplicit(iface) + iface.MarkImplicit() } // The constraint type may not be complete, if we // are in the middle of a type recursion involving type @@ -589,7 +657,7 @@ func (r *importReader) obj(name string) { // completely set up all types in ImportData. r.p.later = append(r.p.later, setConstraintArgs{t: t, constraint: constraint}) - case 'V': + case varTag: typ := r.typ() r.declare(types.NewVar(pos, r.currPkg, name, typ)) @@ -730,7 +798,8 @@ func (r *importReader) qualifiedIdent() (*types.Package, string) { } func (r *importReader) pos() token.Pos { - if r.p.insert != nil { // shallow mode + if r.p.shallow { + // precise offsets are encoded only in shallow mode return r.posv2() } if r.p.version >= iexportVersionPosCol { @@ -783,7 +852,7 @@ func (r *importReader) typ() types.Type { } func isInterface(t types.Type) bool { - _, ok := t.(*types.Interface) + _, ok := aliases.Unalias(t).(*types.Interface) return ok } @@ -805,7 +874,7 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { errorf("unexpected kind tag in %q: %v", r.p.ipath, k) return nil - case definedType: + case aliasType, definedType: pkg, name := r.qualifiedIdent() r.p.doDecl(pkg, name) return pkg.Scope().Lookup(name).(*types.TypeName).Type() @@ -831,13 +900,28 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { fields := make([]*types.Var, r.uint64()) tags := make([]string, len(fields)) for i := range fields { + var field *types.Var + if r.p.shallow { + field, _ = r.objectPathObject().(*types.Var) + } + fpos := r.pos() fname := r.ident() ftyp := r.typ() emb := r.bool() tag := r.string() - fields[i] = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + // Either this is not a shallow import, the field is local, or the + // encoded objectPath failed to produce an object (a bug). + // + // Even in this last, buggy case, fall back on creating a new field. As + // discussed in iexport.go, this is not correct, but mostly works and is + // preferable to failing (for now at least). + if field == nil { + field = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + } + + fields[i] = field tags[i] = tag } return types.NewStruct(fields, tags) @@ -853,6 +937,11 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { methods := make([]*types.Func, r.uint64()) for i := range methods { + var method *types.Func + if r.p.shallow { + method, _ = r.objectPathObject().(*types.Func) + } + mpos := r.pos() mname := r.ident() @@ -862,9 +951,12 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { if base != nil { recv = types.NewVar(token.NoPos, r.currPkg, "", base) } - msig := r.signature(recv, nil, nil) - methods[i] = types.NewFunc(mpos, r.currPkg, mname, msig) + + if method == nil { + method = types.NewFunc(mpos, r.currPkg, mname, msig) + } + methods[i] = method } typ := newInterface(methods, embeddeds) @@ -901,18 +993,21 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { // The imported instantiated type doesn't include any methods, so // we must always use the methods of the base (orig) type. // TODO provide a non-nil *Environment - t, _ := typeparams.Instantiate(nil, baseType, targs, false) + t, _ := types.Instantiate(nil, baseType, targs, false) + + // Workaround for golang/go#61561. See the doc for instanceList for details. + r.p.instanceList = append(r.p.instanceList, t) return t case unionType: if r.p.version < iexportVersionGenerics { errorf("unexpected instantiation type") } - terms := make([]*typeparams.Term, r.uint64()) + terms := make([]*types.Term, r.uint64()) for i := range terms { - terms[i] = typeparams.NewTerm(r.bool(), r.typ()) + terms[i] = types.NewTerm(r.bool(), r.typ()) } - return typeparams.NewUnion(terms) + return types.NewUnion(terms) } } @@ -920,23 +1015,43 @@ func (r *importReader) kind() itag { return itag(r.uint64()) } -func (r *importReader) signature(recv *types.Var, rparams []*typeparams.TypeParam, tparams []*typeparams.TypeParam) *types.Signature { +// objectPathObject is the inverse of exportWriter.objectPath. +// +// In shallow mode, certain fields and methods may need to be looked up in an +// imported package. See the doc for exportWriter.objectPath for a full +// explanation. +func (r *importReader) objectPathObject() types.Object { + objPath := objectpath.Path(r.string()) + if objPath == "" { + return nil + } + pkg := r.pkg() + obj, err := objectpath.Object(pkg, objPath) + if err != nil { + if r.p.reportf != nil { + r.p.reportf("failed to find object for objectPath %q: %v", objPath, err) + } + } + return obj +} + +func (r *importReader) signature(recv *types.Var, rparams []*types.TypeParam, tparams []*types.TypeParam) *types.Signature { params := r.paramList() results := r.paramList() variadic := params.Len() > 0 && r.bool() - return typeparams.NewSignatureType(recv, rparams, tparams, params, results, variadic) + return types.NewSignatureType(recv, rparams, tparams, params, results, variadic) } -func (r *importReader) tparamList() []*typeparams.TypeParam { +func (r *importReader) tparamList() []*types.TypeParam { n := r.uint64() if n == 0 { return nil } - xs := make([]*typeparams.TypeParam, n) + xs := make([]*types.TypeParam, n) for i := range xs { // Note: the standard library importer is tolerant of nil types here, // though would panic in SetTypeParams. - xs[i] = r.typ().(*typeparams.TypeParam) + xs[i] = aliases.Unalias(r.typ()).(*types.TypeParam) } return xs } @@ -983,13 +1098,3 @@ func (r *importReader) byte() byte { } return x } - -func baseType(typ types.Type) *types.Named { - // pointer receivers are never types.Named types - if p, _ := typ.(*types.Pointer); p != nil { - typ = p.Elem() - } - // receiver base types are always (possibly generic) types.Named types - n, _ := typ.(*types.Named) - return n -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/support_go117.go b/vendor/golang.org/x/tools/internal/gcimporter/support_go117.go deleted file mode 100644 index d892273..0000000 --- a/vendor/golang.org/x/tools/internal/gcimporter/support_go117.go +++ /dev/null @@ -1,16 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package gcimporter - -import "go/types" - -const iexportVersion = iexportVersionGo1_11 - -func additionalPredeclared() []types.Type { - return nil -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go b/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go index edbe6ea..0cd3b91 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go @@ -2,9 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.18 -// +build go1.18 - package gcimporter import "go/types" diff --git a/vendor/golang.org/x/tools/internal/gcimporter/unified_no.go b/vendor/golang.org/x/tools/internal/gcimporter/unified_no.go index 286bf44..38b624c 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/unified_no.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/unified_no.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !(go1.18 && goexperiment.unified) -// +build !go1.18 !goexperiment.unified +//go:build !goexperiment.unified +// +build !goexperiment.unified package gcimporter diff --git a/vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go index b5d69ff..b5118d0 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.18 && goexperiment.unified -// +build go1.18,goexperiment.unified +//go:build goexperiment.unified +// +build goexperiment.unified package gcimporter diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go deleted file mode 100644 index 8eb2072..0000000 --- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go +++ /dev/null @@ -1,19 +0,0 @@ -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package gcimporter - -import ( - "fmt" - "go/token" - "go/types" -) - -func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { - err = fmt.Errorf("go/tools compiled with a Go version earlier than 1.18 cannot read unified IR export data") - return -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go index b977435..2c07706 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go @@ -4,9 +4,6 @@ // Derived from go/internal/gcimporter/ureader.go -//go:build go1.18 -// +build go1.18 - package gcimporter import ( @@ -16,6 +13,7 @@ import ( "sort" "strings" + "golang.org/x/tools/internal/aliases" "golang.org/x/tools/internal/pkgbits" ) @@ -28,6 +26,7 @@ type pkgReader struct { ctxt *types.Context imports map[string]*types.Package // previously imported packages, indexed by path + aliases bool // create types.Alias nodes // lazily initialized arrays corresponding to the unified IR // PosBase, Pkg, and Type sections, respectively. @@ -101,6 +100,7 @@ func readUnifiedPackage(fset *token.FileSet, ctxt *types.Context, imports map[st ctxt: ctxt, imports: imports, + aliases: aliases.Enabled(), posBases: make([]string, input.NumElems(pkgbits.RelocPosBase)), pkgs: make([]*types.Package, input.NumElems(pkgbits.RelocPkg)), @@ -526,7 +526,7 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types.Package, string) { case pkgbits.ObjAlias: pos := r.pos() typ := r.typ() - declare(types.NewTypeName(pos, objPkg, objName, typ)) + declare(aliases.NewAlias(r.p.aliases, pos, objPkg, objName, typ)) case pkgbits.ObjConst: pos := r.pos() @@ -553,7 +553,7 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types.Package, string) { // If the underlying type is an interface, we need to // duplicate its methods so we can replace the receiver // parameter's type (#49906). - if iface, ok := underlying.(*types.Interface); ok && iface.NumExplicitMethods() != 0 { + if iface, ok := aliases.Unalias(underlying).(*types.Interface); ok && iface.NumExplicitMethods() != 0 { methods := make([]*types.Func, iface.NumExplicitMethods()) for i := range methods { fn := iface.ExplicitMethod(i) diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go index 8d9fc98..eb7a828 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go +++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go @@ -13,6 +13,7 @@ import ( "io" "log" "os" + "os/exec" "reflect" "regexp" "runtime" @@ -21,12 +22,9 @@ import ( "sync" "time" - exec "golang.org/x/sys/execabs" - "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/event/keys" "golang.org/x/tools/internal/event/label" - "golang.org/x/tools/internal/event/tag" ) // An Runner will run go command invocations and serialize @@ -56,11 +54,14 @@ func (runner *Runner) initialize() { // 1.14: go: updating go.mod: existing contents have changed since last read var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`) -// verb is an event label for the go command verb. -var verb = keys.NewString("verb", "go command verb") +// event keys for go command invocations +var ( + verb = keys.NewString("verb", "go command verb") + directory = keys.NewString("directory", "") +) func invLabels(inv Invocation) []label.Label { - return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)} + return []label.Label{verb.Of(inv.Verb), directory.Of(inv.WorkingDir)} } // Run is a convenience wrapper around RunRaw. @@ -85,6 +86,7 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde // RunRaw runs the invocation, serializing requests only if they fight over // go.mod changes. +// Postcondition: both error results have same nilness. func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...) defer done() @@ -95,23 +97,24 @@ func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer stdout, stderr, friendlyErr, err := runner.runConcurrent(ctx, inv) // If we encounter a load concurrency error, we need to retry serially. - if friendlyErr == nil || !modConcurrencyError.MatchString(friendlyErr.Error()) { - return stdout, stderr, friendlyErr, err + if friendlyErr != nil && modConcurrencyError.MatchString(friendlyErr.Error()) { + event.Error(ctx, "Load concurrency error, will retry serially", err) + + // Run serially by calling runPiped. + stdout.Reset() + stderr.Reset() + friendlyErr, err = runner.runPiped(ctx, inv, stdout, stderr) } - event.Error(ctx, "Load concurrency error, will retry serially", err) - // Run serially by calling runPiped. - stdout.Reset() - stderr.Reset() - friendlyErr, err = runner.runPiped(ctx, inv, stdout, stderr) return stdout, stderr, friendlyErr, err } +// Postcondition: both error results have same nilness. func (runner *Runner) runConcurrent(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { // Wait for 1 worker to become available. select { case <-ctx.Done(): - return nil, nil, nil, ctx.Err() + return nil, nil, ctx.Err(), ctx.Err() case runner.inFlight <- struct{}{}: defer func() { <-runner.inFlight }() } @@ -121,6 +124,7 @@ func (runner *Runner) runConcurrent(ctx context.Context, inv Invocation) (*bytes return stdout, stderr, friendlyErr, err } +// Postcondition: both error results have same nilness. func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) (error, error) { // Make sure the runner is always initialized. runner.initialize() @@ -129,7 +133,7 @@ func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stde // runPiped commands. select { case <-ctx.Done(): - return nil, ctx.Err() + return ctx.Err(), ctx.Err() case runner.serialized <- struct{}{}: defer func() { <-runner.serialized }() } @@ -139,7 +143,7 @@ func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stde for i := 0; i < maxInFlight; i++ { select { case <-ctx.Done(): - return nil, ctx.Err() + return ctx.Err(), ctx.Err() case runner.inFlight <- struct{}{}: // Make sure we always "return" any workers we took. defer func() { <-runner.inFlight }() @@ -156,12 +160,15 @@ type Invocation struct { BuildFlags []string // If ModFlag is set, the go command is invoked with -mod=ModFlag. + // TODO(rfindley): remove, in favor of Args. ModFlag string // If ModFile is set, the go command is invoked with -modfile=ModFile. + // TODO(rfindley): remove, in favor of Args. ModFile string // If Overlay is set, the go command is invoked with -overlay=Overlay. + // TODO(rfindley): remove, in favor of Args. Overlay string // If CleanEnv is set, the invocation will run only with the environment @@ -172,6 +179,7 @@ type Invocation struct { Logf func(format string, args ...interface{}) } +// Postcondition: both error results have same nilness. func (i *Invocation) runWithFriendlyError(ctx context.Context, stdout, stderr io.Writer) (friendlyError error, rawError error) { rawError = i.run(ctx, stdout, stderr) if rawError != nil { @@ -319,7 +327,7 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) { // Per https://pkg.go.dev/os#File.Close, the call to stdoutR.Close // should cause the Read call in io.Copy to unblock and return // immediately, but we still need to receive from stdoutErr to confirm - // that that has happened. + // that it has happened. <-stdoutErr err2 = ctx.Err() } @@ -333,7 +341,7 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) { // one goroutine at a time will call Write.” // // Since we're starting a goroutine that writes to cmd.Stdout, we must - // also update cmd.Stderr so that that still holds. + // also update cmd.Stderr so that it still holds. func() { defer func() { recover() }() if cmd.Stderr == prevStdout { diff --git a/vendor/golang.org/x/tools/internal/gocommand/vendor.go b/vendor/golang.org/x/tools/internal/gocommand/vendor.go index 2d3d408..e38d1fb 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/vendor.go +++ b/vendor/golang.org/x/tools/internal/gocommand/vendor.go @@ -107,3 +107,57 @@ func getMainModuleAnd114(ctx context.Context, inv Invocation, r *Runner) (*Modul } return mod, lines[4] == "go1.14", nil } + +// WorkspaceVendorEnabled reports whether workspace vendoring is enabled. It takes a *Runner to execute Go commands +// with the supplied context.Context and Invocation. The Invocation can contain pre-defined fields, +// of which only Verb and Args are modified to run the appropriate Go command. +// Inspired by setDefaultBuildMod in modload/init.go +func WorkspaceVendorEnabled(ctx context.Context, inv Invocation, r *Runner) (bool, []*ModuleJSON, error) { + inv.Verb = "env" + inv.Args = []string{"GOWORK"} + stdout, err := r.Run(ctx, inv) + if err != nil { + return false, nil, err + } + goWork := string(bytes.TrimSpace(stdout.Bytes())) + if fi, err := os.Stat(filepath.Join(filepath.Dir(goWork), "vendor")); err == nil && fi.IsDir() { + mainMods, err := getWorkspaceMainModules(ctx, inv, r) + if err != nil { + return false, nil, err + } + return true, mainMods, nil + } + return false, nil, nil +} + +// getWorkspaceMainModules gets the main modules' information. +// This is the information needed to figure out if vendoring should be enabled. +func getWorkspaceMainModules(ctx context.Context, inv Invocation, r *Runner) ([]*ModuleJSON, error) { + const format = `{{.Path}} +{{.Dir}} +{{.GoMod}} +{{.GoVersion}} +` + inv.Verb = "list" + inv.Args = []string{"-m", "-f", format} + stdout, err := r.Run(ctx, inv) + if err != nil { + return nil, err + } + + lines := strings.Split(strings.TrimSuffix(stdout.String(), "\n"), "\n") + if len(lines) < 4 { + return nil, fmt.Errorf("unexpected stdout: %q", stdout.String()) + } + mods := make([]*ModuleJSON, 0, len(lines)/4) + for i := 0; i < len(lines); i += 4 { + mods = append(mods, &ModuleJSON{ + Path: lines[i], + Dir: lines[i+1], + GoMod: lines[i+2], + GoVersion: lines[i+3], + Main: true, + }) + } + return mods, nil +} diff --git a/vendor/golang.org/x/tools/internal/packagesinternal/packages.go b/vendor/golang.org/x/tools/internal/packagesinternal/packages.go index d9950b1..44719de 100644 --- a/vendor/golang.org/x/tools/internal/packagesinternal/packages.go +++ b/vendor/golang.org/x/tools/internal/packagesinternal/packages.go @@ -5,10 +5,6 @@ // Package packagesinternal exposes internal-only fields from go/packages. package packagesinternal -import ( - "golang.org/x/tools/internal/gocommand" -) - var GetForTest = func(p interface{}) string { return "" } var GetDepsErrors = func(p interface{}) []*PackageError { return nil } @@ -18,10 +14,6 @@ type PackageError struct { Err string // the error itself } -var GetGoCmdRunner = func(config interface{}) *gocommand.Runner { return nil } - -var SetGoCmdRunner = func(config interface{}, runner *gocommand.Runner) {} - var TypecheckCgo int var DepsErrors int // must be set as a LoadMode to call GetDepsErrors var ForTest int // must be set as a LoadMode to call GetForTest diff --git a/vendor/golang.org/x/tools/internal/pkgbits/decoder.go b/vendor/golang.org/x/tools/internal/pkgbits/decoder.go index b92e8e6..2acd858 100644 --- a/vendor/golang.org/x/tools/internal/pkgbits/decoder.go +++ b/vendor/golang.org/x/tools/internal/pkgbits/decoder.go @@ -23,6 +23,9 @@ type PkgDecoder struct { // version is the file format version. version uint32 + // aliases determines whether types.Aliases should be created + aliases bool + // sync indicates whether the file uses sync markers. sync bool @@ -73,6 +76,7 @@ func (pr *PkgDecoder) SyncMarkers() bool { return pr.sync } func NewPkgDecoder(pkgPath, input string) PkgDecoder { pr := PkgDecoder{ pkgPath: pkgPath, + //aliases: aliases.Enabled(), } // TODO(mdempsky): Implement direct indexing of input string to diff --git a/vendor/golang.org/x/tools/internal/stdlib/manifest.go b/vendor/golang.org/x/tools/internal/stdlib/manifest.go new file mode 100644 index 0000000..fd68920 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/stdlib/manifest.go @@ -0,0 +1,17320 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Code generated by generate.go. DO NOT EDIT. + +package stdlib + +var PackageSymbols = map[string][]Symbol{ + "archive/tar": { + {"(*Header).FileInfo", Method, 1}, + {"(*Reader).Next", Method, 0}, + {"(*Reader).Read", Method, 0}, + {"(*Writer).AddFS", Method, 22}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).Flush", Method, 0}, + {"(*Writer).Write", Method, 0}, + {"(*Writer).WriteHeader", Method, 0}, + {"(Format).String", Method, 10}, + {"ErrFieldTooLong", Var, 0}, + {"ErrHeader", Var, 0}, + {"ErrInsecurePath", Var, 20}, + {"ErrWriteAfterClose", Var, 0}, + {"ErrWriteTooLong", Var, 0}, + {"FileInfoHeader", Func, 1}, + {"Format", Type, 10}, + {"FormatGNU", Const, 10}, + {"FormatPAX", Const, 10}, + {"FormatUSTAR", Const, 10}, + {"FormatUnknown", Const, 10}, + {"Header", Type, 0}, + {"Header.AccessTime", Field, 0}, + {"Header.ChangeTime", Field, 0}, + {"Header.Devmajor", Field, 0}, + {"Header.Devminor", Field, 0}, + {"Header.Format", Field, 10}, + {"Header.Gid", Field, 0}, + {"Header.Gname", Field, 0}, + {"Header.Linkname", Field, 0}, + {"Header.ModTime", Field, 0}, + {"Header.Mode", Field, 0}, + {"Header.Name", Field, 0}, + {"Header.PAXRecords", Field, 10}, + {"Header.Size", Field, 0}, + {"Header.Typeflag", Field, 0}, + {"Header.Uid", Field, 0}, + {"Header.Uname", Field, 0}, + {"Header.Xattrs", Field, 3}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"Reader", Type, 0}, + {"TypeBlock", Const, 0}, + {"TypeChar", Const, 0}, + {"TypeCont", Const, 0}, + {"TypeDir", Const, 0}, + {"TypeFifo", Const, 0}, + {"TypeGNULongLink", Const, 1}, + {"TypeGNULongName", Const, 1}, + {"TypeGNUSparse", Const, 3}, + {"TypeLink", Const, 0}, + {"TypeReg", Const, 0}, + {"TypeRegA", Const, 0}, + {"TypeSymlink", Const, 0}, + {"TypeXGlobalHeader", Const, 0}, + {"TypeXHeader", Const, 0}, + {"Writer", Type, 0}, + }, + "archive/zip": { + {"(*File).DataOffset", Method, 2}, + {"(*File).FileInfo", Method, 0}, + {"(*File).ModTime", Method, 0}, + {"(*File).Mode", Method, 0}, + {"(*File).Open", Method, 0}, + {"(*File).OpenRaw", Method, 17}, + {"(*File).SetModTime", Method, 0}, + {"(*File).SetMode", Method, 0}, + {"(*FileHeader).FileInfo", Method, 0}, + {"(*FileHeader).ModTime", Method, 0}, + {"(*FileHeader).Mode", Method, 0}, + {"(*FileHeader).SetModTime", Method, 0}, + {"(*FileHeader).SetMode", Method, 0}, + {"(*ReadCloser).Close", Method, 0}, + {"(*ReadCloser).Open", Method, 16}, + {"(*ReadCloser).RegisterDecompressor", Method, 6}, + {"(*Reader).Open", Method, 16}, + {"(*Reader).RegisterDecompressor", Method, 6}, + {"(*Writer).AddFS", Method, 22}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).Copy", Method, 17}, + {"(*Writer).Create", Method, 0}, + {"(*Writer).CreateHeader", Method, 0}, + {"(*Writer).CreateRaw", Method, 17}, + {"(*Writer).Flush", Method, 4}, + {"(*Writer).RegisterCompressor", Method, 6}, + {"(*Writer).SetComment", Method, 10}, + {"(*Writer).SetOffset", Method, 5}, + {"Compressor", Type, 2}, + {"Decompressor", Type, 2}, + {"Deflate", Const, 0}, + {"ErrAlgorithm", Var, 0}, + {"ErrChecksum", Var, 0}, + {"ErrFormat", Var, 0}, + {"ErrInsecurePath", Var, 20}, + {"File", Type, 0}, + {"File.FileHeader", Field, 0}, + {"FileHeader", Type, 0}, + {"FileHeader.CRC32", Field, 0}, + {"FileHeader.Comment", Field, 0}, + {"FileHeader.CompressedSize", Field, 0}, + {"FileHeader.CompressedSize64", Field, 1}, + {"FileHeader.CreatorVersion", Field, 0}, + {"FileHeader.ExternalAttrs", Field, 0}, + {"FileHeader.Extra", Field, 0}, + {"FileHeader.Flags", Field, 0}, + {"FileHeader.Method", Field, 0}, + {"FileHeader.Modified", Field, 10}, + {"FileHeader.ModifiedDate", Field, 0}, + {"FileHeader.ModifiedTime", Field, 0}, + {"FileHeader.Name", Field, 0}, + {"FileHeader.NonUTF8", Field, 10}, + {"FileHeader.ReaderVersion", Field, 0}, + {"FileHeader.UncompressedSize", Field, 0}, + {"FileHeader.UncompressedSize64", Field, 1}, + {"FileInfoHeader", Func, 0}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"OpenReader", Func, 0}, + {"ReadCloser", Type, 0}, + {"ReadCloser.Reader", Field, 0}, + {"Reader", Type, 0}, + {"Reader.Comment", Field, 0}, + {"Reader.File", Field, 0}, + {"RegisterCompressor", Func, 2}, + {"RegisterDecompressor", Func, 2}, + {"Store", Const, 0}, + {"Writer", Type, 0}, + }, + "bufio": { + {"(*Reader).Buffered", Method, 0}, + {"(*Reader).Discard", Method, 5}, + {"(*Reader).Peek", Method, 0}, + {"(*Reader).Read", Method, 0}, + {"(*Reader).ReadByte", Method, 0}, + {"(*Reader).ReadBytes", Method, 0}, + {"(*Reader).ReadLine", Method, 0}, + {"(*Reader).ReadRune", Method, 0}, + {"(*Reader).ReadSlice", Method, 0}, + {"(*Reader).ReadString", Method, 0}, + {"(*Reader).Reset", Method, 2}, + {"(*Reader).Size", Method, 10}, + {"(*Reader).UnreadByte", Method, 0}, + {"(*Reader).UnreadRune", Method, 0}, + {"(*Reader).WriteTo", Method, 1}, + {"(*Scanner).Buffer", Method, 6}, + {"(*Scanner).Bytes", Method, 1}, + {"(*Scanner).Err", Method, 1}, + {"(*Scanner).Scan", Method, 1}, + {"(*Scanner).Split", Method, 1}, + {"(*Scanner).Text", Method, 1}, + {"(*Writer).Available", Method, 0}, + {"(*Writer).AvailableBuffer", Method, 18}, + {"(*Writer).Buffered", Method, 0}, + {"(*Writer).Flush", Method, 0}, + {"(*Writer).ReadFrom", Method, 1}, + {"(*Writer).Reset", Method, 2}, + {"(*Writer).Size", Method, 10}, + {"(*Writer).Write", Method, 0}, + {"(*Writer).WriteByte", Method, 0}, + {"(*Writer).WriteRune", Method, 0}, + {"(*Writer).WriteString", Method, 0}, + {"(ReadWriter).Available", Method, 0}, + {"(ReadWriter).AvailableBuffer", Method, 18}, + {"(ReadWriter).Discard", Method, 5}, + {"(ReadWriter).Flush", Method, 0}, + {"(ReadWriter).Peek", Method, 0}, + {"(ReadWriter).Read", Method, 0}, + {"(ReadWriter).ReadByte", Method, 0}, + {"(ReadWriter).ReadBytes", Method, 0}, + {"(ReadWriter).ReadFrom", Method, 1}, + {"(ReadWriter).ReadLine", Method, 0}, + {"(ReadWriter).ReadRune", Method, 0}, + {"(ReadWriter).ReadSlice", Method, 0}, + {"(ReadWriter).ReadString", Method, 0}, + {"(ReadWriter).UnreadByte", Method, 0}, + {"(ReadWriter).UnreadRune", Method, 0}, + {"(ReadWriter).Write", Method, 0}, + {"(ReadWriter).WriteByte", Method, 0}, + {"(ReadWriter).WriteRune", Method, 0}, + {"(ReadWriter).WriteString", Method, 0}, + {"(ReadWriter).WriteTo", Method, 1}, + {"ErrAdvanceTooFar", Var, 1}, + {"ErrBadReadCount", Var, 15}, + {"ErrBufferFull", Var, 0}, + {"ErrFinalToken", Var, 6}, + {"ErrInvalidUnreadByte", Var, 0}, + {"ErrInvalidUnreadRune", Var, 0}, + {"ErrNegativeAdvance", Var, 1}, + {"ErrNegativeCount", Var, 0}, + {"ErrTooLong", Var, 1}, + {"MaxScanTokenSize", Const, 1}, + {"NewReadWriter", Func, 0}, + {"NewReader", Func, 0}, + {"NewReaderSize", Func, 0}, + {"NewScanner", Func, 1}, + {"NewWriter", Func, 0}, + {"NewWriterSize", Func, 0}, + {"ReadWriter", Type, 0}, + {"ReadWriter.Reader", Field, 0}, + {"ReadWriter.Writer", Field, 0}, + {"Reader", Type, 0}, + {"ScanBytes", Func, 1}, + {"ScanLines", Func, 1}, + {"ScanRunes", Func, 1}, + {"ScanWords", Func, 1}, + {"Scanner", Type, 1}, + {"SplitFunc", Type, 1}, + {"Writer", Type, 0}, + }, + "bytes": { + {"(*Buffer).Available", Method, 21}, + {"(*Buffer).AvailableBuffer", Method, 21}, + {"(*Buffer).Bytes", Method, 0}, + {"(*Buffer).Cap", Method, 5}, + {"(*Buffer).Grow", Method, 1}, + {"(*Buffer).Len", Method, 0}, + {"(*Buffer).Next", Method, 0}, + {"(*Buffer).Read", Method, 0}, + {"(*Buffer).ReadByte", Method, 0}, + {"(*Buffer).ReadBytes", Method, 0}, + {"(*Buffer).ReadFrom", Method, 0}, + {"(*Buffer).ReadRune", Method, 0}, + {"(*Buffer).ReadString", Method, 0}, + {"(*Buffer).Reset", Method, 0}, + {"(*Buffer).String", Method, 0}, + {"(*Buffer).Truncate", Method, 0}, + {"(*Buffer).UnreadByte", Method, 0}, + {"(*Buffer).UnreadRune", Method, 0}, + {"(*Buffer).Write", Method, 0}, + {"(*Buffer).WriteByte", Method, 0}, + {"(*Buffer).WriteRune", Method, 0}, + {"(*Buffer).WriteString", Method, 0}, + {"(*Buffer).WriteTo", Method, 0}, + {"(*Reader).Len", Method, 0}, + {"(*Reader).Read", Method, 0}, + {"(*Reader).ReadAt", Method, 0}, + {"(*Reader).ReadByte", Method, 0}, + {"(*Reader).ReadRune", Method, 0}, + {"(*Reader).Reset", Method, 7}, + {"(*Reader).Seek", Method, 0}, + {"(*Reader).Size", Method, 5}, + {"(*Reader).UnreadByte", Method, 0}, + {"(*Reader).UnreadRune", Method, 0}, + {"(*Reader).WriteTo", Method, 1}, + {"Buffer", Type, 0}, + {"Clone", Func, 20}, + {"Compare", Func, 0}, + {"Contains", Func, 0}, + {"ContainsAny", Func, 7}, + {"ContainsFunc", Func, 21}, + {"ContainsRune", Func, 7}, + {"Count", Func, 0}, + {"Cut", Func, 18}, + {"CutPrefix", Func, 20}, + {"CutSuffix", Func, 20}, + {"Equal", Func, 0}, + {"EqualFold", Func, 0}, + {"ErrTooLarge", Var, 0}, + {"Fields", Func, 0}, + {"FieldsFunc", Func, 0}, + {"HasPrefix", Func, 0}, + {"HasSuffix", Func, 0}, + {"Index", Func, 0}, + {"IndexAny", Func, 0}, + {"IndexByte", Func, 0}, + {"IndexFunc", Func, 0}, + {"IndexRune", Func, 0}, + {"Join", Func, 0}, + {"LastIndex", Func, 0}, + {"LastIndexAny", Func, 0}, + {"LastIndexByte", Func, 5}, + {"LastIndexFunc", Func, 0}, + {"Map", Func, 0}, + {"MinRead", Const, 0}, + {"NewBuffer", Func, 0}, + {"NewBufferString", Func, 0}, + {"NewReader", Func, 0}, + {"Reader", Type, 0}, + {"Repeat", Func, 0}, + {"Replace", Func, 0}, + {"ReplaceAll", Func, 12}, + {"Runes", Func, 0}, + {"Split", Func, 0}, + {"SplitAfter", Func, 0}, + {"SplitAfterN", Func, 0}, + {"SplitN", Func, 0}, + {"Title", Func, 0}, + {"ToLower", Func, 0}, + {"ToLowerSpecial", Func, 0}, + {"ToTitle", Func, 0}, + {"ToTitleSpecial", Func, 0}, + {"ToUpper", Func, 0}, + {"ToUpperSpecial", Func, 0}, + {"ToValidUTF8", Func, 13}, + {"Trim", Func, 0}, + {"TrimFunc", Func, 0}, + {"TrimLeft", Func, 0}, + {"TrimLeftFunc", Func, 0}, + {"TrimPrefix", Func, 1}, + {"TrimRight", Func, 0}, + {"TrimRightFunc", Func, 0}, + {"TrimSpace", Func, 0}, + {"TrimSuffix", Func, 1}, + }, + "cmp": { + {"Compare", Func, 21}, + {"Less", Func, 21}, + {"Or", Func, 22}, + {"Ordered", Type, 21}, + }, + "compress/bzip2": { + {"(StructuralError).Error", Method, 0}, + {"NewReader", Func, 0}, + {"StructuralError", Type, 0}, + }, + "compress/flate": { + {"(*ReadError).Error", Method, 0}, + {"(*WriteError).Error", Method, 0}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).Flush", Method, 0}, + {"(*Writer).Reset", Method, 2}, + {"(*Writer).Write", Method, 0}, + {"(CorruptInputError).Error", Method, 0}, + {"(InternalError).Error", Method, 0}, + {"BestCompression", Const, 0}, + {"BestSpeed", Const, 0}, + {"CorruptInputError", Type, 0}, + {"DefaultCompression", Const, 0}, + {"HuffmanOnly", Const, 7}, + {"InternalError", Type, 0}, + {"NewReader", Func, 0}, + {"NewReaderDict", Func, 0}, + {"NewWriter", Func, 0}, + {"NewWriterDict", Func, 0}, + {"NoCompression", Const, 0}, + {"ReadError", Type, 0}, + {"ReadError.Err", Field, 0}, + {"ReadError.Offset", Field, 0}, + {"Reader", Type, 0}, + {"Resetter", Type, 4}, + {"WriteError", Type, 0}, + {"WriteError.Err", Field, 0}, + {"WriteError.Offset", Field, 0}, + {"Writer", Type, 0}, + }, + "compress/gzip": { + {"(*Reader).Close", Method, 0}, + {"(*Reader).Multistream", Method, 4}, + {"(*Reader).Read", Method, 0}, + {"(*Reader).Reset", Method, 3}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).Flush", Method, 1}, + {"(*Writer).Reset", Method, 2}, + {"(*Writer).Write", Method, 0}, + {"BestCompression", Const, 0}, + {"BestSpeed", Const, 0}, + {"DefaultCompression", Const, 0}, + {"ErrChecksum", Var, 0}, + {"ErrHeader", Var, 0}, + {"Header", Type, 0}, + {"Header.Comment", Field, 0}, + {"Header.Extra", Field, 0}, + {"Header.ModTime", Field, 0}, + {"Header.Name", Field, 0}, + {"Header.OS", Field, 0}, + {"HuffmanOnly", Const, 8}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"NewWriterLevel", Func, 0}, + {"NoCompression", Const, 0}, + {"Reader", Type, 0}, + {"Reader.Header", Field, 0}, + {"Writer", Type, 0}, + {"Writer.Header", Field, 0}, + }, + "compress/lzw": { + {"(*Reader).Close", Method, 17}, + {"(*Reader).Read", Method, 17}, + {"(*Reader).Reset", Method, 17}, + {"(*Writer).Close", Method, 17}, + {"(*Writer).Reset", Method, 17}, + {"(*Writer).Write", Method, 17}, + {"LSB", Const, 0}, + {"MSB", Const, 0}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"Order", Type, 0}, + {"Reader", Type, 17}, + {"Writer", Type, 17}, + }, + "compress/zlib": { + {"(*Writer).Close", Method, 0}, + {"(*Writer).Flush", Method, 0}, + {"(*Writer).Reset", Method, 2}, + {"(*Writer).Write", Method, 0}, + {"BestCompression", Const, 0}, + {"BestSpeed", Const, 0}, + {"DefaultCompression", Const, 0}, + {"ErrChecksum", Var, 0}, + {"ErrDictionary", Var, 0}, + {"ErrHeader", Var, 0}, + {"HuffmanOnly", Const, 8}, + {"NewReader", Func, 0}, + {"NewReaderDict", Func, 0}, + {"NewWriter", Func, 0}, + {"NewWriterLevel", Func, 0}, + {"NewWriterLevelDict", Func, 0}, + {"NoCompression", Const, 0}, + {"Resetter", Type, 4}, + {"Writer", Type, 0}, + }, + "container/heap": { + {"Fix", Func, 2}, + {"Init", Func, 0}, + {"Interface", Type, 0}, + {"Pop", Func, 0}, + {"Push", Func, 0}, + {"Remove", Func, 0}, + }, + "container/list": { + {"(*Element).Next", Method, 0}, + {"(*Element).Prev", Method, 0}, + {"(*List).Back", Method, 0}, + {"(*List).Front", Method, 0}, + {"(*List).Init", Method, 0}, + {"(*List).InsertAfter", Method, 0}, + {"(*List).InsertBefore", Method, 0}, + {"(*List).Len", Method, 0}, + {"(*List).MoveAfter", Method, 2}, + {"(*List).MoveBefore", Method, 2}, + {"(*List).MoveToBack", Method, 0}, + {"(*List).MoveToFront", Method, 0}, + {"(*List).PushBack", Method, 0}, + {"(*List).PushBackList", Method, 0}, + {"(*List).PushFront", Method, 0}, + {"(*List).PushFrontList", Method, 0}, + {"(*List).Remove", Method, 0}, + {"Element", Type, 0}, + {"Element.Value", Field, 0}, + {"List", Type, 0}, + {"New", Func, 0}, + }, + "container/ring": { + {"(*Ring).Do", Method, 0}, + {"(*Ring).Len", Method, 0}, + {"(*Ring).Link", Method, 0}, + {"(*Ring).Move", Method, 0}, + {"(*Ring).Next", Method, 0}, + {"(*Ring).Prev", Method, 0}, + {"(*Ring).Unlink", Method, 0}, + {"New", Func, 0}, + {"Ring", Type, 0}, + {"Ring.Value", Field, 0}, + }, + "context": { + {"AfterFunc", Func, 21}, + {"Background", Func, 7}, + {"CancelCauseFunc", Type, 20}, + {"CancelFunc", Type, 7}, + {"Canceled", Var, 7}, + {"Cause", Func, 20}, + {"Context", Type, 7}, + {"DeadlineExceeded", Var, 7}, + {"TODO", Func, 7}, + {"WithCancel", Func, 7}, + {"WithCancelCause", Func, 20}, + {"WithDeadline", Func, 7}, + {"WithDeadlineCause", Func, 21}, + {"WithTimeout", Func, 7}, + {"WithTimeoutCause", Func, 21}, + {"WithValue", Func, 7}, + {"WithoutCancel", Func, 21}, + }, + "crypto": { + {"(Hash).Available", Method, 0}, + {"(Hash).HashFunc", Method, 4}, + {"(Hash).New", Method, 0}, + {"(Hash).Size", Method, 0}, + {"(Hash).String", Method, 15}, + {"BLAKE2b_256", Const, 9}, + {"BLAKE2b_384", Const, 9}, + {"BLAKE2b_512", Const, 9}, + {"BLAKE2s_256", Const, 9}, + {"Decrypter", Type, 5}, + {"DecrypterOpts", Type, 5}, + {"Hash", Type, 0}, + {"MD4", Const, 0}, + {"MD5", Const, 0}, + {"MD5SHA1", Const, 0}, + {"PrivateKey", Type, 0}, + {"PublicKey", Type, 2}, + {"RIPEMD160", Const, 0}, + {"RegisterHash", Func, 0}, + {"SHA1", Const, 0}, + {"SHA224", Const, 0}, + {"SHA256", Const, 0}, + {"SHA384", Const, 0}, + {"SHA3_224", Const, 4}, + {"SHA3_256", Const, 4}, + {"SHA3_384", Const, 4}, + {"SHA3_512", Const, 4}, + {"SHA512", Const, 0}, + {"SHA512_224", Const, 5}, + {"SHA512_256", Const, 5}, + {"Signer", Type, 4}, + {"SignerOpts", Type, 4}, + }, + "crypto/aes": { + {"(KeySizeError).Error", Method, 0}, + {"BlockSize", Const, 0}, + {"KeySizeError", Type, 0}, + {"NewCipher", Func, 0}, + }, + "crypto/cipher": { + {"(StreamReader).Read", Method, 0}, + {"(StreamWriter).Close", Method, 0}, + {"(StreamWriter).Write", Method, 0}, + {"AEAD", Type, 2}, + {"Block", Type, 0}, + {"BlockMode", Type, 0}, + {"NewCBCDecrypter", Func, 0}, + {"NewCBCEncrypter", Func, 0}, + {"NewCFBDecrypter", Func, 0}, + {"NewCFBEncrypter", Func, 0}, + {"NewCTR", Func, 0}, + {"NewGCM", Func, 2}, + {"NewGCMWithNonceSize", Func, 5}, + {"NewGCMWithTagSize", Func, 11}, + {"NewOFB", Func, 0}, + {"Stream", Type, 0}, + {"StreamReader", Type, 0}, + {"StreamReader.R", Field, 0}, + {"StreamReader.S", Field, 0}, + {"StreamWriter", Type, 0}, + {"StreamWriter.Err", Field, 0}, + {"StreamWriter.S", Field, 0}, + {"StreamWriter.W", Field, 0}, + }, + "crypto/des": { + {"(KeySizeError).Error", Method, 0}, + {"BlockSize", Const, 0}, + {"KeySizeError", Type, 0}, + {"NewCipher", Func, 0}, + {"NewTripleDESCipher", Func, 0}, + }, + "crypto/dsa": { + {"ErrInvalidPublicKey", Var, 0}, + {"GenerateKey", Func, 0}, + {"GenerateParameters", Func, 0}, + {"L1024N160", Const, 0}, + {"L2048N224", Const, 0}, + {"L2048N256", Const, 0}, + {"L3072N256", Const, 0}, + {"ParameterSizes", Type, 0}, + {"Parameters", Type, 0}, + {"Parameters.G", Field, 0}, + {"Parameters.P", Field, 0}, + {"Parameters.Q", Field, 0}, + {"PrivateKey", Type, 0}, + {"PrivateKey.PublicKey", Field, 0}, + {"PrivateKey.X", Field, 0}, + {"PublicKey", Type, 0}, + {"PublicKey.Parameters", Field, 0}, + {"PublicKey.Y", Field, 0}, + {"Sign", Func, 0}, + {"Verify", Func, 0}, + }, + "crypto/ecdh": { + {"(*PrivateKey).Bytes", Method, 20}, + {"(*PrivateKey).Curve", Method, 20}, + {"(*PrivateKey).ECDH", Method, 20}, + {"(*PrivateKey).Equal", Method, 20}, + {"(*PrivateKey).Public", Method, 20}, + {"(*PrivateKey).PublicKey", Method, 20}, + {"(*PublicKey).Bytes", Method, 20}, + {"(*PublicKey).Curve", Method, 20}, + {"(*PublicKey).Equal", Method, 20}, + {"Curve", Type, 20}, + {"P256", Func, 20}, + {"P384", Func, 20}, + {"P521", Func, 20}, + {"PrivateKey", Type, 20}, + {"PublicKey", Type, 20}, + {"X25519", Func, 20}, + }, + "crypto/ecdsa": { + {"(*PrivateKey).ECDH", Method, 20}, + {"(*PrivateKey).Equal", Method, 15}, + {"(*PrivateKey).Public", Method, 4}, + {"(*PrivateKey).Sign", Method, 4}, + {"(*PublicKey).ECDH", Method, 20}, + {"(*PublicKey).Equal", Method, 15}, + {"(PrivateKey).Add", Method, 0}, + {"(PrivateKey).Double", Method, 0}, + {"(PrivateKey).IsOnCurve", Method, 0}, + {"(PrivateKey).Params", Method, 0}, + {"(PrivateKey).ScalarBaseMult", Method, 0}, + {"(PrivateKey).ScalarMult", Method, 0}, + {"(PublicKey).Add", Method, 0}, + {"(PublicKey).Double", Method, 0}, + {"(PublicKey).IsOnCurve", Method, 0}, + {"(PublicKey).Params", Method, 0}, + {"(PublicKey).ScalarBaseMult", Method, 0}, + {"(PublicKey).ScalarMult", Method, 0}, + {"GenerateKey", Func, 0}, + {"PrivateKey", Type, 0}, + {"PrivateKey.D", Field, 0}, + {"PrivateKey.PublicKey", Field, 0}, + {"PublicKey", Type, 0}, + {"PublicKey.Curve", Field, 0}, + {"PublicKey.X", Field, 0}, + {"PublicKey.Y", Field, 0}, + {"Sign", Func, 0}, + {"SignASN1", Func, 15}, + {"Verify", Func, 0}, + {"VerifyASN1", Func, 15}, + }, + "crypto/ed25519": { + {"(*Options).HashFunc", Method, 20}, + {"(PrivateKey).Equal", Method, 15}, + {"(PrivateKey).Public", Method, 13}, + {"(PrivateKey).Seed", Method, 13}, + {"(PrivateKey).Sign", Method, 13}, + {"(PublicKey).Equal", Method, 15}, + {"GenerateKey", Func, 13}, + {"NewKeyFromSeed", Func, 13}, + {"Options", Type, 20}, + {"Options.Context", Field, 20}, + {"Options.Hash", Field, 20}, + {"PrivateKey", Type, 13}, + {"PrivateKeySize", Const, 13}, + {"PublicKey", Type, 13}, + {"PublicKeySize", Const, 13}, + {"SeedSize", Const, 13}, + {"Sign", Func, 13}, + {"SignatureSize", Const, 13}, + {"Verify", Func, 13}, + {"VerifyWithOptions", Func, 20}, + }, + "crypto/elliptic": { + {"(*CurveParams).Add", Method, 0}, + {"(*CurveParams).Double", Method, 0}, + {"(*CurveParams).IsOnCurve", Method, 0}, + {"(*CurveParams).Params", Method, 0}, + {"(*CurveParams).ScalarBaseMult", Method, 0}, + {"(*CurveParams).ScalarMult", Method, 0}, + {"Curve", Type, 0}, + {"CurveParams", Type, 0}, + {"CurveParams.B", Field, 0}, + {"CurveParams.BitSize", Field, 0}, + {"CurveParams.Gx", Field, 0}, + {"CurveParams.Gy", Field, 0}, + {"CurveParams.N", Field, 0}, + {"CurveParams.Name", Field, 5}, + {"CurveParams.P", Field, 0}, + {"GenerateKey", Func, 0}, + {"Marshal", Func, 0}, + {"MarshalCompressed", Func, 15}, + {"P224", Func, 0}, + {"P256", Func, 0}, + {"P384", Func, 0}, + {"P521", Func, 0}, + {"Unmarshal", Func, 0}, + {"UnmarshalCompressed", Func, 15}, + }, + "crypto/hmac": { + {"Equal", Func, 1}, + {"New", Func, 0}, + }, + "crypto/md5": { + {"BlockSize", Const, 0}, + {"New", Func, 0}, + {"Size", Const, 0}, + {"Sum", Func, 2}, + }, + "crypto/rand": { + {"Int", Func, 0}, + {"Prime", Func, 0}, + {"Read", Func, 0}, + {"Reader", Var, 0}, + }, + "crypto/rc4": { + {"(*Cipher).Reset", Method, 0}, + {"(*Cipher).XORKeyStream", Method, 0}, + {"(KeySizeError).Error", Method, 0}, + {"Cipher", Type, 0}, + {"KeySizeError", Type, 0}, + {"NewCipher", Func, 0}, + }, + "crypto/rsa": { + {"(*PSSOptions).HashFunc", Method, 4}, + {"(*PrivateKey).Decrypt", Method, 5}, + {"(*PrivateKey).Equal", Method, 15}, + {"(*PrivateKey).Precompute", Method, 0}, + {"(*PrivateKey).Public", Method, 4}, + {"(*PrivateKey).Sign", Method, 4}, + {"(*PrivateKey).Size", Method, 11}, + {"(*PrivateKey).Validate", Method, 0}, + {"(*PublicKey).Equal", Method, 15}, + {"(*PublicKey).Size", Method, 11}, + {"CRTValue", Type, 0}, + {"CRTValue.Coeff", Field, 0}, + {"CRTValue.Exp", Field, 0}, + {"CRTValue.R", Field, 0}, + {"DecryptOAEP", Func, 0}, + {"DecryptPKCS1v15", Func, 0}, + {"DecryptPKCS1v15SessionKey", Func, 0}, + {"EncryptOAEP", Func, 0}, + {"EncryptPKCS1v15", Func, 0}, + {"ErrDecryption", Var, 0}, + {"ErrMessageTooLong", Var, 0}, + {"ErrVerification", Var, 0}, + {"GenerateKey", Func, 0}, + {"GenerateMultiPrimeKey", Func, 0}, + {"OAEPOptions", Type, 5}, + {"OAEPOptions.Hash", Field, 5}, + {"OAEPOptions.Label", Field, 5}, + {"OAEPOptions.MGFHash", Field, 20}, + {"PKCS1v15DecryptOptions", Type, 5}, + {"PKCS1v15DecryptOptions.SessionKeyLen", Field, 5}, + {"PSSOptions", Type, 2}, + {"PSSOptions.Hash", Field, 4}, + {"PSSOptions.SaltLength", Field, 2}, + {"PSSSaltLengthAuto", Const, 2}, + {"PSSSaltLengthEqualsHash", Const, 2}, + {"PrecomputedValues", Type, 0}, + {"PrecomputedValues.CRTValues", Field, 0}, + {"PrecomputedValues.Dp", Field, 0}, + {"PrecomputedValues.Dq", Field, 0}, + {"PrecomputedValues.Qinv", Field, 0}, + {"PrivateKey", Type, 0}, + {"PrivateKey.D", Field, 0}, + {"PrivateKey.Precomputed", Field, 0}, + {"PrivateKey.Primes", Field, 0}, + {"PrivateKey.PublicKey", Field, 0}, + {"PublicKey", Type, 0}, + {"PublicKey.E", Field, 0}, + {"PublicKey.N", Field, 0}, + {"SignPKCS1v15", Func, 0}, + {"SignPSS", Func, 2}, + {"VerifyPKCS1v15", Func, 0}, + {"VerifyPSS", Func, 2}, + }, + "crypto/sha1": { + {"BlockSize", Const, 0}, + {"New", Func, 0}, + {"Size", Const, 0}, + {"Sum", Func, 2}, + }, + "crypto/sha256": { + {"BlockSize", Const, 0}, + {"New", Func, 0}, + {"New224", Func, 0}, + {"Size", Const, 0}, + {"Size224", Const, 0}, + {"Sum224", Func, 2}, + {"Sum256", Func, 2}, + }, + "crypto/sha512": { + {"BlockSize", Const, 0}, + {"New", Func, 0}, + {"New384", Func, 0}, + {"New512_224", Func, 5}, + {"New512_256", Func, 5}, + {"Size", Const, 0}, + {"Size224", Const, 5}, + {"Size256", Const, 5}, + {"Size384", Const, 0}, + {"Sum384", Func, 2}, + {"Sum512", Func, 2}, + {"Sum512_224", Func, 5}, + {"Sum512_256", Func, 5}, + }, + "crypto/subtle": { + {"ConstantTimeByteEq", Func, 0}, + {"ConstantTimeCompare", Func, 0}, + {"ConstantTimeCopy", Func, 0}, + {"ConstantTimeEq", Func, 0}, + {"ConstantTimeLessOrEq", Func, 2}, + {"ConstantTimeSelect", Func, 0}, + {"XORBytes", Func, 20}, + }, + "crypto/tls": { + {"(*CertificateRequestInfo).Context", Method, 17}, + {"(*CertificateRequestInfo).SupportsCertificate", Method, 14}, + {"(*CertificateVerificationError).Error", Method, 20}, + {"(*CertificateVerificationError).Unwrap", Method, 20}, + {"(*ClientHelloInfo).Context", Method, 17}, + {"(*ClientHelloInfo).SupportsCertificate", Method, 14}, + {"(*ClientSessionState).ResumptionState", Method, 21}, + {"(*Config).BuildNameToCertificate", Method, 0}, + {"(*Config).Clone", Method, 8}, + {"(*Config).DecryptTicket", Method, 21}, + {"(*Config).EncryptTicket", Method, 21}, + {"(*Config).SetSessionTicketKeys", Method, 5}, + {"(*Conn).Close", Method, 0}, + {"(*Conn).CloseWrite", Method, 8}, + {"(*Conn).ConnectionState", Method, 0}, + {"(*Conn).Handshake", Method, 0}, + {"(*Conn).HandshakeContext", Method, 17}, + {"(*Conn).LocalAddr", Method, 0}, + {"(*Conn).NetConn", Method, 18}, + {"(*Conn).OCSPResponse", Method, 0}, + {"(*Conn).Read", Method, 0}, + {"(*Conn).RemoteAddr", Method, 0}, + {"(*Conn).SetDeadline", Method, 0}, + {"(*Conn).SetReadDeadline", Method, 0}, + {"(*Conn).SetWriteDeadline", Method, 0}, + {"(*Conn).VerifyHostname", Method, 0}, + {"(*Conn).Write", Method, 0}, + {"(*ConnectionState).ExportKeyingMaterial", Method, 11}, + {"(*Dialer).Dial", Method, 15}, + {"(*Dialer).DialContext", Method, 15}, + {"(*QUICConn).Close", Method, 21}, + {"(*QUICConn).ConnectionState", Method, 21}, + {"(*QUICConn).HandleData", Method, 21}, + {"(*QUICConn).NextEvent", Method, 21}, + {"(*QUICConn).SendSessionTicket", Method, 21}, + {"(*QUICConn).SetTransportParameters", Method, 21}, + {"(*QUICConn).Start", Method, 21}, + {"(*SessionState).Bytes", Method, 21}, + {"(AlertError).Error", Method, 21}, + {"(ClientAuthType).String", Method, 15}, + {"(CurveID).String", Method, 15}, + {"(QUICEncryptionLevel).String", Method, 21}, + {"(RecordHeaderError).Error", Method, 6}, + {"(SignatureScheme).String", Method, 15}, + {"AlertError", Type, 21}, + {"Certificate", Type, 0}, + {"Certificate.Certificate", Field, 0}, + {"Certificate.Leaf", Field, 0}, + {"Certificate.OCSPStaple", Field, 0}, + {"Certificate.PrivateKey", Field, 0}, + {"Certificate.SignedCertificateTimestamps", Field, 5}, + {"Certificate.SupportedSignatureAlgorithms", Field, 14}, + {"CertificateRequestInfo", Type, 8}, + {"CertificateRequestInfo.AcceptableCAs", Field, 8}, + {"CertificateRequestInfo.SignatureSchemes", Field, 8}, + {"CertificateRequestInfo.Version", Field, 14}, + {"CertificateVerificationError", Type, 20}, + {"CertificateVerificationError.Err", Field, 20}, + {"CertificateVerificationError.UnverifiedCertificates", Field, 20}, + {"CipherSuite", Type, 14}, + {"CipherSuite.ID", Field, 14}, + {"CipherSuite.Insecure", Field, 14}, + {"CipherSuite.Name", Field, 14}, + {"CipherSuite.SupportedVersions", Field, 14}, + {"CipherSuiteName", Func, 14}, + {"CipherSuites", Func, 14}, + {"Client", Func, 0}, + {"ClientAuthType", Type, 0}, + {"ClientHelloInfo", Type, 4}, + {"ClientHelloInfo.CipherSuites", Field, 4}, + {"ClientHelloInfo.Conn", Field, 8}, + {"ClientHelloInfo.ServerName", Field, 4}, + {"ClientHelloInfo.SignatureSchemes", Field, 8}, + {"ClientHelloInfo.SupportedCurves", Field, 4}, + {"ClientHelloInfo.SupportedPoints", Field, 4}, + {"ClientHelloInfo.SupportedProtos", Field, 8}, + {"ClientHelloInfo.SupportedVersions", Field, 8}, + {"ClientSessionCache", Type, 3}, + {"ClientSessionState", Type, 3}, + {"Config", Type, 0}, + {"Config.Certificates", Field, 0}, + {"Config.CipherSuites", Field, 0}, + {"Config.ClientAuth", Field, 0}, + {"Config.ClientCAs", Field, 0}, + {"Config.ClientSessionCache", Field, 3}, + {"Config.CurvePreferences", Field, 3}, + {"Config.DynamicRecordSizingDisabled", Field, 7}, + {"Config.GetCertificate", Field, 4}, + {"Config.GetClientCertificate", Field, 8}, + {"Config.GetConfigForClient", Field, 8}, + {"Config.InsecureSkipVerify", Field, 0}, + {"Config.KeyLogWriter", Field, 8}, + {"Config.MaxVersion", Field, 2}, + {"Config.MinVersion", Field, 2}, + {"Config.NameToCertificate", Field, 0}, + {"Config.NextProtos", Field, 0}, + {"Config.PreferServerCipherSuites", Field, 1}, + {"Config.Rand", Field, 0}, + {"Config.Renegotiation", Field, 7}, + {"Config.RootCAs", Field, 0}, + {"Config.ServerName", Field, 0}, + {"Config.SessionTicketKey", Field, 1}, + {"Config.SessionTicketsDisabled", Field, 1}, + {"Config.Time", Field, 0}, + {"Config.UnwrapSession", Field, 21}, + {"Config.VerifyConnection", Field, 15}, + {"Config.VerifyPeerCertificate", Field, 8}, + {"Config.WrapSession", Field, 21}, + {"Conn", Type, 0}, + {"ConnectionState", Type, 0}, + {"ConnectionState.CipherSuite", Field, 0}, + {"ConnectionState.DidResume", Field, 1}, + {"ConnectionState.HandshakeComplete", Field, 0}, + {"ConnectionState.NegotiatedProtocol", Field, 0}, + {"ConnectionState.NegotiatedProtocolIsMutual", Field, 0}, + {"ConnectionState.OCSPResponse", Field, 5}, + {"ConnectionState.PeerCertificates", Field, 0}, + {"ConnectionState.ServerName", Field, 0}, + {"ConnectionState.SignedCertificateTimestamps", Field, 5}, + {"ConnectionState.TLSUnique", Field, 4}, + {"ConnectionState.VerifiedChains", Field, 0}, + {"ConnectionState.Version", Field, 3}, + {"CurveID", Type, 3}, + {"CurveP256", Const, 3}, + {"CurveP384", Const, 3}, + {"CurveP521", Const, 3}, + {"Dial", Func, 0}, + {"DialWithDialer", Func, 3}, + {"Dialer", Type, 15}, + {"Dialer.Config", Field, 15}, + {"Dialer.NetDialer", Field, 15}, + {"ECDSAWithP256AndSHA256", Const, 8}, + {"ECDSAWithP384AndSHA384", Const, 8}, + {"ECDSAWithP521AndSHA512", Const, 8}, + {"ECDSAWithSHA1", Const, 10}, + {"Ed25519", Const, 13}, + {"InsecureCipherSuites", Func, 14}, + {"Listen", Func, 0}, + {"LoadX509KeyPair", Func, 0}, + {"NewLRUClientSessionCache", Func, 3}, + {"NewListener", Func, 0}, + {"NewResumptionState", Func, 21}, + {"NoClientCert", Const, 0}, + {"PKCS1WithSHA1", Const, 8}, + {"PKCS1WithSHA256", Const, 8}, + {"PKCS1WithSHA384", Const, 8}, + {"PKCS1WithSHA512", Const, 8}, + {"PSSWithSHA256", Const, 8}, + {"PSSWithSHA384", Const, 8}, + {"PSSWithSHA512", Const, 8}, + {"ParseSessionState", Func, 21}, + {"QUICClient", Func, 21}, + {"QUICConfig", Type, 21}, + {"QUICConfig.TLSConfig", Field, 21}, + {"QUICConn", Type, 21}, + {"QUICEncryptionLevel", Type, 21}, + {"QUICEncryptionLevelApplication", Const, 21}, + {"QUICEncryptionLevelEarly", Const, 21}, + {"QUICEncryptionLevelHandshake", Const, 21}, + {"QUICEncryptionLevelInitial", Const, 21}, + {"QUICEvent", Type, 21}, + {"QUICEvent.Data", Field, 21}, + {"QUICEvent.Kind", Field, 21}, + {"QUICEvent.Level", Field, 21}, + {"QUICEvent.Suite", Field, 21}, + {"QUICEventKind", Type, 21}, + {"QUICHandshakeDone", Const, 21}, + {"QUICNoEvent", Const, 21}, + {"QUICRejectedEarlyData", Const, 21}, + {"QUICServer", Func, 21}, + {"QUICSessionTicketOptions", Type, 21}, + {"QUICSessionTicketOptions.EarlyData", Field, 21}, + {"QUICSetReadSecret", Const, 21}, + {"QUICSetWriteSecret", Const, 21}, + {"QUICTransportParameters", Const, 21}, + {"QUICTransportParametersRequired", Const, 21}, + {"QUICWriteData", Const, 21}, + {"RecordHeaderError", Type, 6}, + {"RecordHeaderError.Conn", Field, 12}, + {"RecordHeaderError.Msg", Field, 6}, + {"RecordHeaderError.RecordHeader", Field, 6}, + {"RenegotiateFreelyAsClient", Const, 7}, + {"RenegotiateNever", Const, 7}, + {"RenegotiateOnceAsClient", Const, 7}, + {"RenegotiationSupport", Type, 7}, + {"RequestClientCert", Const, 0}, + {"RequireAndVerifyClientCert", Const, 0}, + {"RequireAnyClientCert", Const, 0}, + {"Server", Func, 0}, + {"SessionState", Type, 21}, + {"SessionState.EarlyData", Field, 21}, + {"SessionState.Extra", Field, 21}, + {"SignatureScheme", Type, 8}, + {"TLS_AES_128_GCM_SHA256", Const, 12}, + {"TLS_AES_256_GCM_SHA384", Const, 12}, + {"TLS_CHACHA20_POLY1305_SHA256", Const, 12}, + {"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA", Const, 2}, + {"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256", Const, 8}, + {"TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256", Const, 2}, + {"TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA", Const, 2}, + {"TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384", Const, 5}, + {"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305", Const, 8}, + {"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256", Const, 14}, + {"TLS_ECDHE_ECDSA_WITH_RC4_128_SHA", Const, 2}, + {"TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA", Const, 0}, + {"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA", Const, 0}, + {"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256", Const, 8}, + {"TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256", Const, 2}, + {"TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA", Const, 1}, + {"TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384", Const, 5}, + {"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305", Const, 8}, + {"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256", Const, 14}, + {"TLS_ECDHE_RSA_WITH_RC4_128_SHA", Const, 0}, + {"TLS_FALLBACK_SCSV", Const, 4}, + {"TLS_RSA_WITH_3DES_EDE_CBC_SHA", Const, 0}, + {"TLS_RSA_WITH_AES_128_CBC_SHA", Const, 0}, + {"TLS_RSA_WITH_AES_128_CBC_SHA256", Const, 8}, + {"TLS_RSA_WITH_AES_128_GCM_SHA256", Const, 6}, + {"TLS_RSA_WITH_AES_256_CBC_SHA", Const, 1}, + {"TLS_RSA_WITH_AES_256_GCM_SHA384", Const, 6}, + {"TLS_RSA_WITH_RC4_128_SHA", Const, 0}, + {"VerifyClientCertIfGiven", Const, 0}, + {"VersionName", Func, 21}, + {"VersionSSL30", Const, 2}, + {"VersionTLS10", Const, 2}, + {"VersionTLS11", Const, 2}, + {"VersionTLS12", Const, 2}, + {"VersionTLS13", Const, 12}, + {"X25519", Const, 8}, + {"X509KeyPair", Func, 0}, + }, + "crypto/x509": { + {"(*CertPool).AddCert", Method, 0}, + {"(*CertPool).AddCertWithConstraint", Method, 22}, + {"(*CertPool).AppendCertsFromPEM", Method, 0}, + {"(*CertPool).Clone", Method, 19}, + {"(*CertPool).Equal", Method, 19}, + {"(*CertPool).Subjects", Method, 0}, + {"(*Certificate).CheckCRLSignature", Method, 0}, + {"(*Certificate).CheckSignature", Method, 0}, + {"(*Certificate).CheckSignatureFrom", Method, 0}, + {"(*Certificate).CreateCRL", Method, 0}, + {"(*Certificate).Equal", Method, 0}, + {"(*Certificate).Verify", Method, 0}, + {"(*Certificate).VerifyHostname", Method, 0}, + {"(*CertificateRequest).CheckSignature", Method, 5}, + {"(*RevocationList).CheckSignatureFrom", Method, 19}, + {"(CertificateInvalidError).Error", Method, 0}, + {"(ConstraintViolationError).Error", Method, 0}, + {"(HostnameError).Error", Method, 0}, + {"(InsecureAlgorithmError).Error", Method, 6}, + {"(OID).Equal", Method, 22}, + {"(OID).EqualASN1OID", Method, 22}, + {"(OID).String", Method, 22}, + {"(PublicKeyAlgorithm).String", Method, 10}, + {"(SignatureAlgorithm).String", Method, 6}, + {"(SystemRootsError).Error", Method, 1}, + {"(SystemRootsError).Unwrap", Method, 16}, + {"(UnhandledCriticalExtension).Error", Method, 0}, + {"(UnknownAuthorityError).Error", Method, 0}, + {"CANotAuthorizedForExtKeyUsage", Const, 10}, + {"CANotAuthorizedForThisName", Const, 0}, + {"CertPool", Type, 0}, + {"Certificate", Type, 0}, + {"Certificate.AuthorityKeyId", Field, 0}, + {"Certificate.BasicConstraintsValid", Field, 0}, + {"Certificate.CRLDistributionPoints", Field, 2}, + {"Certificate.DNSNames", Field, 0}, + {"Certificate.EmailAddresses", Field, 0}, + {"Certificate.ExcludedDNSDomains", Field, 9}, + {"Certificate.ExcludedEmailAddresses", Field, 10}, + {"Certificate.ExcludedIPRanges", Field, 10}, + {"Certificate.ExcludedURIDomains", Field, 10}, + {"Certificate.ExtKeyUsage", Field, 0}, + {"Certificate.Extensions", Field, 2}, + {"Certificate.ExtraExtensions", Field, 2}, + {"Certificate.IPAddresses", Field, 1}, + {"Certificate.IsCA", Field, 0}, + {"Certificate.Issuer", Field, 0}, + {"Certificate.IssuingCertificateURL", Field, 2}, + {"Certificate.KeyUsage", Field, 0}, + {"Certificate.MaxPathLen", Field, 0}, + {"Certificate.MaxPathLenZero", Field, 4}, + {"Certificate.NotAfter", Field, 0}, + {"Certificate.NotBefore", Field, 0}, + {"Certificate.OCSPServer", Field, 2}, + {"Certificate.PermittedDNSDomains", Field, 0}, + {"Certificate.PermittedDNSDomainsCritical", Field, 0}, + {"Certificate.PermittedEmailAddresses", Field, 10}, + {"Certificate.PermittedIPRanges", Field, 10}, + {"Certificate.PermittedURIDomains", Field, 10}, + {"Certificate.Policies", Field, 22}, + {"Certificate.PolicyIdentifiers", Field, 0}, + {"Certificate.PublicKey", Field, 0}, + {"Certificate.PublicKeyAlgorithm", Field, 0}, + {"Certificate.Raw", Field, 0}, + {"Certificate.RawIssuer", Field, 0}, + {"Certificate.RawSubject", Field, 0}, + {"Certificate.RawSubjectPublicKeyInfo", Field, 0}, + {"Certificate.RawTBSCertificate", Field, 0}, + {"Certificate.SerialNumber", Field, 0}, + {"Certificate.Signature", Field, 0}, + {"Certificate.SignatureAlgorithm", Field, 0}, + {"Certificate.Subject", Field, 0}, + {"Certificate.SubjectKeyId", Field, 0}, + {"Certificate.URIs", Field, 10}, + {"Certificate.UnhandledCriticalExtensions", Field, 5}, + {"Certificate.UnknownExtKeyUsage", Field, 0}, + {"Certificate.Version", Field, 0}, + {"CertificateInvalidError", Type, 0}, + {"CertificateInvalidError.Cert", Field, 0}, + {"CertificateInvalidError.Detail", Field, 10}, + {"CertificateInvalidError.Reason", Field, 0}, + {"CertificateRequest", Type, 3}, + {"CertificateRequest.Attributes", Field, 3}, + {"CertificateRequest.DNSNames", Field, 3}, + {"CertificateRequest.EmailAddresses", Field, 3}, + {"CertificateRequest.Extensions", Field, 3}, + {"CertificateRequest.ExtraExtensions", Field, 3}, + {"CertificateRequest.IPAddresses", Field, 3}, + {"CertificateRequest.PublicKey", Field, 3}, + {"CertificateRequest.PublicKeyAlgorithm", Field, 3}, + {"CertificateRequest.Raw", Field, 3}, + {"CertificateRequest.RawSubject", Field, 3}, + {"CertificateRequest.RawSubjectPublicKeyInfo", Field, 3}, + {"CertificateRequest.RawTBSCertificateRequest", Field, 3}, + {"CertificateRequest.Signature", Field, 3}, + {"CertificateRequest.SignatureAlgorithm", Field, 3}, + {"CertificateRequest.Subject", Field, 3}, + {"CertificateRequest.URIs", Field, 10}, + {"CertificateRequest.Version", Field, 3}, + {"ConstraintViolationError", Type, 0}, + {"CreateCertificate", Func, 0}, + {"CreateCertificateRequest", Func, 3}, + {"CreateRevocationList", Func, 15}, + {"DSA", Const, 0}, + {"DSAWithSHA1", Const, 0}, + {"DSAWithSHA256", Const, 0}, + {"DecryptPEMBlock", Func, 1}, + {"ECDSA", Const, 1}, + {"ECDSAWithSHA1", Const, 1}, + {"ECDSAWithSHA256", Const, 1}, + {"ECDSAWithSHA384", Const, 1}, + {"ECDSAWithSHA512", Const, 1}, + {"Ed25519", Const, 13}, + {"EncryptPEMBlock", Func, 1}, + {"ErrUnsupportedAlgorithm", Var, 0}, + {"Expired", Const, 0}, + {"ExtKeyUsage", Type, 0}, + {"ExtKeyUsageAny", Const, 0}, + {"ExtKeyUsageClientAuth", Const, 0}, + {"ExtKeyUsageCodeSigning", Const, 0}, + {"ExtKeyUsageEmailProtection", Const, 0}, + {"ExtKeyUsageIPSECEndSystem", Const, 1}, + {"ExtKeyUsageIPSECTunnel", Const, 1}, + {"ExtKeyUsageIPSECUser", Const, 1}, + {"ExtKeyUsageMicrosoftCommercialCodeSigning", Const, 10}, + {"ExtKeyUsageMicrosoftKernelCodeSigning", Const, 10}, + {"ExtKeyUsageMicrosoftServerGatedCrypto", Const, 1}, + {"ExtKeyUsageNetscapeServerGatedCrypto", Const, 1}, + {"ExtKeyUsageOCSPSigning", Const, 0}, + {"ExtKeyUsageServerAuth", Const, 0}, + {"ExtKeyUsageTimeStamping", Const, 0}, + {"HostnameError", Type, 0}, + {"HostnameError.Certificate", Field, 0}, + {"HostnameError.Host", Field, 0}, + {"IncompatibleUsage", Const, 1}, + {"IncorrectPasswordError", Var, 1}, + {"InsecureAlgorithmError", Type, 6}, + {"InvalidReason", Type, 0}, + {"IsEncryptedPEMBlock", Func, 1}, + {"KeyUsage", Type, 0}, + {"KeyUsageCRLSign", Const, 0}, + {"KeyUsageCertSign", Const, 0}, + {"KeyUsageContentCommitment", Const, 0}, + {"KeyUsageDataEncipherment", Const, 0}, + {"KeyUsageDecipherOnly", Const, 0}, + {"KeyUsageDigitalSignature", Const, 0}, + {"KeyUsageEncipherOnly", Const, 0}, + {"KeyUsageKeyAgreement", Const, 0}, + {"KeyUsageKeyEncipherment", Const, 0}, + {"MD2WithRSA", Const, 0}, + {"MD5WithRSA", Const, 0}, + {"MarshalECPrivateKey", Func, 2}, + {"MarshalPKCS1PrivateKey", Func, 0}, + {"MarshalPKCS1PublicKey", Func, 10}, + {"MarshalPKCS8PrivateKey", Func, 10}, + {"MarshalPKIXPublicKey", Func, 0}, + {"NameConstraintsWithoutSANs", Const, 10}, + {"NameMismatch", Const, 8}, + {"NewCertPool", Func, 0}, + {"NotAuthorizedToSign", Const, 0}, + {"OID", Type, 22}, + {"OIDFromInts", Func, 22}, + {"PEMCipher", Type, 1}, + {"PEMCipher3DES", Const, 1}, + {"PEMCipherAES128", Const, 1}, + {"PEMCipherAES192", Const, 1}, + {"PEMCipherAES256", Const, 1}, + {"PEMCipherDES", Const, 1}, + {"ParseCRL", Func, 0}, + {"ParseCertificate", Func, 0}, + {"ParseCertificateRequest", Func, 3}, + {"ParseCertificates", Func, 0}, + {"ParseDERCRL", Func, 0}, + {"ParseECPrivateKey", Func, 1}, + {"ParsePKCS1PrivateKey", Func, 0}, + {"ParsePKCS1PublicKey", Func, 10}, + {"ParsePKCS8PrivateKey", Func, 0}, + {"ParsePKIXPublicKey", Func, 0}, + {"ParseRevocationList", Func, 19}, + {"PublicKeyAlgorithm", Type, 0}, + {"PureEd25519", Const, 13}, + {"RSA", Const, 0}, + {"RevocationList", Type, 15}, + {"RevocationList.AuthorityKeyId", Field, 19}, + {"RevocationList.Extensions", Field, 19}, + {"RevocationList.ExtraExtensions", Field, 15}, + {"RevocationList.Issuer", Field, 19}, + {"RevocationList.NextUpdate", Field, 15}, + {"RevocationList.Number", Field, 15}, + {"RevocationList.Raw", Field, 19}, + {"RevocationList.RawIssuer", Field, 19}, + {"RevocationList.RawTBSRevocationList", Field, 19}, + {"RevocationList.RevokedCertificateEntries", Field, 21}, + {"RevocationList.RevokedCertificates", Field, 15}, + {"RevocationList.Signature", Field, 19}, + {"RevocationList.SignatureAlgorithm", Field, 15}, + {"RevocationList.ThisUpdate", Field, 15}, + {"RevocationListEntry", Type, 21}, + {"RevocationListEntry.Extensions", Field, 21}, + {"RevocationListEntry.ExtraExtensions", Field, 21}, + {"RevocationListEntry.Raw", Field, 21}, + {"RevocationListEntry.ReasonCode", Field, 21}, + {"RevocationListEntry.RevocationTime", Field, 21}, + {"RevocationListEntry.SerialNumber", Field, 21}, + {"SHA1WithRSA", Const, 0}, + {"SHA256WithRSA", Const, 0}, + {"SHA256WithRSAPSS", Const, 8}, + {"SHA384WithRSA", Const, 0}, + {"SHA384WithRSAPSS", Const, 8}, + {"SHA512WithRSA", Const, 0}, + {"SHA512WithRSAPSS", Const, 8}, + {"SetFallbackRoots", Func, 20}, + {"SignatureAlgorithm", Type, 0}, + {"SystemCertPool", Func, 7}, + {"SystemRootsError", Type, 1}, + {"SystemRootsError.Err", Field, 7}, + {"TooManyConstraints", Const, 10}, + {"TooManyIntermediates", Const, 0}, + {"UnconstrainedName", Const, 10}, + {"UnhandledCriticalExtension", Type, 0}, + {"UnknownAuthorityError", Type, 0}, + {"UnknownAuthorityError.Cert", Field, 8}, + {"UnknownPublicKeyAlgorithm", Const, 0}, + {"UnknownSignatureAlgorithm", Const, 0}, + {"VerifyOptions", Type, 0}, + {"VerifyOptions.CurrentTime", Field, 0}, + {"VerifyOptions.DNSName", Field, 0}, + {"VerifyOptions.Intermediates", Field, 0}, + {"VerifyOptions.KeyUsages", Field, 1}, + {"VerifyOptions.MaxConstraintComparisions", Field, 10}, + {"VerifyOptions.Roots", Field, 0}, + }, + "crypto/x509/pkix": { + {"(*CertificateList).HasExpired", Method, 0}, + {"(*Name).FillFromRDNSequence", Method, 0}, + {"(Name).String", Method, 10}, + {"(Name).ToRDNSequence", Method, 0}, + {"(RDNSequence).String", Method, 10}, + {"AlgorithmIdentifier", Type, 0}, + {"AlgorithmIdentifier.Algorithm", Field, 0}, + {"AlgorithmIdentifier.Parameters", Field, 0}, + {"AttributeTypeAndValue", Type, 0}, + {"AttributeTypeAndValue.Type", Field, 0}, + {"AttributeTypeAndValue.Value", Field, 0}, + {"AttributeTypeAndValueSET", Type, 3}, + {"AttributeTypeAndValueSET.Type", Field, 3}, + {"AttributeTypeAndValueSET.Value", Field, 3}, + {"CertificateList", Type, 0}, + {"CertificateList.SignatureAlgorithm", Field, 0}, + {"CertificateList.SignatureValue", Field, 0}, + {"CertificateList.TBSCertList", Field, 0}, + {"Extension", Type, 0}, + {"Extension.Critical", Field, 0}, + {"Extension.Id", Field, 0}, + {"Extension.Value", Field, 0}, + {"Name", Type, 0}, + {"Name.CommonName", Field, 0}, + {"Name.Country", Field, 0}, + {"Name.ExtraNames", Field, 5}, + {"Name.Locality", Field, 0}, + {"Name.Names", Field, 0}, + {"Name.Organization", Field, 0}, + {"Name.OrganizationalUnit", Field, 0}, + {"Name.PostalCode", Field, 0}, + {"Name.Province", Field, 0}, + {"Name.SerialNumber", Field, 0}, + {"Name.StreetAddress", Field, 0}, + {"RDNSequence", Type, 0}, + {"RelativeDistinguishedNameSET", Type, 0}, + {"RevokedCertificate", Type, 0}, + {"RevokedCertificate.Extensions", Field, 0}, + {"RevokedCertificate.RevocationTime", Field, 0}, + {"RevokedCertificate.SerialNumber", Field, 0}, + {"TBSCertificateList", Type, 0}, + {"TBSCertificateList.Extensions", Field, 0}, + {"TBSCertificateList.Issuer", Field, 0}, + {"TBSCertificateList.NextUpdate", Field, 0}, + {"TBSCertificateList.Raw", Field, 0}, + {"TBSCertificateList.RevokedCertificates", Field, 0}, + {"TBSCertificateList.Signature", Field, 0}, + {"TBSCertificateList.ThisUpdate", Field, 0}, + {"TBSCertificateList.Version", Field, 0}, + }, + "database/sql": { + {"(*ColumnType).DatabaseTypeName", Method, 8}, + {"(*ColumnType).DecimalSize", Method, 8}, + {"(*ColumnType).Length", Method, 8}, + {"(*ColumnType).Name", Method, 8}, + {"(*ColumnType).Nullable", Method, 8}, + {"(*ColumnType).ScanType", Method, 8}, + {"(*Conn).BeginTx", Method, 9}, + {"(*Conn).Close", Method, 9}, + {"(*Conn).ExecContext", Method, 9}, + {"(*Conn).PingContext", Method, 9}, + {"(*Conn).PrepareContext", Method, 9}, + {"(*Conn).QueryContext", Method, 9}, + {"(*Conn).QueryRowContext", Method, 9}, + {"(*Conn).Raw", Method, 13}, + {"(*DB).Begin", Method, 0}, + {"(*DB).BeginTx", Method, 8}, + {"(*DB).Close", Method, 0}, + {"(*DB).Conn", Method, 9}, + {"(*DB).Driver", Method, 0}, + {"(*DB).Exec", Method, 0}, + {"(*DB).ExecContext", Method, 8}, + {"(*DB).Ping", Method, 1}, + {"(*DB).PingContext", Method, 8}, + {"(*DB).Prepare", Method, 0}, + {"(*DB).PrepareContext", Method, 8}, + {"(*DB).Query", Method, 0}, + {"(*DB).QueryContext", Method, 8}, + {"(*DB).QueryRow", Method, 0}, + {"(*DB).QueryRowContext", Method, 8}, + {"(*DB).SetConnMaxIdleTime", Method, 15}, + {"(*DB).SetConnMaxLifetime", Method, 6}, + {"(*DB).SetMaxIdleConns", Method, 1}, + {"(*DB).SetMaxOpenConns", Method, 2}, + {"(*DB).Stats", Method, 5}, + {"(*Null).Scan", Method, 22}, + {"(*NullBool).Scan", Method, 0}, + {"(*NullByte).Scan", Method, 17}, + {"(*NullFloat64).Scan", Method, 0}, + {"(*NullInt16).Scan", Method, 17}, + {"(*NullInt32).Scan", Method, 13}, + {"(*NullInt64).Scan", Method, 0}, + {"(*NullString).Scan", Method, 0}, + {"(*NullTime).Scan", Method, 13}, + {"(*Row).Err", Method, 15}, + {"(*Row).Scan", Method, 0}, + {"(*Rows).Close", Method, 0}, + {"(*Rows).ColumnTypes", Method, 8}, + {"(*Rows).Columns", Method, 0}, + {"(*Rows).Err", Method, 0}, + {"(*Rows).Next", Method, 0}, + {"(*Rows).NextResultSet", Method, 8}, + {"(*Rows).Scan", Method, 0}, + {"(*Stmt).Close", Method, 0}, + {"(*Stmt).Exec", Method, 0}, + {"(*Stmt).ExecContext", Method, 8}, + {"(*Stmt).Query", Method, 0}, + {"(*Stmt).QueryContext", Method, 8}, + {"(*Stmt).QueryRow", Method, 0}, + {"(*Stmt).QueryRowContext", Method, 8}, + {"(*Tx).Commit", Method, 0}, + {"(*Tx).Exec", Method, 0}, + {"(*Tx).ExecContext", Method, 8}, + {"(*Tx).Prepare", Method, 0}, + {"(*Tx).PrepareContext", Method, 8}, + {"(*Tx).Query", Method, 0}, + {"(*Tx).QueryContext", Method, 8}, + {"(*Tx).QueryRow", Method, 0}, + {"(*Tx).QueryRowContext", Method, 8}, + {"(*Tx).Rollback", Method, 0}, + {"(*Tx).Stmt", Method, 0}, + {"(*Tx).StmtContext", Method, 8}, + {"(IsolationLevel).String", Method, 11}, + {"(Null).Value", Method, 22}, + {"(NullBool).Value", Method, 0}, + {"(NullByte).Value", Method, 17}, + {"(NullFloat64).Value", Method, 0}, + {"(NullInt16).Value", Method, 17}, + {"(NullInt32).Value", Method, 13}, + {"(NullInt64).Value", Method, 0}, + {"(NullString).Value", Method, 0}, + {"(NullTime).Value", Method, 13}, + {"ColumnType", Type, 8}, + {"Conn", Type, 9}, + {"DB", Type, 0}, + {"DBStats", Type, 5}, + {"DBStats.Idle", Field, 11}, + {"DBStats.InUse", Field, 11}, + {"DBStats.MaxIdleClosed", Field, 11}, + {"DBStats.MaxIdleTimeClosed", Field, 15}, + {"DBStats.MaxLifetimeClosed", Field, 11}, + {"DBStats.MaxOpenConnections", Field, 11}, + {"DBStats.OpenConnections", Field, 5}, + {"DBStats.WaitCount", Field, 11}, + {"DBStats.WaitDuration", Field, 11}, + {"Drivers", Func, 4}, + {"ErrConnDone", Var, 9}, + {"ErrNoRows", Var, 0}, + {"ErrTxDone", Var, 0}, + {"IsolationLevel", Type, 8}, + {"LevelDefault", Const, 8}, + {"LevelLinearizable", Const, 8}, + {"LevelReadCommitted", Const, 8}, + {"LevelReadUncommitted", Const, 8}, + {"LevelRepeatableRead", Const, 8}, + {"LevelSerializable", Const, 8}, + {"LevelSnapshot", Const, 8}, + {"LevelWriteCommitted", Const, 8}, + {"Named", Func, 8}, + {"NamedArg", Type, 8}, + {"NamedArg.Name", Field, 8}, + {"NamedArg.Value", Field, 8}, + {"Null", Type, 22}, + {"Null.V", Field, 22}, + {"Null.Valid", Field, 22}, + {"NullBool", Type, 0}, + {"NullBool.Bool", Field, 0}, + {"NullBool.Valid", Field, 0}, + {"NullByte", Type, 17}, + {"NullByte.Byte", Field, 17}, + {"NullByte.Valid", Field, 17}, + {"NullFloat64", Type, 0}, + {"NullFloat64.Float64", Field, 0}, + {"NullFloat64.Valid", Field, 0}, + {"NullInt16", Type, 17}, + {"NullInt16.Int16", Field, 17}, + {"NullInt16.Valid", Field, 17}, + {"NullInt32", Type, 13}, + {"NullInt32.Int32", Field, 13}, + {"NullInt32.Valid", Field, 13}, + {"NullInt64", Type, 0}, + {"NullInt64.Int64", Field, 0}, + {"NullInt64.Valid", Field, 0}, + {"NullString", Type, 0}, + {"NullString.String", Field, 0}, + {"NullString.Valid", Field, 0}, + {"NullTime", Type, 13}, + {"NullTime.Time", Field, 13}, + {"NullTime.Valid", Field, 13}, + {"Open", Func, 0}, + {"OpenDB", Func, 10}, + {"Out", Type, 9}, + {"Out.Dest", Field, 9}, + {"Out.In", Field, 9}, + {"RawBytes", Type, 0}, + {"Register", Func, 0}, + {"Result", Type, 0}, + {"Row", Type, 0}, + {"Rows", Type, 0}, + {"Scanner", Type, 0}, + {"Stmt", Type, 0}, + {"Tx", Type, 0}, + {"TxOptions", Type, 8}, + {"TxOptions.Isolation", Field, 8}, + {"TxOptions.ReadOnly", Field, 8}, + }, + "database/sql/driver": { + {"(NotNull).ConvertValue", Method, 0}, + {"(Null).ConvertValue", Method, 0}, + {"(RowsAffected).LastInsertId", Method, 0}, + {"(RowsAffected).RowsAffected", Method, 0}, + {"Bool", Var, 0}, + {"ColumnConverter", Type, 0}, + {"Conn", Type, 0}, + {"ConnBeginTx", Type, 8}, + {"ConnPrepareContext", Type, 8}, + {"Connector", Type, 10}, + {"DefaultParameterConverter", Var, 0}, + {"Driver", Type, 0}, + {"DriverContext", Type, 10}, + {"ErrBadConn", Var, 0}, + {"ErrRemoveArgument", Var, 9}, + {"ErrSkip", Var, 0}, + {"Execer", Type, 0}, + {"ExecerContext", Type, 8}, + {"Int32", Var, 0}, + {"IsScanValue", Func, 0}, + {"IsValue", Func, 0}, + {"IsolationLevel", Type, 8}, + {"NamedValue", Type, 8}, + {"NamedValue.Name", Field, 8}, + {"NamedValue.Ordinal", Field, 8}, + {"NamedValue.Value", Field, 8}, + {"NamedValueChecker", Type, 9}, + {"NotNull", Type, 0}, + {"NotNull.Converter", Field, 0}, + {"Null", Type, 0}, + {"Null.Converter", Field, 0}, + {"Pinger", Type, 8}, + {"Queryer", Type, 1}, + {"QueryerContext", Type, 8}, + {"Result", Type, 0}, + {"ResultNoRows", Var, 0}, + {"Rows", Type, 0}, + {"RowsAffected", Type, 0}, + {"RowsColumnTypeDatabaseTypeName", Type, 8}, + {"RowsColumnTypeLength", Type, 8}, + {"RowsColumnTypeNullable", Type, 8}, + {"RowsColumnTypePrecisionScale", Type, 8}, + {"RowsColumnTypeScanType", Type, 8}, + {"RowsNextResultSet", Type, 8}, + {"SessionResetter", Type, 10}, + {"Stmt", Type, 0}, + {"StmtExecContext", Type, 8}, + {"StmtQueryContext", Type, 8}, + {"String", Var, 0}, + {"Tx", Type, 0}, + {"TxOptions", Type, 8}, + {"TxOptions.Isolation", Field, 8}, + {"TxOptions.ReadOnly", Field, 8}, + {"Validator", Type, 15}, + {"Value", Type, 0}, + {"ValueConverter", Type, 0}, + {"Valuer", Type, 0}, + }, + "debug/buildinfo": { + {"BuildInfo", Type, 18}, + {"Read", Func, 18}, + {"ReadFile", Func, 18}, + }, + "debug/dwarf": { + {"(*AddrType).Basic", Method, 0}, + {"(*AddrType).Common", Method, 0}, + {"(*AddrType).Size", Method, 0}, + {"(*AddrType).String", Method, 0}, + {"(*ArrayType).Common", Method, 0}, + {"(*ArrayType).Size", Method, 0}, + {"(*ArrayType).String", Method, 0}, + {"(*BasicType).Basic", Method, 0}, + {"(*BasicType).Common", Method, 0}, + {"(*BasicType).Size", Method, 0}, + {"(*BasicType).String", Method, 0}, + {"(*BoolType).Basic", Method, 0}, + {"(*BoolType).Common", Method, 0}, + {"(*BoolType).Size", Method, 0}, + {"(*BoolType).String", Method, 0}, + {"(*CharType).Basic", Method, 0}, + {"(*CharType).Common", Method, 0}, + {"(*CharType).Size", Method, 0}, + {"(*CharType).String", Method, 0}, + {"(*CommonType).Common", Method, 0}, + {"(*CommonType).Size", Method, 0}, + {"(*ComplexType).Basic", Method, 0}, + {"(*ComplexType).Common", Method, 0}, + {"(*ComplexType).Size", Method, 0}, + {"(*ComplexType).String", Method, 0}, + {"(*Data).AddSection", Method, 14}, + {"(*Data).AddTypes", Method, 3}, + {"(*Data).LineReader", Method, 5}, + {"(*Data).Ranges", Method, 7}, + {"(*Data).Reader", Method, 0}, + {"(*Data).Type", Method, 0}, + {"(*DotDotDotType).Common", Method, 0}, + {"(*DotDotDotType).Size", Method, 0}, + {"(*DotDotDotType).String", Method, 0}, + {"(*Entry).AttrField", Method, 5}, + {"(*Entry).Val", Method, 0}, + {"(*EnumType).Common", Method, 0}, + {"(*EnumType).Size", Method, 0}, + {"(*EnumType).String", Method, 0}, + {"(*FloatType).Basic", Method, 0}, + {"(*FloatType).Common", Method, 0}, + {"(*FloatType).Size", Method, 0}, + {"(*FloatType).String", Method, 0}, + {"(*FuncType).Common", Method, 0}, + {"(*FuncType).Size", Method, 0}, + {"(*FuncType).String", Method, 0}, + {"(*IntType).Basic", Method, 0}, + {"(*IntType).Common", Method, 0}, + {"(*IntType).Size", Method, 0}, + {"(*IntType).String", Method, 0}, + {"(*LineReader).Files", Method, 14}, + {"(*LineReader).Next", Method, 5}, + {"(*LineReader).Reset", Method, 5}, + {"(*LineReader).Seek", Method, 5}, + {"(*LineReader).SeekPC", Method, 5}, + {"(*LineReader).Tell", Method, 5}, + {"(*PtrType).Common", Method, 0}, + {"(*PtrType).Size", Method, 0}, + {"(*PtrType).String", Method, 0}, + {"(*QualType).Common", Method, 0}, + {"(*QualType).Size", Method, 0}, + {"(*QualType).String", Method, 0}, + {"(*Reader).AddressSize", Method, 5}, + {"(*Reader).ByteOrder", Method, 14}, + {"(*Reader).Next", Method, 0}, + {"(*Reader).Seek", Method, 0}, + {"(*Reader).SeekPC", Method, 7}, + {"(*Reader).SkipChildren", Method, 0}, + {"(*StructType).Common", Method, 0}, + {"(*StructType).Defn", Method, 0}, + {"(*StructType).Size", Method, 0}, + {"(*StructType).String", Method, 0}, + {"(*TypedefType).Common", Method, 0}, + {"(*TypedefType).Size", Method, 0}, + {"(*TypedefType).String", Method, 0}, + {"(*UcharType).Basic", Method, 0}, + {"(*UcharType).Common", Method, 0}, + {"(*UcharType).Size", Method, 0}, + {"(*UcharType).String", Method, 0}, + {"(*UintType).Basic", Method, 0}, + {"(*UintType).Common", Method, 0}, + {"(*UintType).Size", Method, 0}, + {"(*UintType).String", Method, 0}, + {"(*UnspecifiedType).Basic", Method, 4}, + {"(*UnspecifiedType).Common", Method, 4}, + {"(*UnspecifiedType).Size", Method, 4}, + {"(*UnspecifiedType).String", Method, 4}, + {"(*UnsupportedType).Common", Method, 13}, + {"(*UnsupportedType).Size", Method, 13}, + {"(*UnsupportedType).String", Method, 13}, + {"(*VoidType).Common", Method, 0}, + {"(*VoidType).Size", Method, 0}, + {"(*VoidType).String", Method, 0}, + {"(Attr).GoString", Method, 0}, + {"(Attr).String", Method, 0}, + {"(Class).GoString", Method, 5}, + {"(Class).String", Method, 5}, + {"(DecodeError).Error", Method, 0}, + {"(Tag).GoString", Method, 0}, + {"(Tag).String", Method, 0}, + {"AddrType", Type, 0}, + {"AddrType.BasicType", Field, 0}, + {"ArrayType", Type, 0}, + {"ArrayType.CommonType", Field, 0}, + {"ArrayType.Count", Field, 0}, + {"ArrayType.StrideBitSize", Field, 0}, + {"ArrayType.Type", Field, 0}, + {"Attr", Type, 0}, + {"AttrAbstractOrigin", Const, 0}, + {"AttrAccessibility", Const, 0}, + {"AttrAddrBase", Const, 14}, + {"AttrAddrClass", Const, 0}, + {"AttrAlignment", Const, 14}, + {"AttrAllocated", Const, 0}, + {"AttrArtificial", Const, 0}, + {"AttrAssociated", Const, 0}, + {"AttrBaseTypes", Const, 0}, + {"AttrBinaryScale", Const, 14}, + {"AttrBitOffset", Const, 0}, + {"AttrBitSize", Const, 0}, + {"AttrByteSize", Const, 0}, + {"AttrCallAllCalls", Const, 14}, + {"AttrCallAllSourceCalls", Const, 14}, + {"AttrCallAllTailCalls", Const, 14}, + {"AttrCallColumn", Const, 0}, + {"AttrCallDataLocation", Const, 14}, + {"AttrCallDataValue", Const, 14}, + {"AttrCallFile", Const, 0}, + {"AttrCallLine", Const, 0}, + {"AttrCallOrigin", Const, 14}, + {"AttrCallPC", Const, 14}, + {"AttrCallParameter", Const, 14}, + {"AttrCallReturnPC", Const, 14}, + {"AttrCallTailCall", Const, 14}, + {"AttrCallTarget", Const, 14}, + {"AttrCallTargetClobbered", Const, 14}, + {"AttrCallValue", Const, 14}, + {"AttrCalling", Const, 0}, + {"AttrCommonRef", Const, 0}, + {"AttrCompDir", Const, 0}, + {"AttrConstExpr", Const, 14}, + {"AttrConstValue", Const, 0}, + {"AttrContainingType", Const, 0}, + {"AttrCount", Const, 0}, + {"AttrDataBitOffset", Const, 14}, + {"AttrDataLocation", Const, 0}, + {"AttrDataMemberLoc", Const, 0}, + {"AttrDecimalScale", Const, 14}, + {"AttrDecimalSign", Const, 14}, + {"AttrDeclColumn", Const, 0}, + {"AttrDeclFile", Const, 0}, + {"AttrDeclLine", Const, 0}, + {"AttrDeclaration", Const, 0}, + {"AttrDefaultValue", Const, 0}, + {"AttrDefaulted", Const, 14}, + {"AttrDeleted", Const, 14}, + {"AttrDescription", Const, 0}, + {"AttrDigitCount", Const, 14}, + {"AttrDiscr", Const, 0}, + {"AttrDiscrList", Const, 0}, + {"AttrDiscrValue", Const, 0}, + {"AttrDwoName", Const, 14}, + {"AttrElemental", Const, 14}, + {"AttrEncoding", Const, 0}, + {"AttrEndianity", Const, 14}, + {"AttrEntrypc", Const, 0}, + {"AttrEnumClass", Const, 14}, + {"AttrExplicit", Const, 14}, + {"AttrExportSymbols", Const, 14}, + {"AttrExtension", Const, 0}, + {"AttrExternal", Const, 0}, + {"AttrFrameBase", Const, 0}, + {"AttrFriend", Const, 0}, + {"AttrHighpc", Const, 0}, + {"AttrIdentifierCase", Const, 0}, + {"AttrImport", Const, 0}, + {"AttrInline", Const, 0}, + {"AttrIsOptional", Const, 0}, + {"AttrLanguage", Const, 0}, + {"AttrLinkageName", Const, 14}, + {"AttrLocation", Const, 0}, + {"AttrLoclistsBase", Const, 14}, + {"AttrLowerBound", Const, 0}, + {"AttrLowpc", Const, 0}, + {"AttrMacroInfo", Const, 0}, + {"AttrMacros", Const, 14}, + {"AttrMainSubprogram", Const, 14}, + {"AttrMutable", Const, 14}, + {"AttrName", Const, 0}, + {"AttrNamelistItem", Const, 0}, + {"AttrNoreturn", Const, 14}, + {"AttrObjectPointer", Const, 14}, + {"AttrOrdering", Const, 0}, + {"AttrPictureString", Const, 14}, + {"AttrPriority", Const, 0}, + {"AttrProducer", Const, 0}, + {"AttrPrototyped", Const, 0}, + {"AttrPure", Const, 14}, + {"AttrRanges", Const, 0}, + {"AttrRank", Const, 14}, + {"AttrRecursive", Const, 14}, + {"AttrReference", Const, 14}, + {"AttrReturnAddr", Const, 0}, + {"AttrRnglistsBase", Const, 14}, + {"AttrRvalueReference", Const, 14}, + {"AttrSegment", Const, 0}, + {"AttrSibling", Const, 0}, + {"AttrSignature", Const, 14}, + {"AttrSmall", Const, 14}, + {"AttrSpecification", Const, 0}, + {"AttrStartScope", Const, 0}, + {"AttrStaticLink", Const, 0}, + {"AttrStmtList", Const, 0}, + {"AttrStrOffsetsBase", Const, 14}, + {"AttrStride", Const, 0}, + {"AttrStrideSize", Const, 0}, + {"AttrStringLength", Const, 0}, + {"AttrStringLengthBitSize", Const, 14}, + {"AttrStringLengthByteSize", Const, 14}, + {"AttrThreadsScaled", Const, 14}, + {"AttrTrampoline", Const, 0}, + {"AttrType", Const, 0}, + {"AttrUpperBound", Const, 0}, + {"AttrUseLocation", Const, 0}, + {"AttrUseUTF8", Const, 0}, + {"AttrVarParam", Const, 0}, + {"AttrVirtuality", Const, 0}, + {"AttrVisibility", Const, 0}, + {"AttrVtableElemLoc", Const, 0}, + {"BasicType", Type, 0}, + {"BasicType.BitOffset", Field, 0}, + {"BasicType.BitSize", Field, 0}, + {"BasicType.CommonType", Field, 0}, + {"BasicType.DataBitOffset", Field, 18}, + {"BoolType", Type, 0}, + {"BoolType.BasicType", Field, 0}, + {"CharType", Type, 0}, + {"CharType.BasicType", Field, 0}, + {"Class", Type, 5}, + {"ClassAddrPtr", Const, 14}, + {"ClassAddress", Const, 5}, + {"ClassBlock", Const, 5}, + {"ClassConstant", Const, 5}, + {"ClassExprLoc", Const, 5}, + {"ClassFlag", Const, 5}, + {"ClassLinePtr", Const, 5}, + {"ClassLocList", Const, 14}, + {"ClassLocListPtr", Const, 5}, + {"ClassMacPtr", Const, 5}, + {"ClassRangeListPtr", Const, 5}, + {"ClassReference", Const, 5}, + {"ClassReferenceAlt", Const, 5}, + {"ClassReferenceSig", Const, 5}, + {"ClassRngList", Const, 14}, + {"ClassRngListsPtr", Const, 14}, + {"ClassStrOffsetsPtr", Const, 14}, + {"ClassString", Const, 5}, + {"ClassStringAlt", Const, 5}, + {"ClassUnknown", Const, 6}, + {"CommonType", Type, 0}, + {"CommonType.ByteSize", Field, 0}, + {"CommonType.Name", Field, 0}, + {"ComplexType", Type, 0}, + {"ComplexType.BasicType", Field, 0}, + {"Data", Type, 0}, + {"DecodeError", Type, 0}, + {"DecodeError.Err", Field, 0}, + {"DecodeError.Name", Field, 0}, + {"DecodeError.Offset", Field, 0}, + {"DotDotDotType", Type, 0}, + {"DotDotDotType.CommonType", Field, 0}, + {"Entry", Type, 0}, + {"Entry.Children", Field, 0}, + {"Entry.Field", Field, 0}, + {"Entry.Offset", Field, 0}, + {"Entry.Tag", Field, 0}, + {"EnumType", Type, 0}, + {"EnumType.CommonType", Field, 0}, + {"EnumType.EnumName", Field, 0}, + {"EnumType.Val", Field, 0}, + {"EnumValue", Type, 0}, + {"EnumValue.Name", Field, 0}, + {"EnumValue.Val", Field, 0}, + {"ErrUnknownPC", Var, 5}, + {"Field", Type, 0}, + {"Field.Attr", Field, 0}, + {"Field.Class", Field, 5}, + {"Field.Val", Field, 0}, + {"FloatType", Type, 0}, + {"FloatType.BasicType", Field, 0}, + {"FuncType", Type, 0}, + {"FuncType.CommonType", Field, 0}, + {"FuncType.ParamType", Field, 0}, + {"FuncType.ReturnType", Field, 0}, + {"IntType", Type, 0}, + {"IntType.BasicType", Field, 0}, + {"LineEntry", Type, 5}, + {"LineEntry.Address", Field, 5}, + {"LineEntry.BasicBlock", Field, 5}, + {"LineEntry.Column", Field, 5}, + {"LineEntry.Discriminator", Field, 5}, + {"LineEntry.EndSequence", Field, 5}, + {"LineEntry.EpilogueBegin", Field, 5}, + {"LineEntry.File", Field, 5}, + {"LineEntry.ISA", Field, 5}, + {"LineEntry.IsStmt", Field, 5}, + {"LineEntry.Line", Field, 5}, + {"LineEntry.OpIndex", Field, 5}, + {"LineEntry.PrologueEnd", Field, 5}, + {"LineFile", Type, 5}, + {"LineFile.Length", Field, 5}, + {"LineFile.Mtime", Field, 5}, + {"LineFile.Name", Field, 5}, + {"LineReader", Type, 5}, + {"LineReaderPos", Type, 5}, + {"New", Func, 0}, + {"Offset", Type, 0}, + {"PtrType", Type, 0}, + {"PtrType.CommonType", Field, 0}, + {"PtrType.Type", Field, 0}, + {"QualType", Type, 0}, + {"QualType.CommonType", Field, 0}, + {"QualType.Qual", Field, 0}, + {"QualType.Type", Field, 0}, + {"Reader", Type, 0}, + {"StructField", Type, 0}, + {"StructField.BitOffset", Field, 0}, + {"StructField.BitSize", Field, 0}, + {"StructField.ByteOffset", Field, 0}, + {"StructField.ByteSize", Field, 0}, + {"StructField.DataBitOffset", Field, 18}, + {"StructField.Name", Field, 0}, + {"StructField.Type", Field, 0}, + {"StructType", Type, 0}, + {"StructType.CommonType", Field, 0}, + {"StructType.Field", Field, 0}, + {"StructType.Incomplete", Field, 0}, + {"StructType.Kind", Field, 0}, + {"StructType.StructName", Field, 0}, + {"Tag", Type, 0}, + {"TagAccessDeclaration", Const, 0}, + {"TagArrayType", Const, 0}, + {"TagAtomicType", Const, 14}, + {"TagBaseType", Const, 0}, + {"TagCallSite", Const, 14}, + {"TagCallSiteParameter", Const, 14}, + {"TagCatchDwarfBlock", Const, 0}, + {"TagClassType", Const, 0}, + {"TagCoarrayType", Const, 14}, + {"TagCommonDwarfBlock", Const, 0}, + {"TagCommonInclusion", Const, 0}, + {"TagCompileUnit", Const, 0}, + {"TagCondition", Const, 3}, + {"TagConstType", Const, 0}, + {"TagConstant", Const, 0}, + {"TagDwarfProcedure", Const, 0}, + {"TagDynamicType", Const, 14}, + {"TagEntryPoint", Const, 0}, + {"TagEnumerationType", Const, 0}, + {"TagEnumerator", Const, 0}, + {"TagFileType", Const, 0}, + {"TagFormalParameter", Const, 0}, + {"TagFriend", Const, 0}, + {"TagGenericSubrange", Const, 14}, + {"TagImmutableType", Const, 14}, + {"TagImportedDeclaration", Const, 0}, + {"TagImportedModule", Const, 0}, + {"TagImportedUnit", Const, 0}, + {"TagInheritance", Const, 0}, + {"TagInlinedSubroutine", Const, 0}, + {"TagInterfaceType", Const, 0}, + {"TagLabel", Const, 0}, + {"TagLexDwarfBlock", Const, 0}, + {"TagMember", Const, 0}, + {"TagModule", Const, 0}, + {"TagMutableType", Const, 0}, + {"TagNamelist", Const, 0}, + {"TagNamelistItem", Const, 0}, + {"TagNamespace", Const, 0}, + {"TagPackedType", Const, 0}, + {"TagPartialUnit", Const, 0}, + {"TagPointerType", Const, 0}, + {"TagPtrToMemberType", Const, 0}, + {"TagReferenceType", Const, 0}, + {"TagRestrictType", Const, 0}, + {"TagRvalueReferenceType", Const, 3}, + {"TagSetType", Const, 0}, + {"TagSharedType", Const, 3}, + {"TagSkeletonUnit", Const, 14}, + {"TagStringType", Const, 0}, + {"TagStructType", Const, 0}, + {"TagSubprogram", Const, 0}, + {"TagSubrangeType", Const, 0}, + {"TagSubroutineType", Const, 0}, + {"TagTemplateAlias", Const, 3}, + {"TagTemplateTypeParameter", Const, 0}, + {"TagTemplateValueParameter", Const, 0}, + {"TagThrownType", Const, 0}, + {"TagTryDwarfBlock", Const, 0}, + {"TagTypeUnit", Const, 3}, + {"TagTypedef", Const, 0}, + {"TagUnionType", Const, 0}, + {"TagUnspecifiedParameters", Const, 0}, + {"TagUnspecifiedType", Const, 0}, + {"TagVariable", Const, 0}, + {"TagVariant", Const, 0}, + {"TagVariantPart", Const, 0}, + {"TagVolatileType", Const, 0}, + {"TagWithStmt", Const, 0}, + {"Type", Type, 0}, + {"TypedefType", Type, 0}, + {"TypedefType.CommonType", Field, 0}, + {"TypedefType.Type", Field, 0}, + {"UcharType", Type, 0}, + {"UcharType.BasicType", Field, 0}, + {"UintType", Type, 0}, + {"UintType.BasicType", Field, 0}, + {"UnspecifiedType", Type, 4}, + {"UnspecifiedType.BasicType", Field, 4}, + {"UnsupportedType", Type, 13}, + {"UnsupportedType.CommonType", Field, 13}, + {"UnsupportedType.Tag", Field, 13}, + {"VoidType", Type, 0}, + {"VoidType.CommonType", Field, 0}, + }, + "debug/elf": { + {"(*File).Close", Method, 0}, + {"(*File).DWARF", Method, 0}, + {"(*File).DynString", Method, 1}, + {"(*File).DynValue", Method, 21}, + {"(*File).DynamicSymbols", Method, 4}, + {"(*File).ImportedLibraries", Method, 0}, + {"(*File).ImportedSymbols", Method, 0}, + {"(*File).Section", Method, 0}, + {"(*File).SectionByType", Method, 0}, + {"(*File).Symbols", Method, 0}, + {"(*FormatError).Error", Method, 0}, + {"(*Prog).Open", Method, 0}, + {"(*Section).Data", Method, 0}, + {"(*Section).Open", Method, 0}, + {"(Class).GoString", Method, 0}, + {"(Class).String", Method, 0}, + {"(CompressionType).GoString", Method, 6}, + {"(CompressionType).String", Method, 6}, + {"(Data).GoString", Method, 0}, + {"(Data).String", Method, 0}, + {"(DynFlag).GoString", Method, 0}, + {"(DynFlag).String", Method, 0}, + {"(DynFlag1).GoString", Method, 21}, + {"(DynFlag1).String", Method, 21}, + {"(DynTag).GoString", Method, 0}, + {"(DynTag).String", Method, 0}, + {"(Machine).GoString", Method, 0}, + {"(Machine).String", Method, 0}, + {"(NType).GoString", Method, 0}, + {"(NType).String", Method, 0}, + {"(OSABI).GoString", Method, 0}, + {"(OSABI).String", Method, 0}, + {"(Prog).ReadAt", Method, 0}, + {"(ProgFlag).GoString", Method, 0}, + {"(ProgFlag).String", Method, 0}, + {"(ProgType).GoString", Method, 0}, + {"(ProgType).String", Method, 0}, + {"(R_386).GoString", Method, 0}, + {"(R_386).String", Method, 0}, + {"(R_390).GoString", Method, 7}, + {"(R_390).String", Method, 7}, + {"(R_AARCH64).GoString", Method, 4}, + {"(R_AARCH64).String", Method, 4}, + {"(R_ALPHA).GoString", Method, 0}, + {"(R_ALPHA).String", Method, 0}, + {"(R_ARM).GoString", Method, 0}, + {"(R_ARM).String", Method, 0}, + {"(R_LARCH).GoString", Method, 19}, + {"(R_LARCH).String", Method, 19}, + {"(R_MIPS).GoString", Method, 6}, + {"(R_MIPS).String", Method, 6}, + {"(R_PPC).GoString", Method, 0}, + {"(R_PPC).String", Method, 0}, + {"(R_PPC64).GoString", Method, 5}, + {"(R_PPC64).String", Method, 5}, + {"(R_RISCV).GoString", Method, 11}, + {"(R_RISCV).String", Method, 11}, + {"(R_SPARC).GoString", Method, 0}, + {"(R_SPARC).String", Method, 0}, + {"(R_X86_64).GoString", Method, 0}, + {"(R_X86_64).String", Method, 0}, + {"(Section).ReadAt", Method, 0}, + {"(SectionFlag).GoString", Method, 0}, + {"(SectionFlag).String", Method, 0}, + {"(SectionIndex).GoString", Method, 0}, + {"(SectionIndex).String", Method, 0}, + {"(SectionType).GoString", Method, 0}, + {"(SectionType).String", Method, 0}, + {"(SymBind).GoString", Method, 0}, + {"(SymBind).String", Method, 0}, + {"(SymType).GoString", Method, 0}, + {"(SymType).String", Method, 0}, + {"(SymVis).GoString", Method, 0}, + {"(SymVis).String", Method, 0}, + {"(Type).GoString", Method, 0}, + {"(Type).String", Method, 0}, + {"(Version).GoString", Method, 0}, + {"(Version).String", Method, 0}, + {"ARM_MAGIC_TRAMP_NUMBER", Const, 0}, + {"COMPRESS_HIOS", Const, 6}, + {"COMPRESS_HIPROC", Const, 6}, + {"COMPRESS_LOOS", Const, 6}, + {"COMPRESS_LOPROC", Const, 6}, + {"COMPRESS_ZLIB", Const, 6}, + {"COMPRESS_ZSTD", Const, 21}, + {"Chdr32", Type, 6}, + {"Chdr32.Addralign", Field, 6}, + {"Chdr32.Size", Field, 6}, + {"Chdr32.Type", Field, 6}, + {"Chdr64", Type, 6}, + {"Chdr64.Addralign", Field, 6}, + {"Chdr64.Size", Field, 6}, + {"Chdr64.Type", Field, 6}, + {"Class", Type, 0}, + {"CompressionType", Type, 6}, + {"DF_1_CONFALT", Const, 21}, + {"DF_1_DIRECT", Const, 21}, + {"DF_1_DISPRELDNE", Const, 21}, + {"DF_1_DISPRELPND", Const, 21}, + {"DF_1_EDITED", Const, 21}, + {"DF_1_ENDFILTEE", Const, 21}, + {"DF_1_GLOBAL", Const, 21}, + {"DF_1_GLOBAUDIT", Const, 21}, + {"DF_1_GROUP", Const, 21}, + {"DF_1_IGNMULDEF", Const, 21}, + {"DF_1_INITFIRST", Const, 21}, + {"DF_1_INTERPOSE", Const, 21}, + {"DF_1_KMOD", Const, 21}, + {"DF_1_LOADFLTR", Const, 21}, + {"DF_1_NOCOMMON", Const, 21}, + {"DF_1_NODEFLIB", Const, 21}, + {"DF_1_NODELETE", Const, 21}, + {"DF_1_NODIRECT", Const, 21}, + {"DF_1_NODUMP", Const, 21}, + {"DF_1_NOHDR", Const, 21}, + {"DF_1_NOKSYMS", Const, 21}, + {"DF_1_NOOPEN", Const, 21}, + {"DF_1_NORELOC", Const, 21}, + {"DF_1_NOW", Const, 21}, + {"DF_1_ORIGIN", Const, 21}, + {"DF_1_PIE", Const, 21}, + {"DF_1_SINGLETON", Const, 21}, + {"DF_1_STUB", Const, 21}, + {"DF_1_SYMINTPOSE", Const, 21}, + {"DF_1_TRANS", Const, 21}, + {"DF_1_WEAKFILTER", Const, 21}, + {"DF_BIND_NOW", Const, 0}, + {"DF_ORIGIN", Const, 0}, + {"DF_STATIC_TLS", Const, 0}, + {"DF_SYMBOLIC", Const, 0}, + {"DF_TEXTREL", Const, 0}, + {"DT_ADDRRNGHI", Const, 16}, + {"DT_ADDRRNGLO", Const, 16}, + {"DT_AUDIT", Const, 16}, + {"DT_AUXILIARY", Const, 16}, + {"DT_BIND_NOW", Const, 0}, + {"DT_CHECKSUM", Const, 16}, + {"DT_CONFIG", Const, 16}, + {"DT_DEBUG", Const, 0}, + {"DT_DEPAUDIT", Const, 16}, + {"DT_ENCODING", Const, 0}, + {"DT_FEATURE", Const, 16}, + {"DT_FILTER", Const, 16}, + {"DT_FINI", Const, 0}, + {"DT_FINI_ARRAY", Const, 0}, + {"DT_FINI_ARRAYSZ", Const, 0}, + {"DT_FLAGS", Const, 0}, + {"DT_FLAGS_1", Const, 16}, + {"DT_GNU_CONFLICT", Const, 16}, + {"DT_GNU_CONFLICTSZ", Const, 16}, + {"DT_GNU_HASH", Const, 16}, + {"DT_GNU_LIBLIST", Const, 16}, + {"DT_GNU_LIBLISTSZ", Const, 16}, + {"DT_GNU_PRELINKED", Const, 16}, + {"DT_HASH", Const, 0}, + {"DT_HIOS", Const, 0}, + {"DT_HIPROC", Const, 0}, + {"DT_INIT", Const, 0}, + {"DT_INIT_ARRAY", Const, 0}, + {"DT_INIT_ARRAYSZ", Const, 0}, + {"DT_JMPREL", Const, 0}, + {"DT_LOOS", Const, 0}, + {"DT_LOPROC", Const, 0}, + {"DT_MIPS_AUX_DYNAMIC", Const, 16}, + {"DT_MIPS_BASE_ADDRESS", Const, 16}, + {"DT_MIPS_COMPACT_SIZE", Const, 16}, + {"DT_MIPS_CONFLICT", Const, 16}, + {"DT_MIPS_CONFLICTNO", Const, 16}, + {"DT_MIPS_CXX_FLAGS", Const, 16}, + {"DT_MIPS_DELTA_CLASS", Const, 16}, + {"DT_MIPS_DELTA_CLASSSYM", Const, 16}, + {"DT_MIPS_DELTA_CLASSSYM_NO", Const, 16}, + {"DT_MIPS_DELTA_CLASS_NO", Const, 16}, + {"DT_MIPS_DELTA_INSTANCE", Const, 16}, + {"DT_MIPS_DELTA_INSTANCE_NO", Const, 16}, + {"DT_MIPS_DELTA_RELOC", Const, 16}, + {"DT_MIPS_DELTA_RELOC_NO", Const, 16}, + {"DT_MIPS_DELTA_SYM", Const, 16}, + {"DT_MIPS_DELTA_SYM_NO", Const, 16}, + {"DT_MIPS_DYNSTR_ALIGN", Const, 16}, + {"DT_MIPS_FLAGS", Const, 16}, + {"DT_MIPS_GOTSYM", Const, 16}, + {"DT_MIPS_GP_VALUE", Const, 16}, + {"DT_MIPS_HIDDEN_GOTIDX", Const, 16}, + {"DT_MIPS_HIPAGENO", Const, 16}, + {"DT_MIPS_ICHECKSUM", Const, 16}, + {"DT_MIPS_INTERFACE", Const, 16}, + {"DT_MIPS_INTERFACE_SIZE", Const, 16}, + {"DT_MIPS_IVERSION", Const, 16}, + {"DT_MIPS_LIBLIST", Const, 16}, + {"DT_MIPS_LIBLISTNO", Const, 16}, + {"DT_MIPS_LOCALPAGE_GOTIDX", Const, 16}, + {"DT_MIPS_LOCAL_GOTIDX", Const, 16}, + {"DT_MIPS_LOCAL_GOTNO", Const, 16}, + {"DT_MIPS_MSYM", Const, 16}, + {"DT_MIPS_OPTIONS", Const, 16}, + {"DT_MIPS_PERF_SUFFIX", Const, 16}, + {"DT_MIPS_PIXIE_INIT", Const, 16}, + {"DT_MIPS_PLTGOT", Const, 16}, + {"DT_MIPS_PROTECTED_GOTIDX", Const, 16}, + {"DT_MIPS_RLD_MAP", Const, 16}, + {"DT_MIPS_RLD_MAP_REL", Const, 16}, + {"DT_MIPS_RLD_TEXT_RESOLVE_ADDR", Const, 16}, + {"DT_MIPS_RLD_VERSION", Const, 16}, + {"DT_MIPS_RWPLT", Const, 16}, + {"DT_MIPS_SYMBOL_LIB", Const, 16}, + {"DT_MIPS_SYMTABNO", Const, 16}, + {"DT_MIPS_TIME_STAMP", Const, 16}, + {"DT_MIPS_UNREFEXTNO", Const, 16}, + {"DT_MOVEENT", Const, 16}, + {"DT_MOVESZ", Const, 16}, + {"DT_MOVETAB", Const, 16}, + {"DT_NEEDED", Const, 0}, + {"DT_NULL", Const, 0}, + {"DT_PLTGOT", Const, 0}, + {"DT_PLTPAD", Const, 16}, + {"DT_PLTPADSZ", Const, 16}, + {"DT_PLTREL", Const, 0}, + {"DT_PLTRELSZ", Const, 0}, + {"DT_POSFLAG_1", Const, 16}, + {"DT_PPC64_GLINK", Const, 16}, + {"DT_PPC64_OPD", Const, 16}, + {"DT_PPC64_OPDSZ", Const, 16}, + {"DT_PPC64_OPT", Const, 16}, + {"DT_PPC_GOT", Const, 16}, + {"DT_PPC_OPT", Const, 16}, + {"DT_PREINIT_ARRAY", Const, 0}, + {"DT_PREINIT_ARRAYSZ", Const, 0}, + {"DT_REL", Const, 0}, + {"DT_RELA", Const, 0}, + {"DT_RELACOUNT", Const, 16}, + {"DT_RELAENT", Const, 0}, + {"DT_RELASZ", Const, 0}, + {"DT_RELCOUNT", Const, 16}, + {"DT_RELENT", Const, 0}, + {"DT_RELSZ", Const, 0}, + {"DT_RPATH", Const, 0}, + {"DT_RUNPATH", Const, 0}, + {"DT_SONAME", Const, 0}, + {"DT_SPARC_REGISTER", Const, 16}, + {"DT_STRSZ", Const, 0}, + {"DT_STRTAB", Const, 0}, + {"DT_SYMBOLIC", Const, 0}, + {"DT_SYMENT", Const, 0}, + {"DT_SYMINENT", Const, 16}, + {"DT_SYMINFO", Const, 16}, + {"DT_SYMINSZ", Const, 16}, + {"DT_SYMTAB", Const, 0}, + {"DT_SYMTAB_SHNDX", Const, 16}, + {"DT_TEXTREL", Const, 0}, + {"DT_TLSDESC_GOT", Const, 16}, + {"DT_TLSDESC_PLT", Const, 16}, + {"DT_USED", Const, 16}, + {"DT_VALRNGHI", Const, 16}, + {"DT_VALRNGLO", Const, 16}, + {"DT_VERDEF", Const, 16}, + {"DT_VERDEFNUM", Const, 16}, + {"DT_VERNEED", Const, 0}, + {"DT_VERNEEDNUM", Const, 0}, + {"DT_VERSYM", Const, 0}, + {"Data", Type, 0}, + {"Dyn32", Type, 0}, + {"Dyn32.Tag", Field, 0}, + {"Dyn32.Val", Field, 0}, + {"Dyn64", Type, 0}, + {"Dyn64.Tag", Field, 0}, + {"Dyn64.Val", Field, 0}, + {"DynFlag", Type, 0}, + {"DynFlag1", Type, 21}, + {"DynTag", Type, 0}, + {"EI_ABIVERSION", Const, 0}, + {"EI_CLASS", Const, 0}, + {"EI_DATA", Const, 0}, + {"EI_NIDENT", Const, 0}, + {"EI_OSABI", Const, 0}, + {"EI_PAD", Const, 0}, + {"EI_VERSION", Const, 0}, + {"ELFCLASS32", Const, 0}, + {"ELFCLASS64", Const, 0}, + {"ELFCLASSNONE", Const, 0}, + {"ELFDATA2LSB", Const, 0}, + {"ELFDATA2MSB", Const, 0}, + {"ELFDATANONE", Const, 0}, + {"ELFMAG", Const, 0}, + {"ELFOSABI_86OPEN", Const, 0}, + {"ELFOSABI_AIX", Const, 0}, + {"ELFOSABI_ARM", Const, 0}, + {"ELFOSABI_AROS", Const, 11}, + {"ELFOSABI_CLOUDABI", Const, 11}, + {"ELFOSABI_FENIXOS", Const, 11}, + {"ELFOSABI_FREEBSD", Const, 0}, + {"ELFOSABI_HPUX", Const, 0}, + {"ELFOSABI_HURD", Const, 0}, + {"ELFOSABI_IRIX", Const, 0}, + {"ELFOSABI_LINUX", Const, 0}, + {"ELFOSABI_MODESTO", Const, 0}, + {"ELFOSABI_NETBSD", Const, 0}, + {"ELFOSABI_NONE", Const, 0}, + {"ELFOSABI_NSK", Const, 0}, + {"ELFOSABI_OPENBSD", Const, 0}, + {"ELFOSABI_OPENVMS", Const, 0}, + {"ELFOSABI_SOLARIS", Const, 0}, + {"ELFOSABI_STANDALONE", Const, 0}, + {"ELFOSABI_TRU64", Const, 0}, + {"EM_386", Const, 0}, + {"EM_486", Const, 0}, + {"EM_56800EX", Const, 11}, + {"EM_68HC05", Const, 11}, + {"EM_68HC08", Const, 11}, + {"EM_68HC11", Const, 11}, + {"EM_68HC12", Const, 0}, + {"EM_68HC16", Const, 11}, + {"EM_68K", Const, 0}, + {"EM_78KOR", Const, 11}, + {"EM_8051", Const, 11}, + {"EM_860", Const, 0}, + {"EM_88K", Const, 0}, + {"EM_960", Const, 0}, + {"EM_AARCH64", Const, 4}, + {"EM_ALPHA", Const, 0}, + {"EM_ALPHA_STD", Const, 0}, + {"EM_ALTERA_NIOS2", Const, 11}, + {"EM_AMDGPU", Const, 11}, + {"EM_ARC", Const, 0}, + {"EM_ARCA", Const, 11}, + {"EM_ARC_COMPACT", Const, 11}, + {"EM_ARC_COMPACT2", Const, 11}, + {"EM_ARM", Const, 0}, + {"EM_AVR", Const, 11}, + {"EM_AVR32", Const, 11}, + {"EM_BA1", Const, 11}, + {"EM_BA2", Const, 11}, + {"EM_BLACKFIN", Const, 11}, + {"EM_BPF", Const, 11}, + {"EM_C166", Const, 11}, + {"EM_CDP", Const, 11}, + {"EM_CE", Const, 11}, + {"EM_CLOUDSHIELD", Const, 11}, + {"EM_COGE", Const, 11}, + {"EM_COLDFIRE", Const, 0}, + {"EM_COOL", Const, 11}, + {"EM_COREA_1ST", Const, 11}, + {"EM_COREA_2ND", Const, 11}, + {"EM_CR", Const, 11}, + {"EM_CR16", Const, 11}, + {"EM_CRAYNV2", Const, 11}, + {"EM_CRIS", Const, 11}, + {"EM_CRX", Const, 11}, + {"EM_CSR_KALIMBA", Const, 11}, + {"EM_CUDA", Const, 11}, + {"EM_CYPRESS_M8C", Const, 11}, + {"EM_D10V", Const, 11}, + {"EM_D30V", Const, 11}, + {"EM_DSP24", Const, 11}, + {"EM_DSPIC30F", Const, 11}, + {"EM_DXP", Const, 11}, + {"EM_ECOG1", Const, 11}, + {"EM_ECOG16", Const, 11}, + {"EM_ECOG1X", Const, 11}, + {"EM_ECOG2", Const, 11}, + {"EM_ETPU", Const, 11}, + {"EM_EXCESS", Const, 11}, + {"EM_F2MC16", Const, 11}, + {"EM_FIREPATH", Const, 11}, + {"EM_FR20", Const, 0}, + {"EM_FR30", Const, 11}, + {"EM_FT32", Const, 11}, + {"EM_FX66", Const, 11}, + {"EM_H8S", Const, 0}, + {"EM_H8_300", Const, 0}, + {"EM_H8_300H", Const, 0}, + {"EM_H8_500", Const, 0}, + {"EM_HUANY", Const, 11}, + {"EM_IA_64", Const, 0}, + {"EM_INTEL205", Const, 11}, + {"EM_INTEL206", Const, 11}, + {"EM_INTEL207", Const, 11}, + {"EM_INTEL208", Const, 11}, + {"EM_INTEL209", Const, 11}, + {"EM_IP2K", Const, 11}, + {"EM_JAVELIN", Const, 11}, + {"EM_K10M", Const, 11}, + {"EM_KM32", Const, 11}, + {"EM_KMX16", Const, 11}, + {"EM_KMX32", Const, 11}, + {"EM_KMX8", Const, 11}, + {"EM_KVARC", Const, 11}, + {"EM_L10M", Const, 11}, + {"EM_LANAI", Const, 11}, + {"EM_LATTICEMICO32", Const, 11}, + {"EM_LOONGARCH", Const, 19}, + {"EM_M16C", Const, 11}, + {"EM_M32", Const, 0}, + {"EM_M32C", Const, 11}, + {"EM_M32R", Const, 11}, + {"EM_MANIK", Const, 11}, + {"EM_MAX", Const, 11}, + {"EM_MAXQ30", Const, 11}, + {"EM_MCHP_PIC", Const, 11}, + {"EM_MCST_ELBRUS", Const, 11}, + {"EM_ME16", Const, 0}, + {"EM_METAG", Const, 11}, + {"EM_MICROBLAZE", Const, 11}, + {"EM_MIPS", Const, 0}, + {"EM_MIPS_RS3_LE", Const, 0}, + {"EM_MIPS_RS4_BE", Const, 0}, + {"EM_MIPS_X", Const, 0}, + {"EM_MMA", Const, 0}, + {"EM_MMDSP_PLUS", Const, 11}, + {"EM_MMIX", Const, 11}, + {"EM_MN10200", Const, 11}, + {"EM_MN10300", Const, 11}, + {"EM_MOXIE", Const, 11}, + {"EM_MSP430", Const, 11}, + {"EM_NCPU", Const, 0}, + {"EM_NDR1", Const, 0}, + {"EM_NDS32", Const, 11}, + {"EM_NONE", Const, 0}, + {"EM_NORC", Const, 11}, + {"EM_NS32K", Const, 11}, + {"EM_OPEN8", Const, 11}, + {"EM_OPENRISC", Const, 11}, + {"EM_PARISC", Const, 0}, + {"EM_PCP", Const, 0}, + {"EM_PDP10", Const, 11}, + {"EM_PDP11", Const, 11}, + {"EM_PDSP", Const, 11}, + {"EM_PJ", Const, 11}, + {"EM_PPC", Const, 0}, + {"EM_PPC64", Const, 0}, + {"EM_PRISM", Const, 11}, + {"EM_QDSP6", Const, 11}, + {"EM_R32C", Const, 11}, + {"EM_RCE", Const, 0}, + {"EM_RH32", Const, 0}, + {"EM_RISCV", Const, 11}, + {"EM_RL78", Const, 11}, + {"EM_RS08", Const, 11}, + {"EM_RX", Const, 11}, + {"EM_S370", Const, 0}, + {"EM_S390", Const, 0}, + {"EM_SCORE7", Const, 11}, + {"EM_SEP", Const, 11}, + {"EM_SE_C17", Const, 11}, + {"EM_SE_C33", Const, 11}, + {"EM_SH", Const, 0}, + {"EM_SHARC", Const, 11}, + {"EM_SLE9X", Const, 11}, + {"EM_SNP1K", Const, 11}, + {"EM_SPARC", Const, 0}, + {"EM_SPARC32PLUS", Const, 0}, + {"EM_SPARCV9", Const, 0}, + {"EM_ST100", Const, 0}, + {"EM_ST19", Const, 11}, + {"EM_ST200", Const, 11}, + {"EM_ST7", Const, 11}, + {"EM_ST9PLUS", Const, 11}, + {"EM_STARCORE", Const, 0}, + {"EM_STM8", Const, 11}, + {"EM_STXP7X", Const, 11}, + {"EM_SVX", Const, 11}, + {"EM_TILE64", Const, 11}, + {"EM_TILEGX", Const, 11}, + {"EM_TILEPRO", Const, 11}, + {"EM_TINYJ", Const, 0}, + {"EM_TI_ARP32", Const, 11}, + {"EM_TI_C2000", Const, 11}, + {"EM_TI_C5500", Const, 11}, + {"EM_TI_C6000", Const, 11}, + {"EM_TI_PRU", Const, 11}, + {"EM_TMM_GPP", Const, 11}, + {"EM_TPC", Const, 11}, + {"EM_TRICORE", Const, 0}, + {"EM_TRIMEDIA", Const, 11}, + {"EM_TSK3000", Const, 11}, + {"EM_UNICORE", Const, 11}, + {"EM_V800", Const, 0}, + {"EM_V850", Const, 11}, + {"EM_VAX", Const, 11}, + {"EM_VIDEOCORE", Const, 11}, + {"EM_VIDEOCORE3", Const, 11}, + {"EM_VIDEOCORE5", Const, 11}, + {"EM_VISIUM", Const, 11}, + {"EM_VPP500", Const, 0}, + {"EM_X86_64", Const, 0}, + {"EM_XCORE", Const, 11}, + {"EM_XGATE", Const, 11}, + {"EM_XIMO16", Const, 11}, + {"EM_XTENSA", Const, 11}, + {"EM_Z80", Const, 11}, + {"EM_ZSP", Const, 11}, + {"ET_CORE", Const, 0}, + {"ET_DYN", Const, 0}, + {"ET_EXEC", Const, 0}, + {"ET_HIOS", Const, 0}, + {"ET_HIPROC", Const, 0}, + {"ET_LOOS", Const, 0}, + {"ET_LOPROC", Const, 0}, + {"ET_NONE", Const, 0}, + {"ET_REL", Const, 0}, + {"EV_CURRENT", Const, 0}, + {"EV_NONE", Const, 0}, + {"ErrNoSymbols", Var, 4}, + {"File", Type, 0}, + {"File.FileHeader", Field, 0}, + {"File.Progs", Field, 0}, + {"File.Sections", Field, 0}, + {"FileHeader", Type, 0}, + {"FileHeader.ABIVersion", Field, 0}, + {"FileHeader.ByteOrder", Field, 0}, + {"FileHeader.Class", Field, 0}, + {"FileHeader.Data", Field, 0}, + {"FileHeader.Entry", Field, 1}, + {"FileHeader.Machine", Field, 0}, + {"FileHeader.OSABI", Field, 0}, + {"FileHeader.Type", Field, 0}, + {"FileHeader.Version", Field, 0}, + {"FormatError", Type, 0}, + {"Header32", Type, 0}, + {"Header32.Ehsize", Field, 0}, + {"Header32.Entry", Field, 0}, + {"Header32.Flags", Field, 0}, + {"Header32.Ident", Field, 0}, + {"Header32.Machine", Field, 0}, + {"Header32.Phentsize", Field, 0}, + {"Header32.Phnum", Field, 0}, + {"Header32.Phoff", Field, 0}, + {"Header32.Shentsize", Field, 0}, + {"Header32.Shnum", Field, 0}, + {"Header32.Shoff", Field, 0}, + {"Header32.Shstrndx", Field, 0}, + {"Header32.Type", Field, 0}, + {"Header32.Version", Field, 0}, + {"Header64", Type, 0}, + {"Header64.Ehsize", Field, 0}, + {"Header64.Entry", Field, 0}, + {"Header64.Flags", Field, 0}, + {"Header64.Ident", Field, 0}, + {"Header64.Machine", Field, 0}, + {"Header64.Phentsize", Field, 0}, + {"Header64.Phnum", Field, 0}, + {"Header64.Phoff", Field, 0}, + {"Header64.Shentsize", Field, 0}, + {"Header64.Shnum", Field, 0}, + {"Header64.Shoff", Field, 0}, + {"Header64.Shstrndx", Field, 0}, + {"Header64.Type", Field, 0}, + {"Header64.Version", Field, 0}, + {"ImportedSymbol", Type, 0}, + {"ImportedSymbol.Library", Field, 0}, + {"ImportedSymbol.Name", Field, 0}, + {"ImportedSymbol.Version", Field, 0}, + {"Machine", Type, 0}, + {"NT_FPREGSET", Const, 0}, + {"NT_PRPSINFO", Const, 0}, + {"NT_PRSTATUS", Const, 0}, + {"NType", Type, 0}, + {"NewFile", Func, 0}, + {"OSABI", Type, 0}, + {"Open", Func, 0}, + {"PF_MASKOS", Const, 0}, + {"PF_MASKPROC", Const, 0}, + {"PF_R", Const, 0}, + {"PF_W", Const, 0}, + {"PF_X", Const, 0}, + {"PT_AARCH64_ARCHEXT", Const, 16}, + {"PT_AARCH64_UNWIND", Const, 16}, + {"PT_ARM_ARCHEXT", Const, 16}, + {"PT_ARM_EXIDX", Const, 16}, + {"PT_DYNAMIC", Const, 0}, + {"PT_GNU_EH_FRAME", Const, 16}, + {"PT_GNU_MBIND_HI", Const, 16}, + {"PT_GNU_MBIND_LO", Const, 16}, + {"PT_GNU_PROPERTY", Const, 16}, + {"PT_GNU_RELRO", Const, 16}, + {"PT_GNU_STACK", Const, 16}, + {"PT_HIOS", Const, 0}, + {"PT_HIPROC", Const, 0}, + {"PT_INTERP", Const, 0}, + {"PT_LOAD", Const, 0}, + {"PT_LOOS", Const, 0}, + {"PT_LOPROC", Const, 0}, + {"PT_MIPS_ABIFLAGS", Const, 16}, + {"PT_MIPS_OPTIONS", Const, 16}, + {"PT_MIPS_REGINFO", Const, 16}, + {"PT_MIPS_RTPROC", Const, 16}, + {"PT_NOTE", Const, 0}, + {"PT_NULL", Const, 0}, + {"PT_OPENBSD_BOOTDATA", Const, 16}, + {"PT_OPENBSD_RANDOMIZE", Const, 16}, + {"PT_OPENBSD_WXNEEDED", Const, 16}, + {"PT_PAX_FLAGS", Const, 16}, + {"PT_PHDR", Const, 0}, + {"PT_S390_PGSTE", Const, 16}, + {"PT_SHLIB", Const, 0}, + {"PT_SUNWSTACK", Const, 16}, + {"PT_SUNW_EH_FRAME", Const, 16}, + {"PT_TLS", Const, 0}, + {"Prog", Type, 0}, + {"Prog.ProgHeader", Field, 0}, + {"Prog.ReaderAt", Field, 0}, + {"Prog32", Type, 0}, + {"Prog32.Align", Field, 0}, + {"Prog32.Filesz", Field, 0}, + {"Prog32.Flags", Field, 0}, + {"Prog32.Memsz", Field, 0}, + {"Prog32.Off", Field, 0}, + {"Prog32.Paddr", Field, 0}, + {"Prog32.Type", Field, 0}, + {"Prog32.Vaddr", Field, 0}, + {"Prog64", Type, 0}, + {"Prog64.Align", Field, 0}, + {"Prog64.Filesz", Field, 0}, + {"Prog64.Flags", Field, 0}, + {"Prog64.Memsz", Field, 0}, + {"Prog64.Off", Field, 0}, + {"Prog64.Paddr", Field, 0}, + {"Prog64.Type", Field, 0}, + {"Prog64.Vaddr", Field, 0}, + {"ProgFlag", Type, 0}, + {"ProgHeader", Type, 0}, + {"ProgHeader.Align", Field, 0}, + {"ProgHeader.Filesz", Field, 0}, + {"ProgHeader.Flags", Field, 0}, + {"ProgHeader.Memsz", Field, 0}, + {"ProgHeader.Off", Field, 0}, + {"ProgHeader.Paddr", Field, 0}, + {"ProgHeader.Type", Field, 0}, + {"ProgHeader.Vaddr", Field, 0}, + {"ProgType", Type, 0}, + {"R_386", Type, 0}, + {"R_386_16", Const, 10}, + {"R_386_32", Const, 0}, + {"R_386_32PLT", Const, 10}, + {"R_386_8", Const, 10}, + {"R_386_COPY", Const, 0}, + {"R_386_GLOB_DAT", Const, 0}, + {"R_386_GOT32", Const, 0}, + {"R_386_GOT32X", Const, 10}, + {"R_386_GOTOFF", Const, 0}, + {"R_386_GOTPC", Const, 0}, + {"R_386_IRELATIVE", Const, 10}, + {"R_386_JMP_SLOT", Const, 0}, + {"R_386_NONE", Const, 0}, + {"R_386_PC16", Const, 10}, + {"R_386_PC32", Const, 0}, + {"R_386_PC8", Const, 10}, + {"R_386_PLT32", Const, 0}, + {"R_386_RELATIVE", Const, 0}, + {"R_386_SIZE32", Const, 10}, + {"R_386_TLS_DESC", Const, 10}, + {"R_386_TLS_DESC_CALL", Const, 10}, + {"R_386_TLS_DTPMOD32", Const, 0}, + {"R_386_TLS_DTPOFF32", Const, 0}, + {"R_386_TLS_GD", Const, 0}, + {"R_386_TLS_GD_32", Const, 0}, + {"R_386_TLS_GD_CALL", Const, 0}, + {"R_386_TLS_GD_POP", Const, 0}, + {"R_386_TLS_GD_PUSH", Const, 0}, + {"R_386_TLS_GOTDESC", Const, 10}, + {"R_386_TLS_GOTIE", Const, 0}, + {"R_386_TLS_IE", Const, 0}, + {"R_386_TLS_IE_32", Const, 0}, + {"R_386_TLS_LDM", Const, 0}, + {"R_386_TLS_LDM_32", Const, 0}, + {"R_386_TLS_LDM_CALL", Const, 0}, + {"R_386_TLS_LDM_POP", Const, 0}, + {"R_386_TLS_LDM_PUSH", Const, 0}, + {"R_386_TLS_LDO_32", Const, 0}, + {"R_386_TLS_LE", Const, 0}, + {"R_386_TLS_LE_32", Const, 0}, + {"R_386_TLS_TPOFF", Const, 0}, + {"R_386_TLS_TPOFF32", Const, 0}, + {"R_390", Type, 7}, + {"R_390_12", Const, 7}, + {"R_390_16", Const, 7}, + {"R_390_20", Const, 7}, + {"R_390_32", Const, 7}, + {"R_390_64", Const, 7}, + {"R_390_8", Const, 7}, + {"R_390_COPY", Const, 7}, + {"R_390_GLOB_DAT", Const, 7}, + {"R_390_GOT12", Const, 7}, + {"R_390_GOT16", Const, 7}, + {"R_390_GOT20", Const, 7}, + {"R_390_GOT32", Const, 7}, + {"R_390_GOT64", Const, 7}, + {"R_390_GOTENT", Const, 7}, + {"R_390_GOTOFF", Const, 7}, + {"R_390_GOTOFF16", Const, 7}, + {"R_390_GOTOFF64", Const, 7}, + {"R_390_GOTPC", Const, 7}, + {"R_390_GOTPCDBL", Const, 7}, + {"R_390_GOTPLT12", Const, 7}, + {"R_390_GOTPLT16", Const, 7}, + {"R_390_GOTPLT20", Const, 7}, + {"R_390_GOTPLT32", Const, 7}, + {"R_390_GOTPLT64", Const, 7}, + {"R_390_GOTPLTENT", Const, 7}, + {"R_390_GOTPLTOFF16", Const, 7}, + {"R_390_GOTPLTOFF32", Const, 7}, + {"R_390_GOTPLTOFF64", Const, 7}, + {"R_390_JMP_SLOT", Const, 7}, + {"R_390_NONE", Const, 7}, + {"R_390_PC16", Const, 7}, + {"R_390_PC16DBL", Const, 7}, + {"R_390_PC32", Const, 7}, + {"R_390_PC32DBL", Const, 7}, + {"R_390_PC64", Const, 7}, + {"R_390_PLT16DBL", Const, 7}, + {"R_390_PLT32", Const, 7}, + {"R_390_PLT32DBL", Const, 7}, + {"R_390_PLT64", Const, 7}, + {"R_390_RELATIVE", Const, 7}, + {"R_390_TLS_DTPMOD", Const, 7}, + {"R_390_TLS_DTPOFF", Const, 7}, + {"R_390_TLS_GD32", Const, 7}, + {"R_390_TLS_GD64", Const, 7}, + {"R_390_TLS_GDCALL", Const, 7}, + {"R_390_TLS_GOTIE12", Const, 7}, + {"R_390_TLS_GOTIE20", Const, 7}, + {"R_390_TLS_GOTIE32", Const, 7}, + {"R_390_TLS_GOTIE64", Const, 7}, + {"R_390_TLS_IE32", Const, 7}, + {"R_390_TLS_IE64", Const, 7}, + {"R_390_TLS_IEENT", Const, 7}, + {"R_390_TLS_LDCALL", Const, 7}, + {"R_390_TLS_LDM32", Const, 7}, + {"R_390_TLS_LDM64", Const, 7}, + {"R_390_TLS_LDO32", Const, 7}, + {"R_390_TLS_LDO64", Const, 7}, + {"R_390_TLS_LE32", Const, 7}, + {"R_390_TLS_LE64", Const, 7}, + {"R_390_TLS_LOAD", Const, 7}, + {"R_390_TLS_TPOFF", Const, 7}, + {"R_AARCH64", Type, 4}, + {"R_AARCH64_ABS16", Const, 4}, + {"R_AARCH64_ABS32", Const, 4}, + {"R_AARCH64_ABS64", Const, 4}, + {"R_AARCH64_ADD_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_ADR_GOT_PAGE", Const, 4}, + {"R_AARCH64_ADR_PREL_LO21", Const, 4}, + {"R_AARCH64_ADR_PREL_PG_HI21", Const, 4}, + {"R_AARCH64_ADR_PREL_PG_HI21_NC", Const, 4}, + {"R_AARCH64_CALL26", Const, 4}, + {"R_AARCH64_CONDBR19", Const, 4}, + {"R_AARCH64_COPY", Const, 4}, + {"R_AARCH64_GLOB_DAT", Const, 4}, + {"R_AARCH64_GOT_LD_PREL19", Const, 4}, + {"R_AARCH64_IRELATIVE", Const, 4}, + {"R_AARCH64_JUMP26", Const, 4}, + {"R_AARCH64_JUMP_SLOT", Const, 4}, + {"R_AARCH64_LD64_GOTOFF_LO15", Const, 10}, + {"R_AARCH64_LD64_GOTPAGE_LO15", Const, 10}, + {"R_AARCH64_LD64_GOT_LO12_NC", Const, 4}, + {"R_AARCH64_LDST128_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_LDST16_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_LDST32_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_LDST64_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_LDST8_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_LD_PREL_LO19", Const, 4}, + {"R_AARCH64_MOVW_SABS_G0", Const, 4}, + {"R_AARCH64_MOVW_SABS_G1", Const, 4}, + {"R_AARCH64_MOVW_SABS_G2", Const, 4}, + {"R_AARCH64_MOVW_UABS_G0", Const, 4}, + {"R_AARCH64_MOVW_UABS_G0_NC", Const, 4}, + {"R_AARCH64_MOVW_UABS_G1", Const, 4}, + {"R_AARCH64_MOVW_UABS_G1_NC", Const, 4}, + {"R_AARCH64_MOVW_UABS_G2", Const, 4}, + {"R_AARCH64_MOVW_UABS_G2_NC", Const, 4}, + {"R_AARCH64_MOVW_UABS_G3", Const, 4}, + {"R_AARCH64_NONE", Const, 4}, + {"R_AARCH64_NULL", Const, 4}, + {"R_AARCH64_P32_ABS16", Const, 4}, + {"R_AARCH64_P32_ABS32", Const, 4}, + {"R_AARCH64_P32_ADD_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_ADR_GOT_PAGE", Const, 4}, + {"R_AARCH64_P32_ADR_PREL_LO21", Const, 4}, + {"R_AARCH64_P32_ADR_PREL_PG_HI21", Const, 4}, + {"R_AARCH64_P32_CALL26", Const, 4}, + {"R_AARCH64_P32_CONDBR19", Const, 4}, + {"R_AARCH64_P32_COPY", Const, 4}, + {"R_AARCH64_P32_GLOB_DAT", Const, 4}, + {"R_AARCH64_P32_GOT_LD_PREL19", Const, 4}, + {"R_AARCH64_P32_IRELATIVE", Const, 4}, + {"R_AARCH64_P32_JUMP26", Const, 4}, + {"R_AARCH64_P32_JUMP_SLOT", Const, 4}, + {"R_AARCH64_P32_LD32_GOT_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LDST128_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LDST16_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LDST32_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LDST64_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LDST8_ABS_LO12_NC", Const, 4}, + {"R_AARCH64_P32_LD_PREL_LO19", Const, 4}, + {"R_AARCH64_P32_MOVW_SABS_G0", Const, 4}, + {"R_AARCH64_P32_MOVW_UABS_G0", Const, 4}, + {"R_AARCH64_P32_MOVW_UABS_G0_NC", Const, 4}, + {"R_AARCH64_P32_MOVW_UABS_G1", Const, 4}, + {"R_AARCH64_P32_PREL16", Const, 4}, + {"R_AARCH64_P32_PREL32", Const, 4}, + {"R_AARCH64_P32_RELATIVE", Const, 4}, + {"R_AARCH64_P32_TLSDESC", Const, 4}, + {"R_AARCH64_P32_TLSDESC_ADD_LO12_NC", Const, 4}, + {"R_AARCH64_P32_TLSDESC_ADR_PAGE21", Const, 4}, + {"R_AARCH64_P32_TLSDESC_ADR_PREL21", Const, 4}, + {"R_AARCH64_P32_TLSDESC_CALL", Const, 4}, + {"R_AARCH64_P32_TLSDESC_LD32_LO12_NC", Const, 4}, + {"R_AARCH64_P32_TLSDESC_LD_PREL19", Const, 4}, + {"R_AARCH64_P32_TLSGD_ADD_LO12_NC", Const, 4}, + {"R_AARCH64_P32_TLSGD_ADR_PAGE21", Const, 4}, + {"R_AARCH64_P32_TLSIE_ADR_GOTTPREL_PAGE21", Const, 4}, + {"R_AARCH64_P32_TLSIE_LD32_GOTTPREL_LO12_NC", Const, 4}, + {"R_AARCH64_P32_TLSIE_LD_GOTTPREL_PREL19", Const, 4}, + {"R_AARCH64_P32_TLSLE_ADD_TPREL_HI12", Const, 4}, + {"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12", Const, 4}, + {"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12_NC", Const, 4}, + {"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0", Const, 4}, + {"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0_NC", Const, 4}, + {"R_AARCH64_P32_TLSLE_MOVW_TPREL_G1", Const, 4}, + {"R_AARCH64_P32_TLS_DTPMOD", Const, 4}, + {"R_AARCH64_P32_TLS_DTPREL", Const, 4}, + {"R_AARCH64_P32_TLS_TPREL", Const, 4}, + {"R_AARCH64_P32_TSTBR14", Const, 4}, + {"R_AARCH64_PREL16", Const, 4}, + {"R_AARCH64_PREL32", Const, 4}, + {"R_AARCH64_PREL64", Const, 4}, + {"R_AARCH64_RELATIVE", Const, 4}, + {"R_AARCH64_TLSDESC", Const, 4}, + {"R_AARCH64_TLSDESC_ADD", Const, 4}, + {"R_AARCH64_TLSDESC_ADD_LO12_NC", Const, 4}, + {"R_AARCH64_TLSDESC_ADR_PAGE21", Const, 4}, + {"R_AARCH64_TLSDESC_ADR_PREL21", Const, 4}, + {"R_AARCH64_TLSDESC_CALL", Const, 4}, + {"R_AARCH64_TLSDESC_LD64_LO12_NC", Const, 4}, + {"R_AARCH64_TLSDESC_LDR", Const, 4}, + {"R_AARCH64_TLSDESC_LD_PREL19", Const, 4}, + {"R_AARCH64_TLSDESC_OFF_G0_NC", Const, 4}, + {"R_AARCH64_TLSDESC_OFF_G1", Const, 4}, + {"R_AARCH64_TLSGD_ADD_LO12_NC", Const, 4}, + {"R_AARCH64_TLSGD_ADR_PAGE21", Const, 4}, + {"R_AARCH64_TLSGD_ADR_PREL21", Const, 10}, + {"R_AARCH64_TLSGD_MOVW_G0_NC", Const, 10}, + {"R_AARCH64_TLSGD_MOVW_G1", Const, 10}, + {"R_AARCH64_TLSIE_ADR_GOTTPREL_PAGE21", Const, 4}, + {"R_AARCH64_TLSIE_LD64_GOTTPREL_LO12_NC", Const, 4}, + {"R_AARCH64_TLSIE_LD_GOTTPREL_PREL19", Const, 4}, + {"R_AARCH64_TLSIE_MOVW_GOTTPREL_G0_NC", Const, 4}, + {"R_AARCH64_TLSIE_MOVW_GOTTPREL_G1", Const, 4}, + {"R_AARCH64_TLSLD_ADR_PAGE21", Const, 10}, + {"R_AARCH64_TLSLD_ADR_PREL21", Const, 10}, + {"R_AARCH64_TLSLD_LDST128_DTPREL_LO12", Const, 10}, + {"R_AARCH64_TLSLD_LDST128_DTPREL_LO12_NC", Const, 10}, + {"R_AARCH64_TLSLE_ADD_TPREL_HI12", Const, 4}, + {"R_AARCH64_TLSLE_ADD_TPREL_LO12", Const, 4}, + {"R_AARCH64_TLSLE_ADD_TPREL_LO12_NC", Const, 4}, + {"R_AARCH64_TLSLE_LDST128_TPREL_LO12", Const, 10}, + {"R_AARCH64_TLSLE_LDST128_TPREL_LO12_NC", Const, 10}, + {"R_AARCH64_TLSLE_MOVW_TPREL_G0", Const, 4}, + {"R_AARCH64_TLSLE_MOVW_TPREL_G0_NC", Const, 4}, + {"R_AARCH64_TLSLE_MOVW_TPREL_G1", Const, 4}, + {"R_AARCH64_TLSLE_MOVW_TPREL_G1_NC", Const, 4}, + {"R_AARCH64_TLSLE_MOVW_TPREL_G2", Const, 4}, + {"R_AARCH64_TLS_DTPMOD64", Const, 4}, + {"R_AARCH64_TLS_DTPREL64", Const, 4}, + {"R_AARCH64_TLS_TPREL64", Const, 4}, + {"R_AARCH64_TSTBR14", Const, 4}, + {"R_ALPHA", Type, 0}, + {"R_ALPHA_BRADDR", Const, 0}, + {"R_ALPHA_COPY", Const, 0}, + {"R_ALPHA_GLOB_DAT", Const, 0}, + {"R_ALPHA_GPDISP", Const, 0}, + {"R_ALPHA_GPREL32", Const, 0}, + {"R_ALPHA_GPRELHIGH", Const, 0}, + {"R_ALPHA_GPRELLOW", Const, 0}, + {"R_ALPHA_GPVALUE", Const, 0}, + {"R_ALPHA_HINT", Const, 0}, + {"R_ALPHA_IMMED_BR_HI32", Const, 0}, + {"R_ALPHA_IMMED_GP_16", Const, 0}, + {"R_ALPHA_IMMED_GP_HI32", Const, 0}, + {"R_ALPHA_IMMED_LO32", Const, 0}, + {"R_ALPHA_IMMED_SCN_HI32", Const, 0}, + {"R_ALPHA_JMP_SLOT", Const, 0}, + {"R_ALPHA_LITERAL", Const, 0}, + {"R_ALPHA_LITUSE", Const, 0}, + {"R_ALPHA_NONE", Const, 0}, + {"R_ALPHA_OP_PRSHIFT", Const, 0}, + {"R_ALPHA_OP_PSUB", Const, 0}, + {"R_ALPHA_OP_PUSH", Const, 0}, + {"R_ALPHA_OP_STORE", Const, 0}, + {"R_ALPHA_REFLONG", Const, 0}, + {"R_ALPHA_REFQUAD", Const, 0}, + {"R_ALPHA_RELATIVE", Const, 0}, + {"R_ALPHA_SREL16", Const, 0}, + {"R_ALPHA_SREL32", Const, 0}, + {"R_ALPHA_SREL64", Const, 0}, + {"R_ARM", Type, 0}, + {"R_ARM_ABS12", Const, 0}, + {"R_ARM_ABS16", Const, 0}, + {"R_ARM_ABS32", Const, 0}, + {"R_ARM_ABS32_NOI", Const, 10}, + {"R_ARM_ABS8", Const, 0}, + {"R_ARM_ALU_PCREL_15_8", Const, 10}, + {"R_ARM_ALU_PCREL_23_15", Const, 10}, + {"R_ARM_ALU_PCREL_7_0", Const, 10}, + {"R_ARM_ALU_PC_G0", Const, 10}, + {"R_ARM_ALU_PC_G0_NC", Const, 10}, + {"R_ARM_ALU_PC_G1", Const, 10}, + {"R_ARM_ALU_PC_G1_NC", Const, 10}, + {"R_ARM_ALU_PC_G2", Const, 10}, + {"R_ARM_ALU_SBREL_19_12_NC", Const, 10}, + {"R_ARM_ALU_SBREL_27_20_CK", Const, 10}, + {"R_ARM_ALU_SB_G0", Const, 10}, + {"R_ARM_ALU_SB_G0_NC", Const, 10}, + {"R_ARM_ALU_SB_G1", Const, 10}, + {"R_ARM_ALU_SB_G1_NC", Const, 10}, + {"R_ARM_ALU_SB_G2", Const, 10}, + {"R_ARM_AMP_VCALL9", Const, 0}, + {"R_ARM_BASE_ABS", Const, 10}, + {"R_ARM_CALL", Const, 10}, + {"R_ARM_COPY", Const, 0}, + {"R_ARM_GLOB_DAT", Const, 0}, + {"R_ARM_GNU_VTENTRY", Const, 0}, + {"R_ARM_GNU_VTINHERIT", Const, 0}, + {"R_ARM_GOT32", Const, 0}, + {"R_ARM_GOTOFF", Const, 0}, + {"R_ARM_GOTOFF12", Const, 10}, + {"R_ARM_GOTPC", Const, 0}, + {"R_ARM_GOTRELAX", Const, 10}, + {"R_ARM_GOT_ABS", Const, 10}, + {"R_ARM_GOT_BREL12", Const, 10}, + {"R_ARM_GOT_PREL", Const, 10}, + {"R_ARM_IRELATIVE", Const, 10}, + {"R_ARM_JUMP24", Const, 10}, + {"R_ARM_JUMP_SLOT", Const, 0}, + {"R_ARM_LDC_PC_G0", Const, 10}, + {"R_ARM_LDC_PC_G1", Const, 10}, + {"R_ARM_LDC_PC_G2", Const, 10}, + {"R_ARM_LDC_SB_G0", Const, 10}, + {"R_ARM_LDC_SB_G1", Const, 10}, + {"R_ARM_LDC_SB_G2", Const, 10}, + {"R_ARM_LDRS_PC_G0", Const, 10}, + {"R_ARM_LDRS_PC_G1", Const, 10}, + {"R_ARM_LDRS_PC_G2", Const, 10}, + {"R_ARM_LDRS_SB_G0", Const, 10}, + {"R_ARM_LDRS_SB_G1", Const, 10}, + {"R_ARM_LDRS_SB_G2", Const, 10}, + {"R_ARM_LDR_PC_G1", Const, 10}, + {"R_ARM_LDR_PC_G2", Const, 10}, + {"R_ARM_LDR_SBREL_11_10_NC", Const, 10}, + {"R_ARM_LDR_SB_G0", Const, 10}, + {"R_ARM_LDR_SB_G1", Const, 10}, + {"R_ARM_LDR_SB_G2", Const, 10}, + {"R_ARM_ME_TOO", Const, 10}, + {"R_ARM_MOVT_ABS", Const, 10}, + {"R_ARM_MOVT_BREL", Const, 10}, + {"R_ARM_MOVT_PREL", Const, 10}, + {"R_ARM_MOVW_ABS_NC", Const, 10}, + {"R_ARM_MOVW_BREL", Const, 10}, + {"R_ARM_MOVW_BREL_NC", Const, 10}, + {"R_ARM_MOVW_PREL_NC", Const, 10}, + {"R_ARM_NONE", Const, 0}, + {"R_ARM_PC13", Const, 0}, + {"R_ARM_PC24", Const, 0}, + {"R_ARM_PLT32", Const, 0}, + {"R_ARM_PLT32_ABS", Const, 10}, + {"R_ARM_PREL31", Const, 10}, + {"R_ARM_PRIVATE_0", Const, 10}, + {"R_ARM_PRIVATE_1", Const, 10}, + {"R_ARM_PRIVATE_10", Const, 10}, + {"R_ARM_PRIVATE_11", Const, 10}, + {"R_ARM_PRIVATE_12", Const, 10}, + {"R_ARM_PRIVATE_13", Const, 10}, + {"R_ARM_PRIVATE_14", Const, 10}, + {"R_ARM_PRIVATE_15", Const, 10}, + {"R_ARM_PRIVATE_2", Const, 10}, + {"R_ARM_PRIVATE_3", Const, 10}, + {"R_ARM_PRIVATE_4", Const, 10}, + {"R_ARM_PRIVATE_5", Const, 10}, + {"R_ARM_PRIVATE_6", Const, 10}, + {"R_ARM_PRIVATE_7", Const, 10}, + {"R_ARM_PRIVATE_8", Const, 10}, + {"R_ARM_PRIVATE_9", Const, 10}, + {"R_ARM_RABS32", Const, 0}, + {"R_ARM_RBASE", Const, 0}, + {"R_ARM_REL32", Const, 0}, + {"R_ARM_REL32_NOI", Const, 10}, + {"R_ARM_RELATIVE", Const, 0}, + {"R_ARM_RPC24", Const, 0}, + {"R_ARM_RREL32", Const, 0}, + {"R_ARM_RSBREL32", Const, 0}, + {"R_ARM_RXPC25", Const, 10}, + {"R_ARM_SBREL31", Const, 10}, + {"R_ARM_SBREL32", Const, 0}, + {"R_ARM_SWI24", Const, 0}, + {"R_ARM_TARGET1", Const, 10}, + {"R_ARM_TARGET2", Const, 10}, + {"R_ARM_THM_ABS5", Const, 0}, + {"R_ARM_THM_ALU_ABS_G0_NC", Const, 10}, + {"R_ARM_THM_ALU_ABS_G1_NC", Const, 10}, + {"R_ARM_THM_ALU_ABS_G2_NC", Const, 10}, + {"R_ARM_THM_ALU_ABS_G3", Const, 10}, + {"R_ARM_THM_ALU_PREL_11_0", Const, 10}, + {"R_ARM_THM_GOT_BREL12", Const, 10}, + {"R_ARM_THM_JUMP11", Const, 10}, + {"R_ARM_THM_JUMP19", Const, 10}, + {"R_ARM_THM_JUMP24", Const, 10}, + {"R_ARM_THM_JUMP6", Const, 10}, + {"R_ARM_THM_JUMP8", Const, 10}, + {"R_ARM_THM_MOVT_ABS", Const, 10}, + {"R_ARM_THM_MOVT_BREL", Const, 10}, + {"R_ARM_THM_MOVT_PREL", Const, 10}, + {"R_ARM_THM_MOVW_ABS_NC", Const, 10}, + {"R_ARM_THM_MOVW_BREL", Const, 10}, + {"R_ARM_THM_MOVW_BREL_NC", Const, 10}, + {"R_ARM_THM_MOVW_PREL_NC", Const, 10}, + {"R_ARM_THM_PC12", Const, 10}, + {"R_ARM_THM_PC22", Const, 0}, + {"R_ARM_THM_PC8", Const, 0}, + {"R_ARM_THM_RPC22", Const, 0}, + {"R_ARM_THM_SWI8", Const, 0}, + {"R_ARM_THM_TLS_CALL", Const, 10}, + {"R_ARM_THM_TLS_DESCSEQ16", Const, 10}, + {"R_ARM_THM_TLS_DESCSEQ32", Const, 10}, + {"R_ARM_THM_XPC22", Const, 0}, + {"R_ARM_TLS_CALL", Const, 10}, + {"R_ARM_TLS_DESCSEQ", Const, 10}, + {"R_ARM_TLS_DTPMOD32", Const, 10}, + {"R_ARM_TLS_DTPOFF32", Const, 10}, + {"R_ARM_TLS_GD32", Const, 10}, + {"R_ARM_TLS_GOTDESC", Const, 10}, + {"R_ARM_TLS_IE12GP", Const, 10}, + {"R_ARM_TLS_IE32", Const, 10}, + {"R_ARM_TLS_LDM32", Const, 10}, + {"R_ARM_TLS_LDO12", Const, 10}, + {"R_ARM_TLS_LDO32", Const, 10}, + {"R_ARM_TLS_LE12", Const, 10}, + {"R_ARM_TLS_LE32", Const, 10}, + {"R_ARM_TLS_TPOFF32", Const, 10}, + {"R_ARM_V4BX", Const, 10}, + {"R_ARM_XPC25", Const, 0}, + {"R_INFO", Func, 0}, + {"R_INFO32", Func, 0}, + {"R_LARCH", Type, 19}, + {"R_LARCH_32", Const, 19}, + {"R_LARCH_32_PCREL", Const, 20}, + {"R_LARCH_64", Const, 19}, + {"R_LARCH_64_PCREL", Const, 22}, + {"R_LARCH_ABS64_HI12", Const, 20}, + {"R_LARCH_ABS64_LO20", Const, 20}, + {"R_LARCH_ABS_HI20", Const, 20}, + {"R_LARCH_ABS_LO12", Const, 20}, + {"R_LARCH_ADD16", Const, 19}, + {"R_LARCH_ADD24", Const, 19}, + {"R_LARCH_ADD32", Const, 19}, + {"R_LARCH_ADD6", Const, 22}, + {"R_LARCH_ADD64", Const, 19}, + {"R_LARCH_ADD8", Const, 19}, + {"R_LARCH_ADD_ULEB128", Const, 22}, + {"R_LARCH_ALIGN", Const, 22}, + {"R_LARCH_B16", Const, 20}, + {"R_LARCH_B21", Const, 20}, + {"R_LARCH_B26", Const, 20}, + {"R_LARCH_CFA", Const, 22}, + {"R_LARCH_COPY", Const, 19}, + {"R_LARCH_DELETE", Const, 22}, + {"R_LARCH_GNU_VTENTRY", Const, 20}, + {"R_LARCH_GNU_VTINHERIT", Const, 20}, + {"R_LARCH_GOT64_HI12", Const, 20}, + {"R_LARCH_GOT64_LO20", Const, 20}, + {"R_LARCH_GOT64_PC_HI12", Const, 20}, + {"R_LARCH_GOT64_PC_LO20", Const, 20}, + {"R_LARCH_GOT_HI20", Const, 20}, + {"R_LARCH_GOT_LO12", Const, 20}, + {"R_LARCH_GOT_PC_HI20", Const, 20}, + {"R_LARCH_GOT_PC_LO12", Const, 20}, + {"R_LARCH_IRELATIVE", Const, 19}, + {"R_LARCH_JUMP_SLOT", Const, 19}, + {"R_LARCH_MARK_LA", Const, 19}, + {"R_LARCH_MARK_PCREL", Const, 19}, + {"R_LARCH_NONE", Const, 19}, + {"R_LARCH_PCALA64_HI12", Const, 20}, + {"R_LARCH_PCALA64_LO20", Const, 20}, + {"R_LARCH_PCALA_HI20", Const, 20}, + {"R_LARCH_PCALA_LO12", Const, 20}, + {"R_LARCH_PCREL20_S2", Const, 22}, + {"R_LARCH_RELATIVE", Const, 19}, + {"R_LARCH_RELAX", Const, 20}, + {"R_LARCH_SOP_ADD", Const, 19}, + {"R_LARCH_SOP_AND", Const, 19}, + {"R_LARCH_SOP_ASSERT", Const, 19}, + {"R_LARCH_SOP_IF_ELSE", Const, 19}, + {"R_LARCH_SOP_NOT", Const, 19}, + {"R_LARCH_SOP_POP_32_S_0_10_10_16_S2", Const, 19}, + {"R_LARCH_SOP_POP_32_S_0_5_10_16_S2", Const, 19}, + {"R_LARCH_SOP_POP_32_S_10_12", Const, 19}, + {"R_LARCH_SOP_POP_32_S_10_16", Const, 19}, + {"R_LARCH_SOP_POP_32_S_10_16_S2", Const, 19}, + {"R_LARCH_SOP_POP_32_S_10_5", Const, 19}, + {"R_LARCH_SOP_POP_32_S_5_20", Const, 19}, + {"R_LARCH_SOP_POP_32_U", Const, 19}, + {"R_LARCH_SOP_POP_32_U_10_12", Const, 19}, + {"R_LARCH_SOP_PUSH_ABSOLUTE", Const, 19}, + {"R_LARCH_SOP_PUSH_DUP", Const, 19}, + {"R_LARCH_SOP_PUSH_GPREL", Const, 19}, + {"R_LARCH_SOP_PUSH_PCREL", Const, 19}, + {"R_LARCH_SOP_PUSH_PLT_PCREL", Const, 19}, + {"R_LARCH_SOP_PUSH_TLS_GD", Const, 19}, + {"R_LARCH_SOP_PUSH_TLS_GOT", Const, 19}, + {"R_LARCH_SOP_PUSH_TLS_TPREL", Const, 19}, + {"R_LARCH_SOP_SL", Const, 19}, + {"R_LARCH_SOP_SR", Const, 19}, + {"R_LARCH_SOP_SUB", Const, 19}, + {"R_LARCH_SUB16", Const, 19}, + {"R_LARCH_SUB24", Const, 19}, + {"R_LARCH_SUB32", Const, 19}, + {"R_LARCH_SUB6", Const, 22}, + {"R_LARCH_SUB64", Const, 19}, + {"R_LARCH_SUB8", Const, 19}, + {"R_LARCH_SUB_ULEB128", Const, 22}, + {"R_LARCH_TLS_DTPMOD32", Const, 19}, + {"R_LARCH_TLS_DTPMOD64", Const, 19}, + {"R_LARCH_TLS_DTPREL32", Const, 19}, + {"R_LARCH_TLS_DTPREL64", Const, 19}, + {"R_LARCH_TLS_GD_HI20", Const, 20}, + {"R_LARCH_TLS_GD_PC_HI20", Const, 20}, + {"R_LARCH_TLS_IE64_HI12", Const, 20}, + {"R_LARCH_TLS_IE64_LO20", Const, 20}, + {"R_LARCH_TLS_IE64_PC_HI12", Const, 20}, + {"R_LARCH_TLS_IE64_PC_LO20", Const, 20}, + {"R_LARCH_TLS_IE_HI20", Const, 20}, + {"R_LARCH_TLS_IE_LO12", Const, 20}, + {"R_LARCH_TLS_IE_PC_HI20", Const, 20}, + {"R_LARCH_TLS_IE_PC_LO12", Const, 20}, + {"R_LARCH_TLS_LD_HI20", Const, 20}, + {"R_LARCH_TLS_LD_PC_HI20", Const, 20}, + {"R_LARCH_TLS_LE64_HI12", Const, 20}, + {"R_LARCH_TLS_LE64_LO20", Const, 20}, + {"R_LARCH_TLS_LE_HI20", Const, 20}, + {"R_LARCH_TLS_LE_LO12", Const, 20}, + {"R_LARCH_TLS_TPREL32", Const, 19}, + {"R_LARCH_TLS_TPREL64", Const, 19}, + {"R_MIPS", Type, 6}, + {"R_MIPS_16", Const, 6}, + {"R_MIPS_26", Const, 6}, + {"R_MIPS_32", Const, 6}, + {"R_MIPS_64", Const, 6}, + {"R_MIPS_ADD_IMMEDIATE", Const, 6}, + {"R_MIPS_CALL16", Const, 6}, + {"R_MIPS_CALL_HI16", Const, 6}, + {"R_MIPS_CALL_LO16", Const, 6}, + {"R_MIPS_DELETE", Const, 6}, + {"R_MIPS_GOT16", Const, 6}, + {"R_MIPS_GOT_DISP", Const, 6}, + {"R_MIPS_GOT_HI16", Const, 6}, + {"R_MIPS_GOT_LO16", Const, 6}, + {"R_MIPS_GOT_OFST", Const, 6}, + {"R_MIPS_GOT_PAGE", Const, 6}, + {"R_MIPS_GPREL16", Const, 6}, + {"R_MIPS_GPREL32", Const, 6}, + {"R_MIPS_HI16", Const, 6}, + {"R_MIPS_HIGHER", Const, 6}, + {"R_MIPS_HIGHEST", Const, 6}, + {"R_MIPS_INSERT_A", Const, 6}, + {"R_MIPS_INSERT_B", Const, 6}, + {"R_MIPS_JALR", Const, 6}, + {"R_MIPS_LITERAL", Const, 6}, + {"R_MIPS_LO16", Const, 6}, + {"R_MIPS_NONE", Const, 6}, + {"R_MIPS_PC16", Const, 6}, + {"R_MIPS_PC32", Const, 22}, + {"R_MIPS_PJUMP", Const, 6}, + {"R_MIPS_REL16", Const, 6}, + {"R_MIPS_REL32", Const, 6}, + {"R_MIPS_RELGOT", Const, 6}, + {"R_MIPS_SCN_DISP", Const, 6}, + {"R_MIPS_SHIFT5", Const, 6}, + {"R_MIPS_SHIFT6", Const, 6}, + {"R_MIPS_SUB", Const, 6}, + {"R_MIPS_TLS_DTPMOD32", Const, 6}, + {"R_MIPS_TLS_DTPMOD64", Const, 6}, + {"R_MIPS_TLS_DTPREL32", Const, 6}, + {"R_MIPS_TLS_DTPREL64", Const, 6}, + {"R_MIPS_TLS_DTPREL_HI16", Const, 6}, + {"R_MIPS_TLS_DTPREL_LO16", Const, 6}, + {"R_MIPS_TLS_GD", Const, 6}, + {"R_MIPS_TLS_GOTTPREL", Const, 6}, + {"R_MIPS_TLS_LDM", Const, 6}, + {"R_MIPS_TLS_TPREL32", Const, 6}, + {"R_MIPS_TLS_TPREL64", Const, 6}, + {"R_MIPS_TLS_TPREL_HI16", Const, 6}, + {"R_MIPS_TLS_TPREL_LO16", Const, 6}, + {"R_PPC", Type, 0}, + {"R_PPC64", Type, 5}, + {"R_PPC64_ADDR14", Const, 5}, + {"R_PPC64_ADDR14_BRNTAKEN", Const, 5}, + {"R_PPC64_ADDR14_BRTAKEN", Const, 5}, + {"R_PPC64_ADDR16", Const, 5}, + {"R_PPC64_ADDR16_DS", Const, 5}, + {"R_PPC64_ADDR16_HA", Const, 5}, + {"R_PPC64_ADDR16_HI", Const, 5}, + {"R_PPC64_ADDR16_HIGH", Const, 10}, + {"R_PPC64_ADDR16_HIGHA", Const, 10}, + {"R_PPC64_ADDR16_HIGHER", Const, 5}, + {"R_PPC64_ADDR16_HIGHER34", Const, 20}, + {"R_PPC64_ADDR16_HIGHERA", Const, 5}, + {"R_PPC64_ADDR16_HIGHERA34", Const, 20}, + {"R_PPC64_ADDR16_HIGHEST", Const, 5}, + {"R_PPC64_ADDR16_HIGHEST34", Const, 20}, + {"R_PPC64_ADDR16_HIGHESTA", Const, 5}, + {"R_PPC64_ADDR16_HIGHESTA34", Const, 20}, + {"R_PPC64_ADDR16_LO", Const, 5}, + {"R_PPC64_ADDR16_LO_DS", Const, 5}, + {"R_PPC64_ADDR24", Const, 5}, + {"R_PPC64_ADDR32", Const, 5}, + {"R_PPC64_ADDR64", Const, 5}, + {"R_PPC64_ADDR64_LOCAL", Const, 10}, + {"R_PPC64_COPY", Const, 20}, + {"R_PPC64_D28", Const, 20}, + {"R_PPC64_D34", Const, 20}, + {"R_PPC64_D34_HA30", Const, 20}, + {"R_PPC64_D34_HI30", Const, 20}, + {"R_PPC64_D34_LO", Const, 20}, + {"R_PPC64_DTPMOD64", Const, 5}, + {"R_PPC64_DTPREL16", Const, 5}, + {"R_PPC64_DTPREL16_DS", Const, 5}, + {"R_PPC64_DTPREL16_HA", Const, 5}, + {"R_PPC64_DTPREL16_HI", Const, 5}, + {"R_PPC64_DTPREL16_HIGH", Const, 10}, + {"R_PPC64_DTPREL16_HIGHA", Const, 10}, + {"R_PPC64_DTPREL16_HIGHER", Const, 5}, + {"R_PPC64_DTPREL16_HIGHERA", Const, 5}, + {"R_PPC64_DTPREL16_HIGHEST", Const, 5}, + {"R_PPC64_DTPREL16_HIGHESTA", Const, 5}, + {"R_PPC64_DTPREL16_LO", Const, 5}, + {"R_PPC64_DTPREL16_LO_DS", Const, 5}, + {"R_PPC64_DTPREL34", Const, 20}, + {"R_PPC64_DTPREL64", Const, 5}, + {"R_PPC64_ENTRY", Const, 10}, + {"R_PPC64_GLOB_DAT", Const, 20}, + {"R_PPC64_GNU_VTENTRY", Const, 20}, + {"R_PPC64_GNU_VTINHERIT", Const, 20}, + {"R_PPC64_GOT16", Const, 5}, + {"R_PPC64_GOT16_DS", Const, 5}, + {"R_PPC64_GOT16_HA", Const, 5}, + {"R_PPC64_GOT16_HI", Const, 5}, + {"R_PPC64_GOT16_LO", Const, 5}, + {"R_PPC64_GOT16_LO_DS", Const, 5}, + {"R_PPC64_GOT_DTPREL16_DS", Const, 5}, + {"R_PPC64_GOT_DTPREL16_HA", Const, 5}, + {"R_PPC64_GOT_DTPREL16_HI", Const, 5}, + {"R_PPC64_GOT_DTPREL16_LO_DS", Const, 5}, + {"R_PPC64_GOT_DTPREL_PCREL34", Const, 20}, + {"R_PPC64_GOT_PCREL34", Const, 20}, + {"R_PPC64_GOT_TLSGD16", Const, 5}, + {"R_PPC64_GOT_TLSGD16_HA", Const, 5}, + {"R_PPC64_GOT_TLSGD16_HI", Const, 5}, + {"R_PPC64_GOT_TLSGD16_LO", Const, 5}, + {"R_PPC64_GOT_TLSGD_PCREL34", Const, 20}, + {"R_PPC64_GOT_TLSLD16", Const, 5}, + {"R_PPC64_GOT_TLSLD16_HA", Const, 5}, + {"R_PPC64_GOT_TLSLD16_HI", Const, 5}, + {"R_PPC64_GOT_TLSLD16_LO", Const, 5}, + {"R_PPC64_GOT_TLSLD_PCREL34", Const, 20}, + {"R_PPC64_GOT_TPREL16_DS", Const, 5}, + {"R_PPC64_GOT_TPREL16_HA", Const, 5}, + {"R_PPC64_GOT_TPREL16_HI", Const, 5}, + {"R_PPC64_GOT_TPREL16_LO_DS", Const, 5}, + {"R_PPC64_GOT_TPREL_PCREL34", Const, 20}, + {"R_PPC64_IRELATIVE", Const, 10}, + {"R_PPC64_JMP_IREL", Const, 10}, + {"R_PPC64_JMP_SLOT", Const, 5}, + {"R_PPC64_NONE", Const, 5}, + {"R_PPC64_PCREL28", Const, 20}, + {"R_PPC64_PCREL34", Const, 20}, + {"R_PPC64_PCREL_OPT", Const, 20}, + {"R_PPC64_PLT16_HA", Const, 20}, + {"R_PPC64_PLT16_HI", Const, 20}, + {"R_PPC64_PLT16_LO", Const, 20}, + {"R_PPC64_PLT16_LO_DS", Const, 10}, + {"R_PPC64_PLT32", Const, 20}, + {"R_PPC64_PLT64", Const, 20}, + {"R_PPC64_PLTCALL", Const, 20}, + {"R_PPC64_PLTCALL_NOTOC", Const, 20}, + {"R_PPC64_PLTGOT16", Const, 10}, + {"R_PPC64_PLTGOT16_DS", Const, 10}, + {"R_PPC64_PLTGOT16_HA", Const, 10}, + {"R_PPC64_PLTGOT16_HI", Const, 10}, + {"R_PPC64_PLTGOT16_LO", Const, 10}, + {"R_PPC64_PLTGOT_LO_DS", Const, 10}, + {"R_PPC64_PLTREL32", Const, 20}, + {"R_PPC64_PLTREL64", Const, 20}, + {"R_PPC64_PLTSEQ", Const, 20}, + {"R_PPC64_PLTSEQ_NOTOC", Const, 20}, + {"R_PPC64_PLT_PCREL34", Const, 20}, + {"R_PPC64_PLT_PCREL34_NOTOC", Const, 20}, + {"R_PPC64_REL14", Const, 5}, + {"R_PPC64_REL14_BRNTAKEN", Const, 5}, + {"R_PPC64_REL14_BRTAKEN", Const, 5}, + {"R_PPC64_REL16", Const, 5}, + {"R_PPC64_REL16DX_HA", Const, 10}, + {"R_PPC64_REL16_HA", Const, 5}, + {"R_PPC64_REL16_HI", Const, 5}, + {"R_PPC64_REL16_HIGH", Const, 20}, + {"R_PPC64_REL16_HIGHA", Const, 20}, + {"R_PPC64_REL16_HIGHER", Const, 20}, + {"R_PPC64_REL16_HIGHER34", Const, 20}, + {"R_PPC64_REL16_HIGHERA", Const, 20}, + {"R_PPC64_REL16_HIGHERA34", Const, 20}, + {"R_PPC64_REL16_HIGHEST", Const, 20}, + {"R_PPC64_REL16_HIGHEST34", Const, 20}, + {"R_PPC64_REL16_HIGHESTA", Const, 20}, + {"R_PPC64_REL16_HIGHESTA34", Const, 20}, + {"R_PPC64_REL16_LO", Const, 5}, + {"R_PPC64_REL24", Const, 5}, + {"R_PPC64_REL24_NOTOC", Const, 10}, + {"R_PPC64_REL24_P9NOTOC", Const, 21}, + {"R_PPC64_REL30", Const, 20}, + {"R_PPC64_REL32", Const, 5}, + {"R_PPC64_REL64", Const, 5}, + {"R_PPC64_RELATIVE", Const, 18}, + {"R_PPC64_SECTOFF", Const, 20}, + {"R_PPC64_SECTOFF_DS", Const, 10}, + {"R_PPC64_SECTOFF_HA", Const, 20}, + {"R_PPC64_SECTOFF_HI", Const, 20}, + {"R_PPC64_SECTOFF_LO", Const, 20}, + {"R_PPC64_SECTOFF_LO_DS", Const, 10}, + {"R_PPC64_TLS", Const, 5}, + {"R_PPC64_TLSGD", Const, 5}, + {"R_PPC64_TLSLD", Const, 5}, + {"R_PPC64_TOC", Const, 5}, + {"R_PPC64_TOC16", Const, 5}, + {"R_PPC64_TOC16_DS", Const, 5}, + {"R_PPC64_TOC16_HA", Const, 5}, + {"R_PPC64_TOC16_HI", Const, 5}, + {"R_PPC64_TOC16_LO", Const, 5}, + {"R_PPC64_TOC16_LO_DS", Const, 5}, + {"R_PPC64_TOCSAVE", Const, 10}, + {"R_PPC64_TPREL16", Const, 5}, + {"R_PPC64_TPREL16_DS", Const, 5}, + {"R_PPC64_TPREL16_HA", Const, 5}, + {"R_PPC64_TPREL16_HI", Const, 5}, + {"R_PPC64_TPREL16_HIGH", Const, 10}, + {"R_PPC64_TPREL16_HIGHA", Const, 10}, + {"R_PPC64_TPREL16_HIGHER", Const, 5}, + {"R_PPC64_TPREL16_HIGHERA", Const, 5}, + {"R_PPC64_TPREL16_HIGHEST", Const, 5}, + {"R_PPC64_TPREL16_HIGHESTA", Const, 5}, + {"R_PPC64_TPREL16_LO", Const, 5}, + {"R_PPC64_TPREL16_LO_DS", Const, 5}, + {"R_PPC64_TPREL34", Const, 20}, + {"R_PPC64_TPREL64", Const, 5}, + {"R_PPC64_UADDR16", Const, 20}, + {"R_PPC64_UADDR32", Const, 20}, + {"R_PPC64_UADDR64", Const, 20}, + {"R_PPC_ADDR14", Const, 0}, + {"R_PPC_ADDR14_BRNTAKEN", Const, 0}, + {"R_PPC_ADDR14_BRTAKEN", Const, 0}, + {"R_PPC_ADDR16", Const, 0}, + {"R_PPC_ADDR16_HA", Const, 0}, + {"R_PPC_ADDR16_HI", Const, 0}, + {"R_PPC_ADDR16_LO", Const, 0}, + {"R_PPC_ADDR24", Const, 0}, + {"R_PPC_ADDR32", Const, 0}, + {"R_PPC_COPY", Const, 0}, + {"R_PPC_DTPMOD32", Const, 0}, + {"R_PPC_DTPREL16", Const, 0}, + {"R_PPC_DTPREL16_HA", Const, 0}, + {"R_PPC_DTPREL16_HI", Const, 0}, + {"R_PPC_DTPREL16_LO", Const, 0}, + {"R_PPC_DTPREL32", Const, 0}, + {"R_PPC_EMB_BIT_FLD", Const, 0}, + {"R_PPC_EMB_MRKREF", Const, 0}, + {"R_PPC_EMB_NADDR16", Const, 0}, + {"R_PPC_EMB_NADDR16_HA", Const, 0}, + {"R_PPC_EMB_NADDR16_HI", Const, 0}, + {"R_PPC_EMB_NADDR16_LO", Const, 0}, + {"R_PPC_EMB_NADDR32", Const, 0}, + {"R_PPC_EMB_RELSDA", Const, 0}, + {"R_PPC_EMB_RELSEC16", Const, 0}, + {"R_PPC_EMB_RELST_HA", Const, 0}, + {"R_PPC_EMB_RELST_HI", Const, 0}, + {"R_PPC_EMB_RELST_LO", Const, 0}, + {"R_PPC_EMB_SDA21", Const, 0}, + {"R_PPC_EMB_SDA2I16", Const, 0}, + {"R_PPC_EMB_SDA2REL", Const, 0}, + {"R_PPC_EMB_SDAI16", Const, 0}, + {"R_PPC_GLOB_DAT", Const, 0}, + {"R_PPC_GOT16", Const, 0}, + {"R_PPC_GOT16_HA", Const, 0}, + {"R_PPC_GOT16_HI", Const, 0}, + {"R_PPC_GOT16_LO", Const, 0}, + {"R_PPC_GOT_TLSGD16", Const, 0}, + {"R_PPC_GOT_TLSGD16_HA", Const, 0}, + {"R_PPC_GOT_TLSGD16_HI", Const, 0}, + {"R_PPC_GOT_TLSGD16_LO", Const, 0}, + {"R_PPC_GOT_TLSLD16", Const, 0}, + {"R_PPC_GOT_TLSLD16_HA", Const, 0}, + {"R_PPC_GOT_TLSLD16_HI", Const, 0}, + {"R_PPC_GOT_TLSLD16_LO", Const, 0}, + {"R_PPC_GOT_TPREL16", Const, 0}, + {"R_PPC_GOT_TPREL16_HA", Const, 0}, + {"R_PPC_GOT_TPREL16_HI", Const, 0}, + {"R_PPC_GOT_TPREL16_LO", Const, 0}, + {"R_PPC_JMP_SLOT", Const, 0}, + {"R_PPC_LOCAL24PC", Const, 0}, + {"R_PPC_NONE", Const, 0}, + {"R_PPC_PLT16_HA", Const, 0}, + {"R_PPC_PLT16_HI", Const, 0}, + {"R_PPC_PLT16_LO", Const, 0}, + {"R_PPC_PLT32", Const, 0}, + {"R_PPC_PLTREL24", Const, 0}, + {"R_PPC_PLTREL32", Const, 0}, + {"R_PPC_REL14", Const, 0}, + {"R_PPC_REL14_BRNTAKEN", Const, 0}, + {"R_PPC_REL14_BRTAKEN", Const, 0}, + {"R_PPC_REL24", Const, 0}, + {"R_PPC_REL32", Const, 0}, + {"R_PPC_RELATIVE", Const, 0}, + {"R_PPC_SDAREL16", Const, 0}, + {"R_PPC_SECTOFF", Const, 0}, + {"R_PPC_SECTOFF_HA", Const, 0}, + {"R_PPC_SECTOFF_HI", Const, 0}, + {"R_PPC_SECTOFF_LO", Const, 0}, + {"R_PPC_TLS", Const, 0}, + {"R_PPC_TPREL16", Const, 0}, + {"R_PPC_TPREL16_HA", Const, 0}, + {"R_PPC_TPREL16_HI", Const, 0}, + {"R_PPC_TPREL16_LO", Const, 0}, + {"R_PPC_TPREL32", Const, 0}, + {"R_PPC_UADDR16", Const, 0}, + {"R_PPC_UADDR32", Const, 0}, + {"R_RISCV", Type, 11}, + {"R_RISCV_32", Const, 11}, + {"R_RISCV_32_PCREL", Const, 12}, + {"R_RISCV_64", Const, 11}, + {"R_RISCV_ADD16", Const, 11}, + {"R_RISCV_ADD32", Const, 11}, + {"R_RISCV_ADD64", Const, 11}, + {"R_RISCV_ADD8", Const, 11}, + {"R_RISCV_ALIGN", Const, 11}, + {"R_RISCV_BRANCH", Const, 11}, + {"R_RISCV_CALL", Const, 11}, + {"R_RISCV_CALL_PLT", Const, 11}, + {"R_RISCV_COPY", Const, 11}, + {"R_RISCV_GNU_VTENTRY", Const, 11}, + {"R_RISCV_GNU_VTINHERIT", Const, 11}, + {"R_RISCV_GOT_HI20", Const, 11}, + {"R_RISCV_GPREL_I", Const, 11}, + {"R_RISCV_GPREL_S", Const, 11}, + {"R_RISCV_HI20", Const, 11}, + {"R_RISCV_JAL", Const, 11}, + {"R_RISCV_JUMP_SLOT", Const, 11}, + {"R_RISCV_LO12_I", Const, 11}, + {"R_RISCV_LO12_S", Const, 11}, + {"R_RISCV_NONE", Const, 11}, + {"R_RISCV_PCREL_HI20", Const, 11}, + {"R_RISCV_PCREL_LO12_I", Const, 11}, + {"R_RISCV_PCREL_LO12_S", Const, 11}, + {"R_RISCV_RELATIVE", Const, 11}, + {"R_RISCV_RELAX", Const, 11}, + {"R_RISCV_RVC_BRANCH", Const, 11}, + {"R_RISCV_RVC_JUMP", Const, 11}, + {"R_RISCV_RVC_LUI", Const, 11}, + {"R_RISCV_SET16", Const, 11}, + {"R_RISCV_SET32", Const, 11}, + {"R_RISCV_SET6", Const, 11}, + {"R_RISCV_SET8", Const, 11}, + {"R_RISCV_SUB16", Const, 11}, + {"R_RISCV_SUB32", Const, 11}, + {"R_RISCV_SUB6", Const, 11}, + {"R_RISCV_SUB64", Const, 11}, + {"R_RISCV_SUB8", Const, 11}, + {"R_RISCV_TLS_DTPMOD32", Const, 11}, + {"R_RISCV_TLS_DTPMOD64", Const, 11}, + {"R_RISCV_TLS_DTPREL32", Const, 11}, + {"R_RISCV_TLS_DTPREL64", Const, 11}, + {"R_RISCV_TLS_GD_HI20", Const, 11}, + {"R_RISCV_TLS_GOT_HI20", Const, 11}, + {"R_RISCV_TLS_TPREL32", Const, 11}, + {"R_RISCV_TLS_TPREL64", Const, 11}, + {"R_RISCV_TPREL_ADD", Const, 11}, + {"R_RISCV_TPREL_HI20", Const, 11}, + {"R_RISCV_TPREL_I", Const, 11}, + {"R_RISCV_TPREL_LO12_I", Const, 11}, + {"R_RISCV_TPREL_LO12_S", Const, 11}, + {"R_RISCV_TPREL_S", Const, 11}, + {"R_SPARC", Type, 0}, + {"R_SPARC_10", Const, 0}, + {"R_SPARC_11", Const, 0}, + {"R_SPARC_13", Const, 0}, + {"R_SPARC_16", Const, 0}, + {"R_SPARC_22", Const, 0}, + {"R_SPARC_32", Const, 0}, + {"R_SPARC_5", Const, 0}, + {"R_SPARC_6", Const, 0}, + {"R_SPARC_64", Const, 0}, + {"R_SPARC_7", Const, 0}, + {"R_SPARC_8", Const, 0}, + {"R_SPARC_COPY", Const, 0}, + {"R_SPARC_DISP16", Const, 0}, + {"R_SPARC_DISP32", Const, 0}, + {"R_SPARC_DISP64", Const, 0}, + {"R_SPARC_DISP8", Const, 0}, + {"R_SPARC_GLOB_DAT", Const, 0}, + {"R_SPARC_GLOB_JMP", Const, 0}, + {"R_SPARC_GOT10", Const, 0}, + {"R_SPARC_GOT13", Const, 0}, + {"R_SPARC_GOT22", Const, 0}, + {"R_SPARC_H44", Const, 0}, + {"R_SPARC_HH22", Const, 0}, + {"R_SPARC_HI22", Const, 0}, + {"R_SPARC_HIPLT22", Const, 0}, + {"R_SPARC_HIX22", Const, 0}, + {"R_SPARC_HM10", Const, 0}, + {"R_SPARC_JMP_SLOT", Const, 0}, + {"R_SPARC_L44", Const, 0}, + {"R_SPARC_LM22", Const, 0}, + {"R_SPARC_LO10", Const, 0}, + {"R_SPARC_LOPLT10", Const, 0}, + {"R_SPARC_LOX10", Const, 0}, + {"R_SPARC_M44", Const, 0}, + {"R_SPARC_NONE", Const, 0}, + {"R_SPARC_OLO10", Const, 0}, + {"R_SPARC_PC10", Const, 0}, + {"R_SPARC_PC22", Const, 0}, + {"R_SPARC_PCPLT10", Const, 0}, + {"R_SPARC_PCPLT22", Const, 0}, + {"R_SPARC_PCPLT32", Const, 0}, + {"R_SPARC_PC_HH22", Const, 0}, + {"R_SPARC_PC_HM10", Const, 0}, + {"R_SPARC_PC_LM22", Const, 0}, + {"R_SPARC_PLT32", Const, 0}, + {"R_SPARC_PLT64", Const, 0}, + {"R_SPARC_REGISTER", Const, 0}, + {"R_SPARC_RELATIVE", Const, 0}, + {"R_SPARC_UA16", Const, 0}, + {"R_SPARC_UA32", Const, 0}, + {"R_SPARC_UA64", Const, 0}, + {"R_SPARC_WDISP16", Const, 0}, + {"R_SPARC_WDISP19", Const, 0}, + {"R_SPARC_WDISP22", Const, 0}, + {"R_SPARC_WDISP30", Const, 0}, + {"R_SPARC_WPLT30", Const, 0}, + {"R_SYM32", Func, 0}, + {"R_SYM64", Func, 0}, + {"R_TYPE32", Func, 0}, + {"R_TYPE64", Func, 0}, + {"R_X86_64", Type, 0}, + {"R_X86_64_16", Const, 0}, + {"R_X86_64_32", Const, 0}, + {"R_X86_64_32S", Const, 0}, + {"R_X86_64_64", Const, 0}, + {"R_X86_64_8", Const, 0}, + {"R_X86_64_COPY", Const, 0}, + {"R_X86_64_DTPMOD64", Const, 0}, + {"R_X86_64_DTPOFF32", Const, 0}, + {"R_X86_64_DTPOFF64", Const, 0}, + {"R_X86_64_GLOB_DAT", Const, 0}, + {"R_X86_64_GOT32", Const, 0}, + {"R_X86_64_GOT64", Const, 10}, + {"R_X86_64_GOTOFF64", Const, 10}, + {"R_X86_64_GOTPC32", Const, 10}, + {"R_X86_64_GOTPC32_TLSDESC", Const, 10}, + {"R_X86_64_GOTPC64", Const, 10}, + {"R_X86_64_GOTPCREL", Const, 0}, + {"R_X86_64_GOTPCREL64", Const, 10}, + {"R_X86_64_GOTPCRELX", Const, 10}, + {"R_X86_64_GOTPLT64", Const, 10}, + {"R_X86_64_GOTTPOFF", Const, 0}, + {"R_X86_64_IRELATIVE", Const, 10}, + {"R_X86_64_JMP_SLOT", Const, 0}, + {"R_X86_64_NONE", Const, 0}, + {"R_X86_64_PC16", Const, 0}, + {"R_X86_64_PC32", Const, 0}, + {"R_X86_64_PC32_BND", Const, 10}, + {"R_X86_64_PC64", Const, 10}, + {"R_X86_64_PC8", Const, 0}, + {"R_X86_64_PLT32", Const, 0}, + {"R_X86_64_PLT32_BND", Const, 10}, + {"R_X86_64_PLTOFF64", Const, 10}, + {"R_X86_64_RELATIVE", Const, 0}, + {"R_X86_64_RELATIVE64", Const, 10}, + {"R_X86_64_REX_GOTPCRELX", Const, 10}, + {"R_X86_64_SIZE32", Const, 10}, + {"R_X86_64_SIZE64", Const, 10}, + {"R_X86_64_TLSDESC", Const, 10}, + {"R_X86_64_TLSDESC_CALL", Const, 10}, + {"R_X86_64_TLSGD", Const, 0}, + {"R_X86_64_TLSLD", Const, 0}, + {"R_X86_64_TPOFF32", Const, 0}, + {"R_X86_64_TPOFF64", Const, 0}, + {"Rel32", Type, 0}, + {"Rel32.Info", Field, 0}, + {"Rel32.Off", Field, 0}, + {"Rel64", Type, 0}, + {"Rel64.Info", Field, 0}, + {"Rel64.Off", Field, 0}, + {"Rela32", Type, 0}, + {"Rela32.Addend", Field, 0}, + {"Rela32.Info", Field, 0}, + {"Rela32.Off", Field, 0}, + {"Rela64", Type, 0}, + {"Rela64.Addend", Field, 0}, + {"Rela64.Info", Field, 0}, + {"Rela64.Off", Field, 0}, + {"SHF_ALLOC", Const, 0}, + {"SHF_COMPRESSED", Const, 6}, + {"SHF_EXECINSTR", Const, 0}, + {"SHF_GROUP", Const, 0}, + {"SHF_INFO_LINK", Const, 0}, + {"SHF_LINK_ORDER", Const, 0}, + {"SHF_MASKOS", Const, 0}, + {"SHF_MASKPROC", Const, 0}, + {"SHF_MERGE", Const, 0}, + {"SHF_OS_NONCONFORMING", Const, 0}, + {"SHF_STRINGS", Const, 0}, + {"SHF_TLS", Const, 0}, + {"SHF_WRITE", Const, 0}, + {"SHN_ABS", Const, 0}, + {"SHN_COMMON", Const, 0}, + {"SHN_HIOS", Const, 0}, + {"SHN_HIPROC", Const, 0}, + {"SHN_HIRESERVE", Const, 0}, + {"SHN_LOOS", Const, 0}, + {"SHN_LOPROC", Const, 0}, + {"SHN_LORESERVE", Const, 0}, + {"SHN_UNDEF", Const, 0}, + {"SHN_XINDEX", Const, 0}, + {"SHT_DYNAMIC", Const, 0}, + {"SHT_DYNSYM", Const, 0}, + {"SHT_FINI_ARRAY", Const, 0}, + {"SHT_GNU_ATTRIBUTES", Const, 0}, + {"SHT_GNU_HASH", Const, 0}, + {"SHT_GNU_LIBLIST", Const, 0}, + {"SHT_GNU_VERDEF", Const, 0}, + {"SHT_GNU_VERNEED", Const, 0}, + {"SHT_GNU_VERSYM", Const, 0}, + {"SHT_GROUP", Const, 0}, + {"SHT_HASH", Const, 0}, + {"SHT_HIOS", Const, 0}, + {"SHT_HIPROC", Const, 0}, + {"SHT_HIUSER", Const, 0}, + {"SHT_INIT_ARRAY", Const, 0}, + {"SHT_LOOS", Const, 0}, + {"SHT_LOPROC", Const, 0}, + {"SHT_LOUSER", Const, 0}, + {"SHT_MIPS_ABIFLAGS", Const, 17}, + {"SHT_NOBITS", Const, 0}, + {"SHT_NOTE", Const, 0}, + {"SHT_NULL", Const, 0}, + {"SHT_PREINIT_ARRAY", Const, 0}, + {"SHT_PROGBITS", Const, 0}, + {"SHT_REL", Const, 0}, + {"SHT_RELA", Const, 0}, + {"SHT_SHLIB", Const, 0}, + {"SHT_STRTAB", Const, 0}, + {"SHT_SYMTAB", Const, 0}, + {"SHT_SYMTAB_SHNDX", Const, 0}, + {"STB_GLOBAL", Const, 0}, + {"STB_HIOS", Const, 0}, + {"STB_HIPROC", Const, 0}, + {"STB_LOCAL", Const, 0}, + {"STB_LOOS", Const, 0}, + {"STB_LOPROC", Const, 0}, + {"STB_WEAK", Const, 0}, + {"STT_COMMON", Const, 0}, + {"STT_FILE", Const, 0}, + {"STT_FUNC", Const, 0}, + {"STT_HIOS", Const, 0}, + {"STT_HIPROC", Const, 0}, + {"STT_LOOS", Const, 0}, + {"STT_LOPROC", Const, 0}, + {"STT_NOTYPE", Const, 0}, + {"STT_OBJECT", Const, 0}, + {"STT_SECTION", Const, 0}, + {"STT_TLS", Const, 0}, + {"STV_DEFAULT", Const, 0}, + {"STV_HIDDEN", Const, 0}, + {"STV_INTERNAL", Const, 0}, + {"STV_PROTECTED", Const, 0}, + {"ST_BIND", Func, 0}, + {"ST_INFO", Func, 0}, + {"ST_TYPE", Func, 0}, + {"ST_VISIBILITY", Func, 0}, + {"Section", Type, 0}, + {"Section.ReaderAt", Field, 0}, + {"Section.SectionHeader", Field, 0}, + {"Section32", Type, 0}, + {"Section32.Addr", Field, 0}, + {"Section32.Addralign", Field, 0}, + {"Section32.Entsize", Field, 0}, + {"Section32.Flags", Field, 0}, + {"Section32.Info", Field, 0}, + {"Section32.Link", Field, 0}, + {"Section32.Name", Field, 0}, + {"Section32.Off", Field, 0}, + {"Section32.Size", Field, 0}, + {"Section32.Type", Field, 0}, + {"Section64", Type, 0}, + {"Section64.Addr", Field, 0}, + {"Section64.Addralign", Field, 0}, + {"Section64.Entsize", Field, 0}, + {"Section64.Flags", Field, 0}, + {"Section64.Info", Field, 0}, + {"Section64.Link", Field, 0}, + {"Section64.Name", Field, 0}, + {"Section64.Off", Field, 0}, + {"Section64.Size", Field, 0}, + {"Section64.Type", Field, 0}, + {"SectionFlag", Type, 0}, + {"SectionHeader", Type, 0}, + {"SectionHeader.Addr", Field, 0}, + {"SectionHeader.Addralign", Field, 0}, + {"SectionHeader.Entsize", Field, 0}, + {"SectionHeader.FileSize", Field, 6}, + {"SectionHeader.Flags", Field, 0}, + {"SectionHeader.Info", Field, 0}, + {"SectionHeader.Link", Field, 0}, + {"SectionHeader.Name", Field, 0}, + {"SectionHeader.Offset", Field, 0}, + {"SectionHeader.Size", Field, 0}, + {"SectionHeader.Type", Field, 0}, + {"SectionIndex", Type, 0}, + {"SectionType", Type, 0}, + {"Sym32", Type, 0}, + {"Sym32.Info", Field, 0}, + {"Sym32.Name", Field, 0}, + {"Sym32.Other", Field, 0}, + {"Sym32.Shndx", Field, 0}, + {"Sym32.Size", Field, 0}, + {"Sym32.Value", Field, 0}, + {"Sym32Size", Const, 0}, + {"Sym64", Type, 0}, + {"Sym64.Info", Field, 0}, + {"Sym64.Name", Field, 0}, + {"Sym64.Other", Field, 0}, + {"Sym64.Shndx", Field, 0}, + {"Sym64.Size", Field, 0}, + {"Sym64.Value", Field, 0}, + {"Sym64Size", Const, 0}, + {"SymBind", Type, 0}, + {"SymType", Type, 0}, + {"SymVis", Type, 0}, + {"Symbol", Type, 0}, + {"Symbol.Info", Field, 0}, + {"Symbol.Library", Field, 13}, + {"Symbol.Name", Field, 0}, + {"Symbol.Other", Field, 0}, + {"Symbol.Section", Field, 0}, + {"Symbol.Size", Field, 0}, + {"Symbol.Value", Field, 0}, + {"Symbol.Version", Field, 13}, + {"Type", Type, 0}, + {"Version", Type, 0}, + }, + "debug/gosym": { + {"(*DecodingError).Error", Method, 0}, + {"(*LineTable).LineToPC", Method, 0}, + {"(*LineTable).PCToLine", Method, 0}, + {"(*Sym).BaseName", Method, 0}, + {"(*Sym).PackageName", Method, 0}, + {"(*Sym).ReceiverName", Method, 0}, + {"(*Sym).Static", Method, 0}, + {"(*Table).LineToPC", Method, 0}, + {"(*Table).LookupFunc", Method, 0}, + {"(*Table).LookupSym", Method, 0}, + {"(*Table).PCToFunc", Method, 0}, + {"(*Table).PCToLine", Method, 0}, + {"(*Table).SymByAddr", Method, 0}, + {"(*UnknownLineError).Error", Method, 0}, + {"(Func).BaseName", Method, 0}, + {"(Func).PackageName", Method, 0}, + {"(Func).ReceiverName", Method, 0}, + {"(Func).Static", Method, 0}, + {"(UnknownFileError).Error", Method, 0}, + {"DecodingError", Type, 0}, + {"Func", Type, 0}, + {"Func.End", Field, 0}, + {"Func.Entry", Field, 0}, + {"Func.FrameSize", Field, 0}, + {"Func.LineTable", Field, 0}, + {"Func.Locals", Field, 0}, + {"Func.Obj", Field, 0}, + {"Func.Params", Field, 0}, + {"Func.Sym", Field, 0}, + {"LineTable", Type, 0}, + {"LineTable.Data", Field, 0}, + {"LineTable.Line", Field, 0}, + {"LineTable.PC", Field, 0}, + {"NewLineTable", Func, 0}, + {"NewTable", Func, 0}, + {"Obj", Type, 0}, + {"Obj.Funcs", Field, 0}, + {"Obj.Paths", Field, 0}, + {"Sym", Type, 0}, + {"Sym.Func", Field, 0}, + {"Sym.GoType", Field, 0}, + {"Sym.Name", Field, 0}, + {"Sym.Type", Field, 0}, + {"Sym.Value", Field, 0}, + {"Table", Type, 0}, + {"Table.Files", Field, 0}, + {"Table.Funcs", Field, 0}, + {"Table.Objs", Field, 0}, + {"Table.Syms", Field, 0}, + {"UnknownFileError", Type, 0}, + {"UnknownLineError", Type, 0}, + {"UnknownLineError.File", Field, 0}, + {"UnknownLineError.Line", Field, 0}, + }, + "debug/macho": { + {"(*FatFile).Close", Method, 3}, + {"(*File).Close", Method, 0}, + {"(*File).DWARF", Method, 0}, + {"(*File).ImportedLibraries", Method, 0}, + {"(*File).ImportedSymbols", Method, 0}, + {"(*File).Section", Method, 0}, + {"(*File).Segment", Method, 0}, + {"(*FormatError).Error", Method, 0}, + {"(*Section).Data", Method, 0}, + {"(*Section).Open", Method, 0}, + {"(*Segment).Data", Method, 0}, + {"(*Segment).Open", Method, 0}, + {"(Cpu).GoString", Method, 0}, + {"(Cpu).String", Method, 0}, + {"(Dylib).Raw", Method, 0}, + {"(Dysymtab).Raw", Method, 0}, + {"(FatArch).Close", Method, 3}, + {"(FatArch).DWARF", Method, 3}, + {"(FatArch).ImportedLibraries", Method, 3}, + {"(FatArch).ImportedSymbols", Method, 3}, + {"(FatArch).Section", Method, 3}, + {"(FatArch).Segment", Method, 3}, + {"(LoadBytes).Raw", Method, 0}, + {"(LoadCmd).GoString", Method, 0}, + {"(LoadCmd).String", Method, 0}, + {"(RelocTypeARM).GoString", Method, 10}, + {"(RelocTypeARM).String", Method, 10}, + {"(RelocTypeARM64).GoString", Method, 10}, + {"(RelocTypeARM64).String", Method, 10}, + {"(RelocTypeGeneric).GoString", Method, 10}, + {"(RelocTypeGeneric).String", Method, 10}, + {"(RelocTypeX86_64).GoString", Method, 10}, + {"(RelocTypeX86_64).String", Method, 10}, + {"(Rpath).Raw", Method, 10}, + {"(Section).ReadAt", Method, 0}, + {"(Segment).Raw", Method, 0}, + {"(Segment).ReadAt", Method, 0}, + {"(Symtab).Raw", Method, 0}, + {"(Type).GoString", Method, 10}, + {"(Type).String", Method, 10}, + {"ARM64_RELOC_ADDEND", Const, 10}, + {"ARM64_RELOC_BRANCH26", Const, 10}, + {"ARM64_RELOC_GOT_LOAD_PAGE21", Const, 10}, + {"ARM64_RELOC_GOT_LOAD_PAGEOFF12", Const, 10}, + {"ARM64_RELOC_PAGE21", Const, 10}, + {"ARM64_RELOC_PAGEOFF12", Const, 10}, + {"ARM64_RELOC_POINTER_TO_GOT", Const, 10}, + {"ARM64_RELOC_SUBTRACTOR", Const, 10}, + {"ARM64_RELOC_TLVP_LOAD_PAGE21", Const, 10}, + {"ARM64_RELOC_TLVP_LOAD_PAGEOFF12", Const, 10}, + {"ARM64_RELOC_UNSIGNED", Const, 10}, + {"ARM_RELOC_BR24", Const, 10}, + {"ARM_RELOC_HALF", Const, 10}, + {"ARM_RELOC_HALF_SECTDIFF", Const, 10}, + {"ARM_RELOC_LOCAL_SECTDIFF", Const, 10}, + {"ARM_RELOC_PAIR", Const, 10}, + {"ARM_RELOC_PB_LA_PTR", Const, 10}, + {"ARM_RELOC_SECTDIFF", Const, 10}, + {"ARM_RELOC_VANILLA", Const, 10}, + {"ARM_THUMB_32BIT_BRANCH", Const, 10}, + {"ARM_THUMB_RELOC_BR22", Const, 10}, + {"Cpu", Type, 0}, + {"Cpu386", Const, 0}, + {"CpuAmd64", Const, 0}, + {"CpuArm", Const, 3}, + {"CpuArm64", Const, 11}, + {"CpuPpc", Const, 3}, + {"CpuPpc64", Const, 3}, + {"Dylib", Type, 0}, + {"Dylib.CompatVersion", Field, 0}, + {"Dylib.CurrentVersion", Field, 0}, + {"Dylib.LoadBytes", Field, 0}, + {"Dylib.Name", Field, 0}, + {"Dylib.Time", Field, 0}, + {"DylibCmd", Type, 0}, + {"DylibCmd.Cmd", Field, 0}, + {"DylibCmd.CompatVersion", Field, 0}, + {"DylibCmd.CurrentVersion", Field, 0}, + {"DylibCmd.Len", Field, 0}, + {"DylibCmd.Name", Field, 0}, + {"DylibCmd.Time", Field, 0}, + {"Dysymtab", Type, 0}, + {"Dysymtab.DysymtabCmd", Field, 0}, + {"Dysymtab.IndirectSyms", Field, 0}, + {"Dysymtab.LoadBytes", Field, 0}, + {"DysymtabCmd", Type, 0}, + {"DysymtabCmd.Cmd", Field, 0}, + {"DysymtabCmd.Extrefsymoff", Field, 0}, + {"DysymtabCmd.Extreloff", Field, 0}, + {"DysymtabCmd.Iextdefsym", Field, 0}, + {"DysymtabCmd.Ilocalsym", Field, 0}, + {"DysymtabCmd.Indirectsymoff", Field, 0}, + {"DysymtabCmd.Iundefsym", Field, 0}, + {"DysymtabCmd.Len", Field, 0}, + {"DysymtabCmd.Locreloff", Field, 0}, + {"DysymtabCmd.Modtaboff", Field, 0}, + {"DysymtabCmd.Nextdefsym", Field, 0}, + {"DysymtabCmd.Nextrefsyms", Field, 0}, + {"DysymtabCmd.Nextrel", Field, 0}, + {"DysymtabCmd.Nindirectsyms", Field, 0}, + {"DysymtabCmd.Nlocalsym", Field, 0}, + {"DysymtabCmd.Nlocrel", Field, 0}, + {"DysymtabCmd.Nmodtab", Field, 0}, + {"DysymtabCmd.Ntoc", Field, 0}, + {"DysymtabCmd.Nundefsym", Field, 0}, + {"DysymtabCmd.Tocoffset", Field, 0}, + {"ErrNotFat", Var, 3}, + {"FatArch", Type, 3}, + {"FatArch.FatArchHeader", Field, 3}, + {"FatArch.File", Field, 3}, + {"FatArchHeader", Type, 3}, + {"FatArchHeader.Align", Field, 3}, + {"FatArchHeader.Cpu", Field, 3}, + {"FatArchHeader.Offset", Field, 3}, + {"FatArchHeader.Size", Field, 3}, + {"FatArchHeader.SubCpu", Field, 3}, + {"FatFile", Type, 3}, + {"FatFile.Arches", Field, 3}, + {"FatFile.Magic", Field, 3}, + {"File", Type, 0}, + {"File.ByteOrder", Field, 0}, + {"File.Dysymtab", Field, 0}, + {"File.FileHeader", Field, 0}, + {"File.Loads", Field, 0}, + {"File.Sections", Field, 0}, + {"File.Symtab", Field, 0}, + {"FileHeader", Type, 0}, + {"FileHeader.Cmdsz", Field, 0}, + {"FileHeader.Cpu", Field, 0}, + {"FileHeader.Flags", Field, 0}, + {"FileHeader.Magic", Field, 0}, + {"FileHeader.Ncmd", Field, 0}, + {"FileHeader.SubCpu", Field, 0}, + {"FileHeader.Type", Field, 0}, + {"FlagAllModsBound", Const, 10}, + {"FlagAllowStackExecution", Const, 10}, + {"FlagAppExtensionSafe", Const, 10}, + {"FlagBindAtLoad", Const, 10}, + {"FlagBindsToWeak", Const, 10}, + {"FlagCanonical", Const, 10}, + {"FlagDeadStrippableDylib", Const, 10}, + {"FlagDyldLink", Const, 10}, + {"FlagForceFlat", Const, 10}, + {"FlagHasTLVDescriptors", Const, 10}, + {"FlagIncrLink", Const, 10}, + {"FlagLazyInit", Const, 10}, + {"FlagNoFixPrebinding", Const, 10}, + {"FlagNoHeapExecution", Const, 10}, + {"FlagNoMultiDefs", Const, 10}, + {"FlagNoReexportedDylibs", Const, 10}, + {"FlagNoUndefs", Const, 10}, + {"FlagPIE", Const, 10}, + {"FlagPrebindable", Const, 10}, + {"FlagPrebound", Const, 10}, + {"FlagRootSafe", Const, 10}, + {"FlagSetuidSafe", Const, 10}, + {"FlagSplitSegs", Const, 10}, + {"FlagSubsectionsViaSymbols", Const, 10}, + {"FlagTwoLevel", Const, 10}, + {"FlagWeakDefines", Const, 10}, + {"FormatError", Type, 0}, + {"GENERIC_RELOC_LOCAL_SECTDIFF", Const, 10}, + {"GENERIC_RELOC_PAIR", Const, 10}, + {"GENERIC_RELOC_PB_LA_PTR", Const, 10}, + {"GENERIC_RELOC_SECTDIFF", Const, 10}, + {"GENERIC_RELOC_TLV", Const, 10}, + {"GENERIC_RELOC_VANILLA", Const, 10}, + {"Load", Type, 0}, + {"LoadBytes", Type, 0}, + {"LoadCmd", Type, 0}, + {"LoadCmdDylib", Const, 0}, + {"LoadCmdDylinker", Const, 0}, + {"LoadCmdDysymtab", Const, 0}, + {"LoadCmdRpath", Const, 10}, + {"LoadCmdSegment", Const, 0}, + {"LoadCmdSegment64", Const, 0}, + {"LoadCmdSymtab", Const, 0}, + {"LoadCmdThread", Const, 0}, + {"LoadCmdUnixThread", Const, 0}, + {"Magic32", Const, 0}, + {"Magic64", Const, 0}, + {"MagicFat", Const, 3}, + {"NewFatFile", Func, 3}, + {"NewFile", Func, 0}, + {"Nlist32", Type, 0}, + {"Nlist32.Desc", Field, 0}, + {"Nlist32.Name", Field, 0}, + {"Nlist32.Sect", Field, 0}, + {"Nlist32.Type", Field, 0}, + {"Nlist32.Value", Field, 0}, + {"Nlist64", Type, 0}, + {"Nlist64.Desc", Field, 0}, + {"Nlist64.Name", Field, 0}, + {"Nlist64.Sect", Field, 0}, + {"Nlist64.Type", Field, 0}, + {"Nlist64.Value", Field, 0}, + {"Open", Func, 0}, + {"OpenFat", Func, 3}, + {"Regs386", Type, 0}, + {"Regs386.AX", Field, 0}, + {"Regs386.BP", Field, 0}, + {"Regs386.BX", Field, 0}, + {"Regs386.CS", Field, 0}, + {"Regs386.CX", Field, 0}, + {"Regs386.DI", Field, 0}, + {"Regs386.DS", Field, 0}, + {"Regs386.DX", Field, 0}, + {"Regs386.ES", Field, 0}, + {"Regs386.FLAGS", Field, 0}, + {"Regs386.FS", Field, 0}, + {"Regs386.GS", Field, 0}, + {"Regs386.IP", Field, 0}, + {"Regs386.SI", Field, 0}, + {"Regs386.SP", Field, 0}, + {"Regs386.SS", Field, 0}, + {"RegsAMD64", Type, 0}, + {"RegsAMD64.AX", Field, 0}, + {"RegsAMD64.BP", Field, 0}, + {"RegsAMD64.BX", Field, 0}, + {"RegsAMD64.CS", Field, 0}, + {"RegsAMD64.CX", Field, 0}, + {"RegsAMD64.DI", Field, 0}, + {"RegsAMD64.DX", Field, 0}, + {"RegsAMD64.FLAGS", Field, 0}, + {"RegsAMD64.FS", Field, 0}, + {"RegsAMD64.GS", Field, 0}, + {"RegsAMD64.IP", Field, 0}, + {"RegsAMD64.R10", Field, 0}, + {"RegsAMD64.R11", Field, 0}, + {"RegsAMD64.R12", Field, 0}, + {"RegsAMD64.R13", Field, 0}, + {"RegsAMD64.R14", Field, 0}, + {"RegsAMD64.R15", Field, 0}, + {"RegsAMD64.R8", Field, 0}, + {"RegsAMD64.R9", Field, 0}, + {"RegsAMD64.SI", Field, 0}, + {"RegsAMD64.SP", Field, 0}, + {"Reloc", Type, 10}, + {"Reloc.Addr", Field, 10}, + {"Reloc.Extern", Field, 10}, + {"Reloc.Len", Field, 10}, + {"Reloc.Pcrel", Field, 10}, + {"Reloc.Scattered", Field, 10}, + {"Reloc.Type", Field, 10}, + {"Reloc.Value", Field, 10}, + {"RelocTypeARM", Type, 10}, + {"RelocTypeARM64", Type, 10}, + {"RelocTypeGeneric", Type, 10}, + {"RelocTypeX86_64", Type, 10}, + {"Rpath", Type, 10}, + {"Rpath.LoadBytes", Field, 10}, + {"Rpath.Path", Field, 10}, + {"RpathCmd", Type, 10}, + {"RpathCmd.Cmd", Field, 10}, + {"RpathCmd.Len", Field, 10}, + {"RpathCmd.Path", Field, 10}, + {"Section", Type, 0}, + {"Section.ReaderAt", Field, 0}, + {"Section.Relocs", Field, 10}, + {"Section.SectionHeader", Field, 0}, + {"Section32", Type, 0}, + {"Section32.Addr", Field, 0}, + {"Section32.Align", Field, 0}, + {"Section32.Flags", Field, 0}, + {"Section32.Name", Field, 0}, + {"Section32.Nreloc", Field, 0}, + {"Section32.Offset", Field, 0}, + {"Section32.Reloff", Field, 0}, + {"Section32.Reserve1", Field, 0}, + {"Section32.Reserve2", Field, 0}, + {"Section32.Seg", Field, 0}, + {"Section32.Size", Field, 0}, + {"Section64", Type, 0}, + {"Section64.Addr", Field, 0}, + {"Section64.Align", Field, 0}, + {"Section64.Flags", Field, 0}, + {"Section64.Name", Field, 0}, + {"Section64.Nreloc", Field, 0}, + {"Section64.Offset", Field, 0}, + {"Section64.Reloff", Field, 0}, + {"Section64.Reserve1", Field, 0}, + {"Section64.Reserve2", Field, 0}, + {"Section64.Reserve3", Field, 0}, + {"Section64.Seg", Field, 0}, + {"Section64.Size", Field, 0}, + {"SectionHeader", Type, 0}, + {"SectionHeader.Addr", Field, 0}, + {"SectionHeader.Align", Field, 0}, + {"SectionHeader.Flags", Field, 0}, + {"SectionHeader.Name", Field, 0}, + {"SectionHeader.Nreloc", Field, 0}, + {"SectionHeader.Offset", Field, 0}, + {"SectionHeader.Reloff", Field, 0}, + {"SectionHeader.Seg", Field, 0}, + {"SectionHeader.Size", Field, 0}, + {"Segment", Type, 0}, + {"Segment.LoadBytes", Field, 0}, + {"Segment.ReaderAt", Field, 0}, + {"Segment.SegmentHeader", Field, 0}, + {"Segment32", Type, 0}, + {"Segment32.Addr", Field, 0}, + {"Segment32.Cmd", Field, 0}, + {"Segment32.Filesz", Field, 0}, + {"Segment32.Flag", Field, 0}, + {"Segment32.Len", Field, 0}, + {"Segment32.Maxprot", Field, 0}, + {"Segment32.Memsz", Field, 0}, + {"Segment32.Name", Field, 0}, + {"Segment32.Nsect", Field, 0}, + {"Segment32.Offset", Field, 0}, + {"Segment32.Prot", Field, 0}, + {"Segment64", Type, 0}, + {"Segment64.Addr", Field, 0}, + {"Segment64.Cmd", Field, 0}, + {"Segment64.Filesz", Field, 0}, + {"Segment64.Flag", Field, 0}, + {"Segment64.Len", Field, 0}, + {"Segment64.Maxprot", Field, 0}, + {"Segment64.Memsz", Field, 0}, + {"Segment64.Name", Field, 0}, + {"Segment64.Nsect", Field, 0}, + {"Segment64.Offset", Field, 0}, + {"Segment64.Prot", Field, 0}, + {"SegmentHeader", Type, 0}, + {"SegmentHeader.Addr", Field, 0}, + {"SegmentHeader.Cmd", Field, 0}, + {"SegmentHeader.Filesz", Field, 0}, + {"SegmentHeader.Flag", Field, 0}, + {"SegmentHeader.Len", Field, 0}, + {"SegmentHeader.Maxprot", Field, 0}, + {"SegmentHeader.Memsz", Field, 0}, + {"SegmentHeader.Name", Field, 0}, + {"SegmentHeader.Nsect", Field, 0}, + {"SegmentHeader.Offset", Field, 0}, + {"SegmentHeader.Prot", Field, 0}, + {"Symbol", Type, 0}, + {"Symbol.Desc", Field, 0}, + {"Symbol.Name", Field, 0}, + {"Symbol.Sect", Field, 0}, + {"Symbol.Type", Field, 0}, + {"Symbol.Value", Field, 0}, + {"Symtab", Type, 0}, + {"Symtab.LoadBytes", Field, 0}, + {"Symtab.Syms", Field, 0}, + {"Symtab.SymtabCmd", Field, 0}, + {"SymtabCmd", Type, 0}, + {"SymtabCmd.Cmd", Field, 0}, + {"SymtabCmd.Len", Field, 0}, + {"SymtabCmd.Nsyms", Field, 0}, + {"SymtabCmd.Stroff", Field, 0}, + {"SymtabCmd.Strsize", Field, 0}, + {"SymtabCmd.Symoff", Field, 0}, + {"Thread", Type, 0}, + {"Thread.Cmd", Field, 0}, + {"Thread.Data", Field, 0}, + {"Thread.Len", Field, 0}, + {"Thread.Type", Field, 0}, + {"Type", Type, 0}, + {"TypeBundle", Const, 3}, + {"TypeDylib", Const, 3}, + {"TypeExec", Const, 0}, + {"TypeObj", Const, 0}, + {"X86_64_RELOC_BRANCH", Const, 10}, + {"X86_64_RELOC_GOT", Const, 10}, + {"X86_64_RELOC_GOT_LOAD", Const, 10}, + {"X86_64_RELOC_SIGNED", Const, 10}, + {"X86_64_RELOC_SIGNED_1", Const, 10}, + {"X86_64_RELOC_SIGNED_2", Const, 10}, + {"X86_64_RELOC_SIGNED_4", Const, 10}, + {"X86_64_RELOC_SUBTRACTOR", Const, 10}, + {"X86_64_RELOC_TLV", Const, 10}, + {"X86_64_RELOC_UNSIGNED", Const, 10}, + }, + "debug/pe": { + {"(*COFFSymbol).FullName", Method, 8}, + {"(*File).COFFSymbolReadSectionDefAux", Method, 19}, + {"(*File).Close", Method, 0}, + {"(*File).DWARF", Method, 0}, + {"(*File).ImportedLibraries", Method, 0}, + {"(*File).ImportedSymbols", Method, 0}, + {"(*File).Section", Method, 0}, + {"(*FormatError).Error", Method, 0}, + {"(*Section).Data", Method, 0}, + {"(*Section).Open", Method, 0}, + {"(Section).ReadAt", Method, 0}, + {"(StringTable).String", Method, 8}, + {"COFFSymbol", Type, 1}, + {"COFFSymbol.Name", Field, 1}, + {"COFFSymbol.NumberOfAuxSymbols", Field, 1}, + {"COFFSymbol.SectionNumber", Field, 1}, + {"COFFSymbol.StorageClass", Field, 1}, + {"COFFSymbol.Type", Field, 1}, + {"COFFSymbol.Value", Field, 1}, + {"COFFSymbolAuxFormat5", Type, 19}, + {"COFFSymbolAuxFormat5.Checksum", Field, 19}, + {"COFFSymbolAuxFormat5.NumLineNumbers", Field, 19}, + {"COFFSymbolAuxFormat5.NumRelocs", Field, 19}, + {"COFFSymbolAuxFormat5.SecNum", Field, 19}, + {"COFFSymbolAuxFormat5.Selection", Field, 19}, + {"COFFSymbolAuxFormat5.Size", Field, 19}, + {"COFFSymbolSize", Const, 1}, + {"DataDirectory", Type, 3}, + {"DataDirectory.Size", Field, 3}, + {"DataDirectory.VirtualAddress", Field, 3}, + {"File", Type, 0}, + {"File.COFFSymbols", Field, 8}, + {"File.FileHeader", Field, 0}, + {"File.OptionalHeader", Field, 3}, + {"File.Sections", Field, 0}, + {"File.StringTable", Field, 8}, + {"File.Symbols", Field, 1}, + {"FileHeader", Type, 0}, + {"FileHeader.Characteristics", Field, 0}, + {"FileHeader.Machine", Field, 0}, + {"FileHeader.NumberOfSections", Field, 0}, + {"FileHeader.NumberOfSymbols", Field, 0}, + {"FileHeader.PointerToSymbolTable", Field, 0}, + {"FileHeader.SizeOfOptionalHeader", Field, 0}, + {"FileHeader.TimeDateStamp", Field, 0}, + {"FormatError", Type, 0}, + {"IMAGE_COMDAT_SELECT_ANY", Const, 19}, + {"IMAGE_COMDAT_SELECT_ASSOCIATIVE", Const, 19}, + {"IMAGE_COMDAT_SELECT_EXACT_MATCH", Const, 19}, + {"IMAGE_COMDAT_SELECT_LARGEST", Const, 19}, + {"IMAGE_COMDAT_SELECT_NODUPLICATES", Const, 19}, + {"IMAGE_COMDAT_SELECT_SAME_SIZE", Const, 19}, + {"IMAGE_DIRECTORY_ENTRY_ARCHITECTURE", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_BASERELOC", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_BOUND_IMPORT", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_COM_DESCRIPTOR", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_DEBUG", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_DELAY_IMPORT", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_EXCEPTION", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_EXPORT", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_GLOBALPTR", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_IAT", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_IMPORT", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_LOAD_CONFIG", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_RESOURCE", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_SECURITY", Const, 11}, + {"IMAGE_DIRECTORY_ENTRY_TLS", Const, 11}, + {"IMAGE_DLLCHARACTERISTICS_APPCONTAINER", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_DYNAMIC_BASE", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_FORCE_INTEGRITY", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_GUARD_CF", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_HIGH_ENTROPY_VA", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_NO_BIND", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_NO_ISOLATION", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_NO_SEH", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_NX_COMPAT", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_TERMINAL_SERVER_AWARE", Const, 15}, + {"IMAGE_DLLCHARACTERISTICS_WDM_DRIVER", Const, 15}, + {"IMAGE_FILE_32BIT_MACHINE", Const, 15}, + {"IMAGE_FILE_AGGRESIVE_WS_TRIM", Const, 15}, + {"IMAGE_FILE_BYTES_REVERSED_HI", Const, 15}, + {"IMAGE_FILE_BYTES_REVERSED_LO", Const, 15}, + {"IMAGE_FILE_DEBUG_STRIPPED", Const, 15}, + {"IMAGE_FILE_DLL", Const, 15}, + {"IMAGE_FILE_EXECUTABLE_IMAGE", Const, 15}, + {"IMAGE_FILE_LARGE_ADDRESS_AWARE", Const, 15}, + {"IMAGE_FILE_LINE_NUMS_STRIPPED", Const, 15}, + {"IMAGE_FILE_LOCAL_SYMS_STRIPPED", Const, 15}, + {"IMAGE_FILE_MACHINE_AM33", Const, 0}, + {"IMAGE_FILE_MACHINE_AMD64", Const, 0}, + {"IMAGE_FILE_MACHINE_ARM", Const, 0}, + {"IMAGE_FILE_MACHINE_ARM64", Const, 11}, + {"IMAGE_FILE_MACHINE_ARMNT", Const, 12}, + {"IMAGE_FILE_MACHINE_EBC", Const, 0}, + {"IMAGE_FILE_MACHINE_I386", Const, 0}, + {"IMAGE_FILE_MACHINE_IA64", Const, 0}, + {"IMAGE_FILE_MACHINE_LOONGARCH32", Const, 19}, + {"IMAGE_FILE_MACHINE_LOONGARCH64", Const, 19}, + {"IMAGE_FILE_MACHINE_M32R", Const, 0}, + {"IMAGE_FILE_MACHINE_MIPS16", Const, 0}, + {"IMAGE_FILE_MACHINE_MIPSFPU", Const, 0}, + {"IMAGE_FILE_MACHINE_MIPSFPU16", Const, 0}, + {"IMAGE_FILE_MACHINE_POWERPC", Const, 0}, + {"IMAGE_FILE_MACHINE_POWERPCFP", Const, 0}, + {"IMAGE_FILE_MACHINE_R4000", Const, 0}, + {"IMAGE_FILE_MACHINE_RISCV128", Const, 20}, + {"IMAGE_FILE_MACHINE_RISCV32", Const, 20}, + {"IMAGE_FILE_MACHINE_RISCV64", Const, 20}, + {"IMAGE_FILE_MACHINE_SH3", Const, 0}, + {"IMAGE_FILE_MACHINE_SH3DSP", Const, 0}, + {"IMAGE_FILE_MACHINE_SH4", Const, 0}, + {"IMAGE_FILE_MACHINE_SH5", Const, 0}, + {"IMAGE_FILE_MACHINE_THUMB", Const, 0}, + {"IMAGE_FILE_MACHINE_UNKNOWN", Const, 0}, + {"IMAGE_FILE_MACHINE_WCEMIPSV2", Const, 0}, + {"IMAGE_FILE_NET_RUN_FROM_SWAP", Const, 15}, + {"IMAGE_FILE_RELOCS_STRIPPED", Const, 15}, + {"IMAGE_FILE_REMOVABLE_RUN_FROM_SWAP", Const, 15}, + {"IMAGE_FILE_SYSTEM", Const, 15}, + {"IMAGE_FILE_UP_SYSTEM_ONLY", Const, 15}, + {"IMAGE_SCN_CNT_CODE", Const, 19}, + {"IMAGE_SCN_CNT_INITIALIZED_DATA", Const, 19}, + {"IMAGE_SCN_CNT_UNINITIALIZED_DATA", Const, 19}, + {"IMAGE_SCN_LNK_COMDAT", Const, 19}, + {"IMAGE_SCN_MEM_DISCARDABLE", Const, 19}, + {"IMAGE_SCN_MEM_EXECUTE", Const, 19}, + {"IMAGE_SCN_MEM_READ", Const, 19}, + {"IMAGE_SCN_MEM_WRITE", Const, 19}, + {"IMAGE_SUBSYSTEM_EFI_APPLICATION", Const, 15}, + {"IMAGE_SUBSYSTEM_EFI_BOOT_SERVICE_DRIVER", Const, 15}, + {"IMAGE_SUBSYSTEM_EFI_ROM", Const, 15}, + {"IMAGE_SUBSYSTEM_EFI_RUNTIME_DRIVER", Const, 15}, + {"IMAGE_SUBSYSTEM_NATIVE", Const, 15}, + {"IMAGE_SUBSYSTEM_NATIVE_WINDOWS", Const, 15}, + {"IMAGE_SUBSYSTEM_OS2_CUI", Const, 15}, + {"IMAGE_SUBSYSTEM_POSIX_CUI", Const, 15}, + {"IMAGE_SUBSYSTEM_UNKNOWN", Const, 15}, + {"IMAGE_SUBSYSTEM_WINDOWS_BOOT_APPLICATION", Const, 15}, + {"IMAGE_SUBSYSTEM_WINDOWS_CE_GUI", Const, 15}, + {"IMAGE_SUBSYSTEM_WINDOWS_CUI", Const, 15}, + {"IMAGE_SUBSYSTEM_WINDOWS_GUI", Const, 15}, + {"IMAGE_SUBSYSTEM_XBOX", Const, 15}, + {"ImportDirectory", Type, 0}, + {"ImportDirectory.FirstThunk", Field, 0}, + {"ImportDirectory.ForwarderChain", Field, 0}, + {"ImportDirectory.Name", Field, 0}, + {"ImportDirectory.OriginalFirstThunk", Field, 0}, + {"ImportDirectory.TimeDateStamp", Field, 0}, + {"NewFile", Func, 0}, + {"Open", Func, 0}, + {"OptionalHeader32", Type, 3}, + {"OptionalHeader32.AddressOfEntryPoint", Field, 3}, + {"OptionalHeader32.BaseOfCode", Field, 3}, + {"OptionalHeader32.BaseOfData", Field, 3}, + {"OptionalHeader32.CheckSum", Field, 3}, + {"OptionalHeader32.DataDirectory", Field, 3}, + {"OptionalHeader32.DllCharacteristics", Field, 3}, + {"OptionalHeader32.FileAlignment", Field, 3}, + {"OptionalHeader32.ImageBase", Field, 3}, + {"OptionalHeader32.LoaderFlags", Field, 3}, + {"OptionalHeader32.Magic", Field, 3}, + {"OptionalHeader32.MajorImageVersion", Field, 3}, + {"OptionalHeader32.MajorLinkerVersion", Field, 3}, + {"OptionalHeader32.MajorOperatingSystemVersion", Field, 3}, + {"OptionalHeader32.MajorSubsystemVersion", Field, 3}, + {"OptionalHeader32.MinorImageVersion", Field, 3}, + {"OptionalHeader32.MinorLinkerVersion", Field, 3}, + {"OptionalHeader32.MinorOperatingSystemVersion", Field, 3}, + {"OptionalHeader32.MinorSubsystemVersion", Field, 3}, + {"OptionalHeader32.NumberOfRvaAndSizes", Field, 3}, + {"OptionalHeader32.SectionAlignment", Field, 3}, + {"OptionalHeader32.SizeOfCode", Field, 3}, + {"OptionalHeader32.SizeOfHeaders", Field, 3}, + {"OptionalHeader32.SizeOfHeapCommit", Field, 3}, + {"OptionalHeader32.SizeOfHeapReserve", Field, 3}, + {"OptionalHeader32.SizeOfImage", Field, 3}, + {"OptionalHeader32.SizeOfInitializedData", Field, 3}, + {"OptionalHeader32.SizeOfStackCommit", Field, 3}, + {"OptionalHeader32.SizeOfStackReserve", Field, 3}, + {"OptionalHeader32.SizeOfUninitializedData", Field, 3}, + {"OptionalHeader32.Subsystem", Field, 3}, + {"OptionalHeader32.Win32VersionValue", Field, 3}, + {"OptionalHeader64", Type, 3}, + {"OptionalHeader64.AddressOfEntryPoint", Field, 3}, + {"OptionalHeader64.BaseOfCode", Field, 3}, + {"OptionalHeader64.CheckSum", Field, 3}, + {"OptionalHeader64.DataDirectory", Field, 3}, + {"OptionalHeader64.DllCharacteristics", Field, 3}, + {"OptionalHeader64.FileAlignment", Field, 3}, + {"OptionalHeader64.ImageBase", Field, 3}, + {"OptionalHeader64.LoaderFlags", Field, 3}, + {"OptionalHeader64.Magic", Field, 3}, + {"OptionalHeader64.MajorImageVersion", Field, 3}, + {"OptionalHeader64.MajorLinkerVersion", Field, 3}, + {"OptionalHeader64.MajorOperatingSystemVersion", Field, 3}, + {"OptionalHeader64.MajorSubsystemVersion", Field, 3}, + {"OptionalHeader64.MinorImageVersion", Field, 3}, + {"OptionalHeader64.MinorLinkerVersion", Field, 3}, + {"OptionalHeader64.MinorOperatingSystemVersion", Field, 3}, + {"OptionalHeader64.MinorSubsystemVersion", Field, 3}, + {"OptionalHeader64.NumberOfRvaAndSizes", Field, 3}, + {"OptionalHeader64.SectionAlignment", Field, 3}, + {"OptionalHeader64.SizeOfCode", Field, 3}, + {"OptionalHeader64.SizeOfHeaders", Field, 3}, + {"OptionalHeader64.SizeOfHeapCommit", Field, 3}, + {"OptionalHeader64.SizeOfHeapReserve", Field, 3}, + {"OptionalHeader64.SizeOfImage", Field, 3}, + {"OptionalHeader64.SizeOfInitializedData", Field, 3}, + {"OptionalHeader64.SizeOfStackCommit", Field, 3}, + {"OptionalHeader64.SizeOfStackReserve", Field, 3}, + {"OptionalHeader64.SizeOfUninitializedData", Field, 3}, + {"OptionalHeader64.Subsystem", Field, 3}, + {"OptionalHeader64.Win32VersionValue", Field, 3}, + {"Reloc", Type, 8}, + {"Reloc.SymbolTableIndex", Field, 8}, + {"Reloc.Type", Field, 8}, + {"Reloc.VirtualAddress", Field, 8}, + {"Section", Type, 0}, + {"Section.ReaderAt", Field, 0}, + {"Section.Relocs", Field, 8}, + {"Section.SectionHeader", Field, 0}, + {"SectionHeader", Type, 0}, + {"SectionHeader.Characteristics", Field, 0}, + {"SectionHeader.Name", Field, 0}, + {"SectionHeader.NumberOfLineNumbers", Field, 0}, + {"SectionHeader.NumberOfRelocations", Field, 0}, + {"SectionHeader.Offset", Field, 0}, + {"SectionHeader.PointerToLineNumbers", Field, 0}, + {"SectionHeader.PointerToRelocations", Field, 0}, + {"SectionHeader.Size", Field, 0}, + {"SectionHeader.VirtualAddress", Field, 0}, + {"SectionHeader.VirtualSize", Field, 0}, + {"SectionHeader32", Type, 0}, + {"SectionHeader32.Characteristics", Field, 0}, + {"SectionHeader32.Name", Field, 0}, + {"SectionHeader32.NumberOfLineNumbers", Field, 0}, + {"SectionHeader32.NumberOfRelocations", Field, 0}, + {"SectionHeader32.PointerToLineNumbers", Field, 0}, + {"SectionHeader32.PointerToRawData", Field, 0}, + {"SectionHeader32.PointerToRelocations", Field, 0}, + {"SectionHeader32.SizeOfRawData", Field, 0}, + {"SectionHeader32.VirtualAddress", Field, 0}, + {"SectionHeader32.VirtualSize", Field, 0}, + {"StringTable", Type, 8}, + {"Symbol", Type, 1}, + {"Symbol.Name", Field, 1}, + {"Symbol.SectionNumber", Field, 1}, + {"Symbol.StorageClass", Field, 1}, + {"Symbol.Type", Field, 1}, + {"Symbol.Value", Field, 1}, + }, + "debug/plan9obj": { + {"(*File).Close", Method, 3}, + {"(*File).Section", Method, 3}, + {"(*File).Symbols", Method, 3}, + {"(*Section).Data", Method, 3}, + {"(*Section).Open", Method, 3}, + {"(Section).ReadAt", Method, 3}, + {"ErrNoSymbols", Var, 18}, + {"File", Type, 3}, + {"File.FileHeader", Field, 3}, + {"File.Sections", Field, 3}, + {"FileHeader", Type, 3}, + {"FileHeader.Bss", Field, 3}, + {"FileHeader.Entry", Field, 3}, + {"FileHeader.HdrSize", Field, 4}, + {"FileHeader.LoadAddress", Field, 4}, + {"FileHeader.Magic", Field, 3}, + {"FileHeader.PtrSize", Field, 3}, + {"Magic386", Const, 3}, + {"Magic64", Const, 3}, + {"MagicAMD64", Const, 3}, + {"MagicARM", Const, 3}, + {"NewFile", Func, 3}, + {"Open", Func, 3}, + {"Section", Type, 3}, + {"Section.ReaderAt", Field, 3}, + {"Section.SectionHeader", Field, 3}, + {"SectionHeader", Type, 3}, + {"SectionHeader.Name", Field, 3}, + {"SectionHeader.Offset", Field, 3}, + {"SectionHeader.Size", Field, 3}, + {"Sym", Type, 3}, + {"Sym.Name", Field, 3}, + {"Sym.Type", Field, 3}, + {"Sym.Value", Field, 3}, + }, + "embed": { + {"(FS).Open", Method, 16}, + {"(FS).ReadDir", Method, 16}, + {"(FS).ReadFile", Method, 16}, + {"FS", Type, 16}, + }, + "encoding": { + {"BinaryMarshaler", Type, 2}, + {"BinaryUnmarshaler", Type, 2}, + {"TextMarshaler", Type, 2}, + {"TextUnmarshaler", Type, 2}, + }, + "encoding/ascii85": { + {"(CorruptInputError).Error", Method, 0}, + {"CorruptInputError", Type, 0}, + {"Decode", Func, 0}, + {"Encode", Func, 0}, + {"MaxEncodedLen", Func, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + }, + "encoding/asn1": { + {"(BitString).At", Method, 0}, + {"(BitString).RightAlign", Method, 0}, + {"(ObjectIdentifier).Equal", Method, 0}, + {"(ObjectIdentifier).String", Method, 3}, + {"(StructuralError).Error", Method, 0}, + {"(SyntaxError).Error", Method, 0}, + {"BitString", Type, 0}, + {"BitString.BitLength", Field, 0}, + {"BitString.Bytes", Field, 0}, + {"ClassApplication", Const, 6}, + {"ClassContextSpecific", Const, 6}, + {"ClassPrivate", Const, 6}, + {"ClassUniversal", Const, 6}, + {"Enumerated", Type, 0}, + {"Flag", Type, 0}, + {"Marshal", Func, 0}, + {"MarshalWithParams", Func, 10}, + {"NullBytes", Var, 9}, + {"NullRawValue", Var, 9}, + {"ObjectIdentifier", Type, 0}, + {"RawContent", Type, 0}, + {"RawValue", Type, 0}, + {"RawValue.Bytes", Field, 0}, + {"RawValue.Class", Field, 0}, + {"RawValue.FullBytes", Field, 0}, + {"RawValue.IsCompound", Field, 0}, + {"RawValue.Tag", Field, 0}, + {"StructuralError", Type, 0}, + {"StructuralError.Msg", Field, 0}, + {"SyntaxError", Type, 0}, + {"SyntaxError.Msg", Field, 0}, + {"TagBMPString", Const, 14}, + {"TagBitString", Const, 6}, + {"TagBoolean", Const, 6}, + {"TagEnum", Const, 6}, + {"TagGeneralString", Const, 6}, + {"TagGeneralizedTime", Const, 6}, + {"TagIA5String", Const, 6}, + {"TagInteger", Const, 6}, + {"TagNull", Const, 9}, + {"TagNumericString", Const, 10}, + {"TagOID", Const, 6}, + {"TagOctetString", Const, 6}, + {"TagPrintableString", Const, 6}, + {"TagSequence", Const, 6}, + {"TagSet", Const, 6}, + {"TagT61String", Const, 6}, + {"TagUTCTime", Const, 6}, + {"TagUTF8String", Const, 6}, + {"Unmarshal", Func, 0}, + {"UnmarshalWithParams", Func, 0}, + }, + "encoding/base32": { + {"(*Encoding).AppendDecode", Method, 22}, + {"(*Encoding).AppendEncode", Method, 22}, + {"(*Encoding).Decode", Method, 0}, + {"(*Encoding).DecodeString", Method, 0}, + {"(*Encoding).DecodedLen", Method, 0}, + {"(*Encoding).Encode", Method, 0}, + {"(*Encoding).EncodeToString", Method, 0}, + {"(*Encoding).EncodedLen", Method, 0}, + {"(CorruptInputError).Error", Method, 0}, + {"(Encoding).WithPadding", Method, 9}, + {"CorruptInputError", Type, 0}, + {"Encoding", Type, 0}, + {"HexEncoding", Var, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + {"NewEncoding", Func, 0}, + {"NoPadding", Const, 9}, + {"StdEncoding", Var, 0}, + {"StdPadding", Const, 9}, + }, + "encoding/base64": { + {"(*Encoding).AppendDecode", Method, 22}, + {"(*Encoding).AppendEncode", Method, 22}, + {"(*Encoding).Decode", Method, 0}, + {"(*Encoding).DecodeString", Method, 0}, + {"(*Encoding).DecodedLen", Method, 0}, + {"(*Encoding).Encode", Method, 0}, + {"(*Encoding).EncodeToString", Method, 0}, + {"(*Encoding).EncodedLen", Method, 0}, + {"(CorruptInputError).Error", Method, 0}, + {"(Encoding).Strict", Method, 8}, + {"(Encoding).WithPadding", Method, 5}, + {"CorruptInputError", Type, 0}, + {"Encoding", Type, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + {"NewEncoding", Func, 0}, + {"NoPadding", Const, 5}, + {"RawStdEncoding", Var, 5}, + {"RawURLEncoding", Var, 5}, + {"StdEncoding", Var, 0}, + {"StdPadding", Const, 5}, + {"URLEncoding", Var, 0}, + }, + "encoding/binary": { + {"AppendByteOrder", Type, 19}, + {"AppendUvarint", Func, 19}, + {"AppendVarint", Func, 19}, + {"BigEndian", Var, 0}, + {"ByteOrder", Type, 0}, + {"LittleEndian", Var, 0}, + {"MaxVarintLen16", Const, 0}, + {"MaxVarintLen32", Const, 0}, + {"MaxVarintLen64", Const, 0}, + {"NativeEndian", Var, 21}, + {"PutUvarint", Func, 0}, + {"PutVarint", Func, 0}, + {"Read", Func, 0}, + {"ReadUvarint", Func, 0}, + {"ReadVarint", Func, 0}, + {"Size", Func, 0}, + {"Uvarint", Func, 0}, + {"Varint", Func, 0}, + {"Write", Func, 0}, + }, + "encoding/csv": { + {"(*ParseError).Error", Method, 0}, + {"(*ParseError).Unwrap", Method, 13}, + {"(*Reader).FieldPos", Method, 17}, + {"(*Reader).InputOffset", Method, 19}, + {"(*Reader).Read", Method, 0}, + {"(*Reader).ReadAll", Method, 0}, + {"(*Writer).Error", Method, 1}, + {"(*Writer).Flush", Method, 0}, + {"(*Writer).Write", Method, 0}, + {"(*Writer).WriteAll", Method, 0}, + {"ErrBareQuote", Var, 0}, + {"ErrFieldCount", Var, 0}, + {"ErrQuote", Var, 0}, + {"ErrTrailingComma", Var, 0}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"ParseError", Type, 0}, + {"ParseError.Column", Field, 0}, + {"ParseError.Err", Field, 0}, + {"ParseError.Line", Field, 0}, + {"ParseError.StartLine", Field, 10}, + {"Reader", Type, 0}, + {"Reader.Comma", Field, 0}, + {"Reader.Comment", Field, 0}, + {"Reader.FieldsPerRecord", Field, 0}, + {"Reader.LazyQuotes", Field, 0}, + {"Reader.ReuseRecord", Field, 9}, + {"Reader.TrailingComma", Field, 0}, + {"Reader.TrimLeadingSpace", Field, 0}, + {"Writer", Type, 0}, + {"Writer.Comma", Field, 0}, + {"Writer.UseCRLF", Field, 0}, + }, + "encoding/gob": { + {"(*Decoder).Decode", Method, 0}, + {"(*Decoder).DecodeValue", Method, 0}, + {"(*Encoder).Encode", Method, 0}, + {"(*Encoder).EncodeValue", Method, 0}, + {"CommonType", Type, 0}, + {"CommonType.Id", Field, 0}, + {"CommonType.Name", Field, 0}, + {"Decoder", Type, 0}, + {"Encoder", Type, 0}, + {"GobDecoder", Type, 0}, + {"GobEncoder", Type, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + {"Register", Func, 0}, + {"RegisterName", Func, 0}, + }, + "encoding/hex": { + {"(InvalidByteError).Error", Method, 0}, + {"AppendDecode", Func, 22}, + {"AppendEncode", Func, 22}, + {"Decode", Func, 0}, + {"DecodeString", Func, 0}, + {"DecodedLen", Func, 0}, + {"Dump", Func, 0}, + {"Dumper", Func, 0}, + {"Encode", Func, 0}, + {"EncodeToString", Func, 0}, + {"EncodedLen", Func, 0}, + {"ErrLength", Var, 0}, + {"InvalidByteError", Type, 0}, + {"NewDecoder", Func, 10}, + {"NewEncoder", Func, 10}, + }, + "encoding/json": { + {"(*Decoder).Buffered", Method, 1}, + {"(*Decoder).Decode", Method, 0}, + {"(*Decoder).DisallowUnknownFields", Method, 10}, + {"(*Decoder).InputOffset", Method, 14}, + {"(*Decoder).More", Method, 5}, + {"(*Decoder).Token", Method, 5}, + {"(*Decoder).UseNumber", Method, 1}, + {"(*Encoder).Encode", Method, 0}, + {"(*Encoder).SetEscapeHTML", Method, 7}, + {"(*Encoder).SetIndent", Method, 7}, + {"(*InvalidUTF8Error).Error", Method, 0}, + {"(*InvalidUnmarshalError).Error", Method, 0}, + {"(*MarshalerError).Error", Method, 0}, + {"(*MarshalerError).Unwrap", Method, 13}, + {"(*RawMessage).MarshalJSON", Method, 0}, + {"(*RawMessage).UnmarshalJSON", Method, 0}, + {"(*SyntaxError).Error", Method, 0}, + {"(*UnmarshalFieldError).Error", Method, 0}, + {"(*UnmarshalTypeError).Error", Method, 0}, + {"(*UnsupportedTypeError).Error", Method, 0}, + {"(*UnsupportedValueError).Error", Method, 0}, + {"(Delim).String", Method, 5}, + {"(Number).Float64", Method, 1}, + {"(Number).Int64", Method, 1}, + {"(Number).String", Method, 1}, + {"(RawMessage).MarshalJSON", Method, 8}, + {"Compact", Func, 0}, + {"Decoder", Type, 0}, + {"Delim", Type, 5}, + {"Encoder", Type, 0}, + {"HTMLEscape", Func, 0}, + {"Indent", Func, 0}, + {"InvalidUTF8Error", Type, 0}, + {"InvalidUTF8Error.S", Field, 0}, + {"InvalidUnmarshalError", Type, 0}, + {"InvalidUnmarshalError.Type", Field, 0}, + {"Marshal", Func, 0}, + {"MarshalIndent", Func, 0}, + {"Marshaler", Type, 0}, + {"MarshalerError", Type, 0}, + {"MarshalerError.Err", Field, 0}, + {"MarshalerError.Type", Field, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + {"Number", Type, 1}, + {"RawMessage", Type, 0}, + {"SyntaxError", Type, 0}, + {"SyntaxError.Offset", Field, 0}, + {"Token", Type, 5}, + {"Unmarshal", Func, 0}, + {"UnmarshalFieldError", Type, 0}, + {"UnmarshalFieldError.Field", Field, 0}, + {"UnmarshalFieldError.Key", Field, 0}, + {"UnmarshalFieldError.Type", Field, 0}, + {"UnmarshalTypeError", Type, 0}, + {"UnmarshalTypeError.Field", Field, 8}, + {"UnmarshalTypeError.Offset", Field, 5}, + {"UnmarshalTypeError.Struct", Field, 8}, + {"UnmarshalTypeError.Type", Field, 0}, + {"UnmarshalTypeError.Value", Field, 0}, + {"Unmarshaler", Type, 0}, + {"UnsupportedTypeError", Type, 0}, + {"UnsupportedTypeError.Type", Field, 0}, + {"UnsupportedValueError", Type, 0}, + {"UnsupportedValueError.Str", Field, 0}, + {"UnsupportedValueError.Value", Field, 0}, + {"Valid", Func, 9}, + }, + "encoding/pem": { + {"Block", Type, 0}, + {"Block.Bytes", Field, 0}, + {"Block.Headers", Field, 0}, + {"Block.Type", Field, 0}, + {"Decode", Func, 0}, + {"Encode", Func, 0}, + {"EncodeToMemory", Func, 0}, + }, + "encoding/xml": { + {"(*Decoder).Decode", Method, 0}, + {"(*Decoder).DecodeElement", Method, 0}, + {"(*Decoder).InputOffset", Method, 4}, + {"(*Decoder).InputPos", Method, 19}, + {"(*Decoder).RawToken", Method, 0}, + {"(*Decoder).Skip", Method, 0}, + {"(*Decoder).Token", Method, 0}, + {"(*Encoder).Close", Method, 20}, + {"(*Encoder).Encode", Method, 0}, + {"(*Encoder).EncodeElement", Method, 2}, + {"(*Encoder).EncodeToken", Method, 2}, + {"(*Encoder).Flush", Method, 2}, + {"(*Encoder).Indent", Method, 1}, + {"(*SyntaxError).Error", Method, 0}, + {"(*TagPathError).Error", Method, 0}, + {"(*UnsupportedTypeError).Error", Method, 0}, + {"(CharData).Copy", Method, 0}, + {"(Comment).Copy", Method, 0}, + {"(Directive).Copy", Method, 0}, + {"(ProcInst).Copy", Method, 0}, + {"(StartElement).Copy", Method, 0}, + {"(StartElement).End", Method, 2}, + {"(UnmarshalError).Error", Method, 0}, + {"Attr", Type, 0}, + {"Attr.Name", Field, 0}, + {"Attr.Value", Field, 0}, + {"CharData", Type, 0}, + {"Comment", Type, 0}, + {"CopyToken", Func, 0}, + {"Decoder", Type, 0}, + {"Decoder.AutoClose", Field, 0}, + {"Decoder.CharsetReader", Field, 0}, + {"Decoder.DefaultSpace", Field, 1}, + {"Decoder.Entity", Field, 0}, + {"Decoder.Strict", Field, 0}, + {"Directive", Type, 0}, + {"Encoder", Type, 0}, + {"EndElement", Type, 0}, + {"EndElement.Name", Field, 0}, + {"Escape", Func, 0}, + {"EscapeText", Func, 1}, + {"HTMLAutoClose", Var, 0}, + {"HTMLEntity", Var, 0}, + {"Header", Const, 0}, + {"Marshal", Func, 0}, + {"MarshalIndent", Func, 0}, + {"Marshaler", Type, 2}, + {"MarshalerAttr", Type, 2}, + {"Name", Type, 0}, + {"Name.Local", Field, 0}, + {"Name.Space", Field, 0}, + {"NewDecoder", Func, 0}, + {"NewEncoder", Func, 0}, + {"NewTokenDecoder", Func, 10}, + {"ProcInst", Type, 0}, + {"ProcInst.Inst", Field, 0}, + {"ProcInst.Target", Field, 0}, + {"StartElement", Type, 0}, + {"StartElement.Attr", Field, 0}, + {"StartElement.Name", Field, 0}, + {"SyntaxError", Type, 0}, + {"SyntaxError.Line", Field, 0}, + {"SyntaxError.Msg", Field, 0}, + {"TagPathError", Type, 0}, + {"TagPathError.Field1", Field, 0}, + {"TagPathError.Field2", Field, 0}, + {"TagPathError.Struct", Field, 0}, + {"TagPathError.Tag1", Field, 0}, + {"TagPathError.Tag2", Field, 0}, + {"Token", Type, 0}, + {"TokenReader", Type, 10}, + {"Unmarshal", Func, 0}, + {"UnmarshalError", Type, 0}, + {"Unmarshaler", Type, 2}, + {"UnmarshalerAttr", Type, 2}, + {"UnsupportedTypeError", Type, 0}, + {"UnsupportedTypeError.Type", Field, 0}, + }, + "errors": { + {"As", Func, 13}, + {"ErrUnsupported", Var, 21}, + {"Is", Func, 13}, + {"Join", Func, 20}, + {"New", Func, 0}, + {"Unwrap", Func, 13}, + }, + "expvar": { + {"(*Float).Add", Method, 0}, + {"(*Float).Set", Method, 0}, + {"(*Float).String", Method, 0}, + {"(*Float).Value", Method, 8}, + {"(*Int).Add", Method, 0}, + {"(*Int).Set", Method, 0}, + {"(*Int).String", Method, 0}, + {"(*Int).Value", Method, 8}, + {"(*Map).Add", Method, 0}, + {"(*Map).AddFloat", Method, 0}, + {"(*Map).Delete", Method, 12}, + {"(*Map).Do", Method, 0}, + {"(*Map).Get", Method, 0}, + {"(*Map).Init", Method, 0}, + {"(*Map).Set", Method, 0}, + {"(*Map).String", Method, 0}, + {"(*String).Set", Method, 0}, + {"(*String).String", Method, 0}, + {"(*String).Value", Method, 8}, + {"(Func).String", Method, 0}, + {"(Func).Value", Method, 8}, + {"Do", Func, 0}, + {"Float", Type, 0}, + {"Func", Type, 0}, + {"Get", Func, 0}, + {"Handler", Func, 8}, + {"Int", Type, 0}, + {"KeyValue", Type, 0}, + {"KeyValue.Key", Field, 0}, + {"KeyValue.Value", Field, 0}, + {"Map", Type, 0}, + {"NewFloat", Func, 0}, + {"NewInt", Func, 0}, + {"NewMap", Func, 0}, + {"NewString", Func, 0}, + {"Publish", Func, 0}, + {"String", Type, 0}, + {"Var", Type, 0}, + }, + "flag": { + {"(*FlagSet).Arg", Method, 0}, + {"(*FlagSet).Args", Method, 0}, + {"(*FlagSet).Bool", Method, 0}, + {"(*FlagSet).BoolFunc", Method, 21}, + {"(*FlagSet).BoolVar", Method, 0}, + {"(*FlagSet).Duration", Method, 0}, + {"(*FlagSet).DurationVar", Method, 0}, + {"(*FlagSet).ErrorHandling", Method, 10}, + {"(*FlagSet).Float64", Method, 0}, + {"(*FlagSet).Float64Var", Method, 0}, + {"(*FlagSet).Func", Method, 16}, + {"(*FlagSet).Init", Method, 0}, + {"(*FlagSet).Int", Method, 0}, + {"(*FlagSet).Int64", Method, 0}, + {"(*FlagSet).Int64Var", Method, 0}, + {"(*FlagSet).IntVar", Method, 0}, + {"(*FlagSet).Lookup", Method, 0}, + {"(*FlagSet).NArg", Method, 0}, + {"(*FlagSet).NFlag", Method, 0}, + {"(*FlagSet).Name", Method, 10}, + {"(*FlagSet).Output", Method, 10}, + {"(*FlagSet).Parse", Method, 0}, + {"(*FlagSet).Parsed", Method, 0}, + {"(*FlagSet).PrintDefaults", Method, 0}, + {"(*FlagSet).Set", Method, 0}, + {"(*FlagSet).SetOutput", Method, 0}, + {"(*FlagSet).String", Method, 0}, + {"(*FlagSet).StringVar", Method, 0}, + {"(*FlagSet).TextVar", Method, 19}, + {"(*FlagSet).Uint", Method, 0}, + {"(*FlagSet).Uint64", Method, 0}, + {"(*FlagSet).Uint64Var", Method, 0}, + {"(*FlagSet).UintVar", Method, 0}, + {"(*FlagSet).Var", Method, 0}, + {"(*FlagSet).Visit", Method, 0}, + {"(*FlagSet).VisitAll", Method, 0}, + {"Arg", Func, 0}, + {"Args", Func, 0}, + {"Bool", Func, 0}, + {"BoolFunc", Func, 21}, + {"BoolVar", Func, 0}, + {"CommandLine", Var, 2}, + {"ContinueOnError", Const, 0}, + {"Duration", Func, 0}, + {"DurationVar", Func, 0}, + {"ErrHelp", Var, 0}, + {"ErrorHandling", Type, 0}, + {"ExitOnError", Const, 0}, + {"Flag", Type, 0}, + {"Flag.DefValue", Field, 0}, + {"Flag.Name", Field, 0}, + {"Flag.Usage", Field, 0}, + {"Flag.Value", Field, 0}, + {"FlagSet", Type, 0}, + {"FlagSet.Usage", Field, 0}, + {"Float64", Func, 0}, + {"Float64Var", Func, 0}, + {"Func", Func, 16}, + {"Getter", Type, 2}, + {"Int", Func, 0}, + {"Int64", Func, 0}, + {"Int64Var", Func, 0}, + {"IntVar", Func, 0}, + {"Lookup", Func, 0}, + {"NArg", Func, 0}, + {"NFlag", Func, 0}, + {"NewFlagSet", Func, 0}, + {"PanicOnError", Const, 0}, + {"Parse", Func, 0}, + {"Parsed", Func, 0}, + {"PrintDefaults", Func, 0}, + {"Set", Func, 0}, + {"String", Func, 0}, + {"StringVar", Func, 0}, + {"TextVar", Func, 19}, + {"Uint", Func, 0}, + {"Uint64", Func, 0}, + {"Uint64Var", Func, 0}, + {"UintVar", Func, 0}, + {"UnquoteUsage", Func, 5}, + {"Usage", Var, 0}, + {"Value", Type, 0}, + {"Var", Func, 0}, + {"Visit", Func, 0}, + {"VisitAll", Func, 0}, + }, + "fmt": { + {"Append", Func, 19}, + {"Appendf", Func, 19}, + {"Appendln", Func, 19}, + {"Errorf", Func, 0}, + {"FormatString", Func, 20}, + {"Formatter", Type, 0}, + {"Fprint", Func, 0}, + {"Fprintf", Func, 0}, + {"Fprintln", Func, 0}, + {"Fscan", Func, 0}, + {"Fscanf", Func, 0}, + {"Fscanln", Func, 0}, + {"GoStringer", Type, 0}, + {"Print", Func, 0}, + {"Printf", Func, 0}, + {"Println", Func, 0}, + {"Scan", Func, 0}, + {"ScanState", Type, 0}, + {"Scanf", Func, 0}, + {"Scanln", Func, 0}, + {"Scanner", Type, 0}, + {"Sprint", Func, 0}, + {"Sprintf", Func, 0}, + {"Sprintln", Func, 0}, + {"Sscan", Func, 0}, + {"Sscanf", Func, 0}, + {"Sscanln", Func, 0}, + {"State", Type, 0}, + {"Stringer", Type, 0}, + }, + "go/ast": { + {"(*ArrayType).End", Method, 0}, + {"(*ArrayType).Pos", Method, 0}, + {"(*AssignStmt).End", Method, 0}, + {"(*AssignStmt).Pos", Method, 0}, + {"(*BadDecl).End", Method, 0}, + {"(*BadDecl).Pos", Method, 0}, + {"(*BadExpr).End", Method, 0}, + {"(*BadExpr).Pos", Method, 0}, + {"(*BadStmt).End", Method, 0}, + {"(*BadStmt).Pos", Method, 0}, + {"(*BasicLit).End", Method, 0}, + {"(*BasicLit).Pos", Method, 0}, + {"(*BinaryExpr).End", Method, 0}, + {"(*BinaryExpr).Pos", Method, 0}, + {"(*BlockStmt).End", Method, 0}, + {"(*BlockStmt).Pos", Method, 0}, + {"(*BranchStmt).End", Method, 0}, + {"(*BranchStmt).Pos", Method, 0}, + {"(*CallExpr).End", Method, 0}, + {"(*CallExpr).Pos", Method, 0}, + {"(*CaseClause).End", Method, 0}, + {"(*CaseClause).Pos", Method, 0}, + {"(*ChanType).End", Method, 0}, + {"(*ChanType).Pos", Method, 0}, + {"(*CommClause).End", Method, 0}, + {"(*CommClause).Pos", Method, 0}, + {"(*Comment).End", Method, 0}, + {"(*Comment).Pos", Method, 0}, + {"(*CommentGroup).End", Method, 0}, + {"(*CommentGroup).Pos", Method, 0}, + {"(*CommentGroup).Text", Method, 0}, + {"(*CompositeLit).End", Method, 0}, + {"(*CompositeLit).Pos", Method, 0}, + {"(*DeclStmt).End", Method, 0}, + {"(*DeclStmt).Pos", Method, 0}, + {"(*DeferStmt).End", Method, 0}, + {"(*DeferStmt).Pos", Method, 0}, + {"(*Ellipsis).End", Method, 0}, + {"(*Ellipsis).Pos", Method, 0}, + {"(*EmptyStmt).End", Method, 0}, + {"(*EmptyStmt).Pos", Method, 0}, + {"(*ExprStmt).End", Method, 0}, + {"(*ExprStmt).Pos", Method, 0}, + {"(*Field).End", Method, 0}, + {"(*Field).Pos", Method, 0}, + {"(*FieldList).End", Method, 0}, + {"(*FieldList).NumFields", Method, 0}, + {"(*FieldList).Pos", Method, 0}, + {"(*File).End", Method, 0}, + {"(*File).Pos", Method, 0}, + {"(*ForStmt).End", Method, 0}, + {"(*ForStmt).Pos", Method, 0}, + {"(*FuncDecl).End", Method, 0}, + {"(*FuncDecl).Pos", Method, 0}, + {"(*FuncLit).End", Method, 0}, + {"(*FuncLit).Pos", Method, 0}, + {"(*FuncType).End", Method, 0}, + {"(*FuncType).Pos", Method, 0}, + {"(*GenDecl).End", Method, 0}, + {"(*GenDecl).Pos", Method, 0}, + {"(*GoStmt).End", Method, 0}, + {"(*GoStmt).Pos", Method, 0}, + {"(*Ident).End", Method, 0}, + {"(*Ident).IsExported", Method, 0}, + {"(*Ident).Pos", Method, 0}, + {"(*Ident).String", Method, 0}, + {"(*IfStmt).End", Method, 0}, + {"(*IfStmt).Pos", Method, 0}, + {"(*ImportSpec).End", Method, 0}, + {"(*ImportSpec).Pos", Method, 0}, + {"(*IncDecStmt).End", Method, 0}, + {"(*IncDecStmt).Pos", Method, 0}, + {"(*IndexExpr).End", Method, 0}, + {"(*IndexExpr).Pos", Method, 0}, + {"(*IndexListExpr).End", Method, 18}, + {"(*IndexListExpr).Pos", Method, 18}, + {"(*InterfaceType).End", Method, 0}, + {"(*InterfaceType).Pos", Method, 0}, + {"(*KeyValueExpr).End", Method, 0}, + {"(*KeyValueExpr).Pos", Method, 0}, + {"(*LabeledStmt).End", Method, 0}, + {"(*LabeledStmt).Pos", Method, 0}, + {"(*MapType).End", Method, 0}, + {"(*MapType).Pos", Method, 0}, + {"(*Object).Pos", Method, 0}, + {"(*Package).End", Method, 0}, + {"(*Package).Pos", Method, 0}, + {"(*ParenExpr).End", Method, 0}, + {"(*ParenExpr).Pos", Method, 0}, + {"(*RangeStmt).End", Method, 0}, + {"(*RangeStmt).Pos", Method, 0}, + {"(*ReturnStmt).End", Method, 0}, + {"(*ReturnStmt).Pos", Method, 0}, + {"(*Scope).Insert", Method, 0}, + {"(*Scope).Lookup", Method, 0}, + {"(*Scope).String", Method, 0}, + {"(*SelectStmt).End", Method, 0}, + {"(*SelectStmt).Pos", Method, 0}, + {"(*SelectorExpr).End", Method, 0}, + {"(*SelectorExpr).Pos", Method, 0}, + {"(*SendStmt).End", Method, 0}, + {"(*SendStmt).Pos", Method, 0}, + {"(*SliceExpr).End", Method, 0}, + {"(*SliceExpr).Pos", Method, 0}, + {"(*StarExpr).End", Method, 0}, + {"(*StarExpr).Pos", Method, 0}, + {"(*StructType).End", Method, 0}, + {"(*StructType).Pos", Method, 0}, + {"(*SwitchStmt).End", Method, 0}, + {"(*SwitchStmt).Pos", Method, 0}, + {"(*TypeAssertExpr).End", Method, 0}, + {"(*TypeAssertExpr).Pos", Method, 0}, + {"(*TypeSpec).End", Method, 0}, + {"(*TypeSpec).Pos", Method, 0}, + {"(*TypeSwitchStmt).End", Method, 0}, + {"(*TypeSwitchStmt).Pos", Method, 0}, + {"(*UnaryExpr).End", Method, 0}, + {"(*UnaryExpr).Pos", Method, 0}, + {"(*ValueSpec).End", Method, 0}, + {"(*ValueSpec).Pos", Method, 0}, + {"(CommentMap).Comments", Method, 1}, + {"(CommentMap).Filter", Method, 1}, + {"(CommentMap).String", Method, 1}, + {"(CommentMap).Update", Method, 1}, + {"(ObjKind).String", Method, 0}, + {"ArrayType", Type, 0}, + {"ArrayType.Elt", Field, 0}, + {"ArrayType.Lbrack", Field, 0}, + {"ArrayType.Len", Field, 0}, + {"AssignStmt", Type, 0}, + {"AssignStmt.Lhs", Field, 0}, + {"AssignStmt.Rhs", Field, 0}, + {"AssignStmt.Tok", Field, 0}, + {"AssignStmt.TokPos", Field, 0}, + {"Bad", Const, 0}, + {"BadDecl", Type, 0}, + {"BadDecl.From", Field, 0}, + {"BadDecl.To", Field, 0}, + {"BadExpr", Type, 0}, + {"BadExpr.From", Field, 0}, + {"BadExpr.To", Field, 0}, + {"BadStmt", Type, 0}, + {"BadStmt.From", Field, 0}, + {"BadStmt.To", Field, 0}, + {"BasicLit", Type, 0}, + {"BasicLit.Kind", Field, 0}, + {"BasicLit.Value", Field, 0}, + {"BasicLit.ValuePos", Field, 0}, + {"BinaryExpr", Type, 0}, + {"BinaryExpr.Op", Field, 0}, + {"BinaryExpr.OpPos", Field, 0}, + {"BinaryExpr.X", Field, 0}, + {"BinaryExpr.Y", Field, 0}, + {"BlockStmt", Type, 0}, + {"BlockStmt.Lbrace", Field, 0}, + {"BlockStmt.List", Field, 0}, + {"BlockStmt.Rbrace", Field, 0}, + {"BranchStmt", Type, 0}, + {"BranchStmt.Label", Field, 0}, + {"BranchStmt.Tok", Field, 0}, + {"BranchStmt.TokPos", Field, 0}, + {"CallExpr", Type, 0}, + {"CallExpr.Args", Field, 0}, + {"CallExpr.Ellipsis", Field, 0}, + {"CallExpr.Fun", Field, 0}, + {"CallExpr.Lparen", Field, 0}, + {"CallExpr.Rparen", Field, 0}, + {"CaseClause", Type, 0}, + {"CaseClause.Body", Field, 0}, + {"CaseClause.Case", Field, 0}, + {"CaseClause.Colon", Field, 0}, + {"CaseClause.List", Field, 0}, + {"ChanDir", Type, 0}, + {"ChanType", Type, 0}, + {"ChanType.Arrow", Field, 1}, + {"ChanType.Begin", Field, 0}, + {"ChanType.Dir", Field, 0}, + {"ChanType.Value", Field, 0}, + {"CommClause", Type, 0}, + {"CommClause.Body", Field, 0}, + {"CommClause.Case", Field, 0}, + {"CommClause.Colon", Field, 0}, + {"CommClause.Comm", Field, 0}, + {"Comment", Type, 0}, + {"Comment.Slash", Field, 0}, + {"Comment.Text", Field, 0}, + {"CommentGroup", Type, 0}, + {"CommentGroup.List", Field, 0}, + {"CommentMap", Type, 1}, + {"CompositeLit", Type, 0}, + {"CompositeLit.Elts", Field, 0}, + {"CompositeLit.Incomplete", Field, 11}, + {"CompositeLit.Lbrace", Field, 0}, + {"CompositeLit.Rbrace", Field, 0}, + {"CompositeLit.Type", Field, 0}, + {"Con", Const, 0}, + {"Decl", Type, 0}, + {"DeclStmt", Type, 0}, + {"DeclStmt.Decl", Field, 0}, + {"DeferStmt", Type, 0}, + {"DeferStmt.Call", Field, 0}, + {"DeferStmt.Defer", Field, 0}, + {"Ellipsis", Type, 0}, + {"Ellipsis.Ellipsis", Field, 0}, + {"Ellipsis.Elt", Field, 0}, + {"EmptyStmt", Type, 0}, + {"EmptyStmt.Implicit", Field, 5}, + {"EmptyStmt.Semicolon", Field, 0}, + {"Expr", Type, 0}, + {"ExprStmt", Type, 0}, + {"ExprStmt.X", Field, 0}, + {"Field", Type, 0}, + {"Field.Comment", Field, 0}, + {"Field.Doc", Field, 0}, + {"Field.Names", Field, 0}, + {"Field.Tag", Field, 0}, + {"Field.Type", Field, 0}, + {"FieldFilter", Type, 0}, + {"FieldList", Type, 0}, + {"FieldList.Closing", Field, 0}, + {"FieldList.List", Field, 0}, + {"FieldList.Opening", Field, 0}, + {"File", Type, 0}, + {"File.Comments", Field, 0}, + {"File.Decls", Field, 0}, + {"File.Doc", Field, 0}, + {"File.FileEnd", Field, 20}, + {"File.FileStart", Field, 20}, + {"File.GoVersion", Field, 21}, + {"File.Imports", Field, 0}, + {"File.Name", Field, 0}, + {"File.Package", Field, 0}, + {"File.Scope", Field, 0}, + {"File.Unresolved", Field, 0}, + {"FileExports", Func, 0}, + {"Filter", Type, 0}, + {"FilterDecl", Func, 0}, + {"FilterFile", Func, 0}, + {"FilterFuncDuplicates", Const, 0}, + {"FilterImportDuplicates", Const, 0}, + {"FilterPackage", Func, 0}, + {"FilterUnassociatedComments", Const, 0}, + {"ForStmt", Type, 0}, + {"ForStmt.Body", Field, 0}, + {"ForStmt.Cond", Field, 0}, + {"ForStmt.For", Field, 0}, + {"ForStmt.Init", Field, 0}, + {"ForStmt.Post", Field, 0}, + {"Fprint", Func, 0}, + {"Fun", Const, 0}, + {"FuncDecl", Type, 0}, + {"FuncDecl.Body", Field, 0}, + {"FuncDecl.Doc", Field, 0}, + {"FuncDecl.Name", Field, 0}, + {"FuncDecl.Recv", Field, 0}, + {"FuncDecl.Type", Field, 0}, + {"FuncLit", Type, 0}, + {"FuncLit.Body", Field, 0}, + {"FuncLit.Type", Field, 0}, + {"FuncType", Type, 0}, + {"FuncType.Func", Field, 0}, + {"FuncType.Params", Field, 0}, + {"FuncType.Results", Field, 0}, + {"FuncType.TypeParams", Field, 18}, + {"GenDecl", Type, 0}, + {"GenDecl.Doc", Field, 0}, + {"GenDecl.Lparen", Field, 0}, + {"GenDecl.Rparen", Field, 0}, + {"GenDecl.Specs", Field, 0}, + {"GenDecl.Tok", Field, 0}, + {"GenDecl.TokPos", Field, 0}, + {"GoStmt", Type, 0}, + {"GoStmt.Call", Field, 0}, + {"GoStmt.Go", Field, 0}, + {"Ident", Type, 0}, + {"Ident.Name", Field, 0}, + {"Ident.NamePos", Field, 0}, + {"Ident.Obj", Field, 0}, + {"IfStmt", Type, 0}, + {"IfStmt.Body", Field, 0}, + {"IfStmt.Cond", Field, 0}, + {"IfStmt.Else", Field, 0}, + {"IfStmt.If", Field, 0}, + {"IfStmt.Init", Field, 0}, + {"ImportSpec", Type, 0}, + {"ImportSpec.Comment", Field, 0}, + {"ImportSpec.Doc", Field, 0}, + {"ImportSpec.EndPos", Field, 0}, + {"ImportSpec.Name", Field, 0}, + {"ImportSpec.Path", Field, 0}, + {"Importer", Type, 0}, + {"IncDecStmt", Type, 0}, + {"IncDecStmt.Tok", Field, 0}, + {"IncDecStmt.TokPos", Field, 0}, + {"IncDecStmt.X", Field, 0}, + {"IndexExpr", Type, 0}, + {"IndexExpr.Index", Field, 0}, + {"IndexExpr.Lbrack", Field, 0}, + {"IndexExpr.Rbrack", Field, 0}, + {"IndexExpr.X", Field, 0}, + {"IndexListExpr", Type, 18}, + {"IndexListExpr.Indices", Field, 18}, + {"IndexListExpr.Lbrack", Field, 18}, + {"IndexListExpr.Rbrack", Field, 18}, + {"IndexListExpr.X", Field, 18}, + {"Inspect", Func, 0}, + {"InterfaceType", Type, 0}, + {"InterfaceType.Incomplete", Field, 0}, + {"InterfaceType.Interface", Field, 0}, + {"InterfaceType.Methods", Field, 0}, + {"IsExported", Func, 0}, + {"IsGenerated", Func, 21}, + {"KeyValueExpr", Type, 0}, + {"KeyValueExpr.Colon", Field, 0}, + {"KeyValueExpr.Key", Field, 0}, + {"KeyValueExpr.Value", Field, 0}, + {"LabeledStmt", Type, 0}, + {"LabeledStmt.Colon", Field, 0}, + {"LabeledStmt.Label", Field, 0}, + {"LabeledStmt.Stmt", Field, 0}, + {"Lbl", Const, 0}, + {"MapType", Type, 0}, + {"MapType.Key", Field, 0}, + {"MapType.Map", Field, 0}, + {"MapType.Value", Field, 0}, + {"MergeMode", Type, 0}, + {"MergePackageFiles", Func, 0}, + {"NewCommentMap", Func, 1}, + {"NewIdent", Func, 0}, + {"NewObj", Func, 0}, + {"NewPackage", Func, 0}, + {"NewScope", Func, 0}, + {"Node", Type, 0}, + {"NotNilFilter", Func, 0}, + {"ObjKind", Type, 0}, + {"Object", Type, 0}, + {"Object.Data", Field, 0}, + {"Object.Decl", Field, 0}, + {"Object.Kind", Field, 0}, + {"Object.Name", Field, 0}, + {"Object.Type", Field, 0}, + {"Package", Type, 0}, + {"Package.Files", Field, 0}, + {"Package.Imports", Field, 0}, + {"Package.Name", Field, 0}, + {"Package.Scope", Field, 0}, + {"PackageExports", Func, 0}, + {"ParenExpr", Type, 0}, + {"ParenExpr.Lparen", Field, 0}, + {"ParenExpr.Rparen", Field, 0}, + {"ParenExpr.X", Field, 0}, + {"Pkg", Const, 0}, + {"Print", Func, 0}, + {"RECV", Const, 0}, + {"RangeStmt", Type, 0}, + {"RangeStmt.Body", Field, 0}, + {"RangeStmt.For", Field, 0}, + {"RangeStmt.Key", Field, 0}, + {"RangeStmt.Range", Field, 20}, + {"RangeStmt.Tok", Field, 0}, + {"RangeStmt.TokPos", Field, 0}, + {"RangeStmt.Value", Field, 0}, + {"RangeStmt.X", Field, 0}, + {"ReturnStmt", Type, 0}, + {"ReturnStmt.Results", Field, 0}, + {"ReturnStmt.Return", Field, 0}, + {"SEND", Const, 0}, + {"Scope", Type, 0}, + {"Scope.Objects", Field, 0}, + {"Scope.Outer", Field, 0}, + {"SelectStmt", Type, 0}, + {"SelectStmt.Body", Field, 0}, + {"SelectStmt.Select", Field, 0}, + {"SelectorExpr", Type, 0}, + {"SelectorExpr.Sel", Field, 0}, + {"SelectorExpr.X", Field, 0}, + {"SendStmt", Type, 0}, + {"SendStmt.Arrow", Field, 0}, + {"SendStmt.Chan", Field, 0}, + {"SendStmt.Value", Field, 0}, + {"SliceExpr", Type, 0}, + {"SliceExpr.High", Field, 0}, + {"SliceExpr.Lbrack", Field, 0}, + {"SliceExpr.Low", Field, 0}, + {"SliceExpr.Max", Field, 2}, + {"SliceExpr.Rbrack", Field, 0}, + {"SliceExpr.Slice3", Field, 2}, + {"SliceExpr.X", Field, 0}, + {"SortImports", Func, 0}, + {"Spec", Type, 0}, + {"StarExpr", Type, 0}, + {"StarExpr.Star", Field, 0}, + {"StarExpr.X", Field, 0}, + {"Stmt", Type, 0}, + {"StructType", Type, 0}, + {"StructType.Fields", Field, 0}, + {"StructType.Incomplete", Field, 0}, + {"StructType.Struct", Field, 0}, + {"SwitchStmt", Type, 0}, + {"SwitchStmt.Body", Field, 0}, + {"SwitchStmt.Init", Field, 0}, + {"SwitchStmt.Switch", Field, 0}, + {"SwitchStmt.Tag", Field, 0}, + {"Typ", Const, 0}, + {"TypeAssertExpr", Type, 0}, + {"TypeAssertExpr.Lparen", Field, 2}, + {"TypeAssertExpr.Rparen", Field, 2}, + {"TypeAssertExpr.Type", Field, 0}, + {"TypeAssertExpr.X", Field, 0}, + {"TypeSpec", Type, 0}, + {"TypeSpec.Assign", Field, 9}, + {"TypeSpec.Comment", Field, 0}, + {"TypeSpec.Doc", Field, 0}, + {"TypeSpec.Name", Field, 0}, + {"TypeSpec.Type", Field, 0}, + {"TypeSpec.TypeParams", Field, 18}, + {"TypeSwitchStmt", Type, 0}, + {"TypeSwitchStmt.Assign", Field, 0}, + {"TypeSwitchStmt.Body", Field, 0}, + {"TypeSwitchStmt.Init", Field, 0}, + {"TypeSwitchStmt.Switch", Field, 0}, + {"UnaryExpr", Type, 0}, + {"UnaryExpr.Op", Field, 0}, + {"UnaryExpr.OpPos", Field, 0}, + {"UnaryExpr.X", Field, 0}, + {"Unparen", Func, 22}, + {"ValueSpec", Type, 0}, + {"ValueSpec.Comment", Field, 0}, + {"ValueSpec.Doc", Field, 0}, + {"ValueSpec.Names", Field, 0}, + {"ValueSpec.Type", Field, 0}, + {"ValueSpec.Values", Field, 0}, + {"Var", Const, 0}, + {"Visitor", Type, 0}, + {"Walk", Func, 0}, + }, + "go/build": { + {"(*Context).Import", Method, 0}, + {"(*Context).ImportDir", Method, 0}, + {"(*Context).MatchFile", Method, 2}, + {"(*Context).SrcDirs", Method, 0}, + {"(*MultiplePackageError).Error", Method, 4}, + {"(*NoGoError).Error", Method, 0}, + {"(*Package).IsCommand", Method, 0}, + {"AllowBinary", Const, 0}, + {"ArchChar", Func, 0}, + {"Context", Type, 0}, + {"Context.BuildTags", Field, 0}, + {"Context.CgoEnabled", Field, 0}, + {"Context.Compiler", Field, 0}, + {"Context.Dir", Field, 14}, + {"Context.GOARCH", Field, 0}, + {"Context.GOOS", Field, 0}, + {"Context.GOPATH", Field, 0}, + {"Context.GOROOT", Field, 0}, + {"Context.HasSubdir", Field, 0}, + {"Context.InstallSuffix", Field, 1}, + {"Context.IsAbsPath", Field, 0}, + {"Context.IsDir", Field, 0}, + {"Context.JoinPath", Field, 0}, + {"Context.OpenFile", Field, 0}, + {"Context.ReadDir", Field, 0}, + {"Context.ReleaseTags", Field, 1}, + {"Context.SplitPathList", Field, 0}, + {"Context.ToolTags", Field, 17}, + {"Context.UseAllFiles", Field, 0}, + {"Default", Var, 0}, + {"Directive", Type, 21}, + {"Directive.Pos", Field, 21}, + {"Directive.Text", Field, 21}, + {"FindOnly", Const, 0}, + {"IgnoreVendor", Const, 6}, + {"Import", Func, 0}, + {"ImportComment", Const, 4}, + {"ImportDir", Func, 0}, + {"ImportMode", Type, 0}, + {"IsLocalImport", Func, 0}, + {"MultiplePackageError", Type, 4}, + {"MultiplePackageError.Dir", Field, 4}, + {"MultiplePackageError.Files", Field, 4}, + {"MultiplePackageError.Packages", Field, 4}, + {"NoGoError", Type, 0}, + {"NoGoError.Dir", Field, 0}, + {"Package", Type, 0}, + {"Package.AllTags", Field, 2}, + {"Package.BinDir", Field, 0}, + {"Package.BinaryOnly", Field, 7}, + {"Package.CFiles", Field, 0}, + {"Package.CXXFiles", Field, 2}, + {"Package.CgoCFLAGS", Field, 0}, + {"Package.CgoCPPFLAGS", Field, 2}, + {"Package.CgoCXXFLAGS", Field, 2}, + {"Package.CgoFFLAGS", Field, 7}, + {"Package.CgoFiles", Field, 0}, + {"Package.CgoLDFLAGS", Field, 0}, + {"Package.CgoPkgConfig", Field, 0}, + {"Package.ConflictDir", Field, 2}, + {"Package.Dir", Field, 0}, + {"Package.Directives", Field, 21}, + {"Package.Doc", Field, 0}, + {"Package.EmbedPatternPos", Field, 16}, + {"Package.EmbedPatterns", Field, 16}, + {"Package.FFiles", Field, 7}, + {"Package.GoFiles", Field, 0}, + {"Package.Goroot", Field, 0}, + {"Package.HFiles", Field, 0}, + {"Package.IgnoredGoFiles", Field, 1}, + {"Package.IgnoredOtherFiles", Field, 16}, + {"Package.ImportComment", Field, 4}, + {"Package.ImportPath", Field, 0}, + {"Package.ImportPos", Field, 0}, + {"Package.Imports", Field, 0}, + {"Package.InvalidGoFiles", Field, 6}, + {"Package.MFiles", Field, 3}, + {"Package.Name", Field, 0}, + {"Package.PkgObj", Field, 0}, + {"Package.PkgRoot", Field, 0}, + {"Package.PkgTargetRoot", Field, 5}, + {"Package.Root", Field, 0}, + {"Package.SFiles", Field, 0}, + {"Package.SrcRoot", Field, 0}, + {"Package.SwigCXXFiles", Field, 1}, + {"Package.SwigFiles", Field, 1}, + {"Package.SysoFiles", Field, 0}, + {"Package.TestDirectives", Field, 21}, + {"Package.TestEmbedPatternPos", Field, 16}, + {"Package.TestEmbedPatterns", Field, 16}, + {"Package.TestGoFiles", Field, 0}, + {"Package.TestImportPos", Field, 0}, + {"Package.TestImports", Field, 0}, + {"Package.XTestDirectives", Field, 21}, + {"Package.XTestEmbedPatternPos", Field, 16}, + {"Package.XTestEmbedPatterns", Field, 16}, + {"Package.XTestGoFiles", Field, 0}, + {"Package.XTestImportPos", Field, 0}, + {"Package.XTestImports", Field, 0}, + {"ToolDir", Var, 0}, + }, + "go/build/constraint": { + {"(*AndExpr).Eval", Method, 16}, + {"(*AndExpr).String", Method, 16}, + {"(*NotExpr).Eval", Method, 16}, + {"(*NotExpr).String", Method, 16}, + {"(*OrExpr).Eval", Method, 16}, + {"(*OrExpr).String", Method, 16}, + {"(*SyntaxError).Error", Method, 16}, + {"(*TagExpr).Eval", Method, 16}, + {"(*TagExpr).String", Method, 16}, + {"AndExpr", Type, 16}, + {"AndExpr.X", Field, 16}, + {"AndExpr.Y", Field, 16}, + {"Expr", Type, 16}, + {"GoVersion", Func, 21}, + {"IsGoBuild", Func, 16}, + {"IsPlusBuild", Func, 16}, + {"NotExpr", Type, 16}, + {"NotExpr.X", Field, 16}, + {"OrExpr", Type, 16}, + {"OrExpr.X", Field, 16}, + {"OrExpr.Y", Field, 16}, + {"Parse", Func, 16}, + {"PlusBuildLines", Func, 16}, + {"SyntaxError", Type, 16}, + {"SyntaxError.Err", Field, 16}, + {"SyntaxError.Offset", Field, 16}, + {"TagExpr", Type, 16}, + {"TagExpr.Tag", Field, 16}, + }, + "go/constant": { + {"(Kind).String", Method, 18}, + {"BinaryOp", Func, 5}, + {"BitLen", Func, 5}, + {"Bool", Const, 5}, + {"BoolVal", Func, 5}, + {"Bytes", Func, 5}, + {"Compare", Func, 5}, + {"Complex", Const, 5}, + {"Denom", Func, 5}, + {"Float", Const, 5}, + {"Float32Val", Func, 5}, + {"Float64Val", Func, 5}, + {"Imag", Func, 5}, + {"Int", Const, 5}, + {"Int64Val", Func, 5}, + {"Kind", Type, 5}, + {"Make", Func, 13}, + {"MakeBool", Func, 5}, + {"MakeFloat64", Func, 5}, + {"MakeFromBytes", Func, 5}, + {"MakeFromLiteral", Func, 5}, + {"MakeImag", Func, 5}, + {"MakeInt64", Func, 5}, + {"MakeString", Func, 5}, + {"MakeUint64", Func, 5}, + {"MakeUnknown", Func, 5}, + {"Num", Func, 5}, + {"Real", Func, 5}, + {"Shift", Func, 5}, + {"Sign", Func, 5}, + {"String", Const, 5}, + {"StringVal", Func, 5}, + {"ToComplex", Func, 6}, + {"ToFloat", Func, 6}, + {"ToInt", Func, 6}, + {"Uint64Val", Func, 5}, + {"UnaryOp", Func, 5}, + {"Unknown", Const, 5}, + {"Val", Func, 13}, + {"Value", Type, 5}, + }, + "go/doc": { + {"(*Package).Filter", Method, 0}, + {"(*Package).HTML", Method, 19}, + {"(*Package).Markdown", Method, 19}, + {"(*Package).Parser", Method, 19}, + {"(*Package).Printer", Method, 19}, + {"(*Package).Synopsis", Method, 19}, + {"(*Package).Text", Method, 19}, + {"AllDecls", Const, 0}, + {"AllMethods", Const, 0}, + {"Example", Type, 0}, + {"Example.Code", Field, 0}, + {"Example.Comments", Field, 0}, + {"Example.Doc", Field, 0}, + {"Example.EmptyOutput", Field, 1}, + {"Example.Name", Field, 0}, + {"Example.Order", Field, 1}, + {"Example.Output", Field, 0}, + {"Example.Play", Field, 1}, + {"Example.Suffix", Field, 14}, + {"Example.Unordered", Field, 7}, + {"Examples", Func, 0}, + {"Filter", Type, 0}, + {"Func", Type, 0}, + {"Func.Decl", Field, 0}, + {"Func.Doc", Field, 0}, + {"Func.Examples", Field, 14}, + {"Func.Level", Field, 0}, + {"Func.Name", Field, 0}, + {"Func.Orig", Field, 0}, + {"Func.Recv", Field, 0}, + {"IllegalPrefixes", Var, 1}, + {"IsPredeclared", Func, 8}, + {"Mode", Type, 0}, + {"New", Func, 0}, + {"NewFromFiles", Func, 14}, + {"Note", Type, 1}, + {"Note.Body", Field, 1}, + {"Note.End", Field, 1}, + {"Note.Pos", Field, 1}, + {"Note.UID", Field, 1}, + {"Package", Type, 0}, + {"Package.Bugs", Field, 0}, + {"Package.Consts", Field, 0}, + {"Package.Doc", Field, 0}, + {"Package.Examples", Field, 14}, + {"Package.Filenames", Field, 0}, + {"Package.Funcs", Field, 0}, + {"Package.ImportPath", Field, 0}, + {"Package.Imports", Field, 0}, + {"Package.Name", Field, 0}, + {"Package.Notes", Field, 1}, + {"Package.Types", Field, 0}, + {"Package.Vars", Field, 0}, + {"PreserveAST", Const, 12}, + {"Synopsis", Func, 0}, + {"ToHTML", Func, 0}, + {"ToText", Func, 0}, + {"Type", Type, 0}, + {"Type.Consts", Field, 0}, + {"Type.Decl", Field, 0}, + {"Type.Doc", Field, 0}, + {"Type.Examples", Field, 14}, + {"Type.Funcs", Field, 0}, + {"Type.Methods", Field, 0}, + {"Type.Name", Field, 0}, + {"Type.Vars", Field, 0}, + {"Value", Type, 0}, + {"Value.Decl", Field, 0}, + {"Value.Doc", Field, 0}, + {"Value.Names", Field, 0}, + }, + "go/doc/comment": { + {"(*DocLink).DefaultURL", Method, 19}, + {"(*Heading).DefaultID", Method, 19}, + {"(*List).BlankBefore", Method, 19}, + {"(*List).BlankBetween", Method, 19}, + {"(*Parser).Parse", Method, 19}, + {"(*Printer).Comment", Method, 19}, + {"(*Printer).HTML", Method, 19}, + {"(*Printer).Markdown", Method, 19}, + {"(*Printer).Text", Method, 19}, + {"Block", Type, 19}, + {"Code", Type, 19}, + {"Code.Text", Field, 19}, + {"DefaultLookupPackage", Func, 19}, + {"Doc", Type, 19}, + {"Doc.Content", Field, 19}, + {"Doc.Links", Field, 19}, + {"DocLink", Type, 19}, + {"DocLink.ImportPath", Field, 19}, + {"DocLink.Name", Field, 19}, + {"DocLink.Recv", Field, 19}, + {"DocLink.Text", Field, 19}, + {"Heading", Type, 19}, + {"Heading.Text", Field, 19}, + {"Italic", Type, 19}, + {"Link", Type, 19}, + {"Link.Auto", Field, 19}, + {"Link.Text", Field, 19}, + {"Link.URL", Field, 19}, + {"LinkDef", Type, 19}, + {"LinkDef.Text", Field, 19}, + {"LinkDef.URL", Field, 19}, + {"LinkDef.Used", Field, 19}, + {"List", Type, 19}, + {"List.ForceBlankBefore", Field, 19}, + {"List.ForceBlankBetween", Field, 19}, + {"List.Items", Field, 19}, + {"ListItem", Type, 19}, + {"ListItem.Content", Field, 19}, + {"ListItem.Number", Field, 19}, + {"Paragraph", Type, 19}, + {"Paragraph.Text", Field, 19}, + {"Parser", Type, 19}, + {"Parser.LookupPackage", Field, 19}, + {"Parser.LookupSym", Field, 19}, + {"Parser.Words", Field, 19}, + {"Plain", Type, 19}, + {"Printer", Type, 19}, + {"Printer.DocLinkBaseURL", Field, 19}, + {"Printer.DocLinkURL", Field, 19}, + {"Printer.HeadingID", Field, 19}, + {"Printer.HeadingLevel", Field, 19}, + {"Printer.TextCodePrefix", Field, 19}, + {"Printer.TextPrefix", Field, 19}, + {"Printer.TextWidth", Field, 19}, + {"Text", Type, 19}, + }, + "go/format": { + {"Node", Func, 1}, + {"Source", Func, 1}, + }, + "go/importer": { + {"Default", Func, 5}, + {"For", Func, 5}, + {"ForCompiler", Func, 12}, + {"Lookup", Type, 5}, + }, + "go/parser": { + {"AllErrors", Const, 1}, + {"DeclarationErrors", Const, 0}, + {"ImportsOnly", Const, 0}, + {"Mode", Type, 0}, + {"PackageClauseOnly", Const, 0}, + {"ParseComments", Const, 0}, + {"ParseDir", Func, 0}, + {"ParseExpr", Func, 0}, + {"ParseExprFrom", Func, 5}, + {"ParseFile", Func, 0}, + {"SkipObjectResolution", Const, 17}, + {"SpuriousErrors", Const, 0}, + {"Trace", Const, 0}, + }, + "go/printer": { + {"(*Config).Fprint", Method, 0}, + {"CommentedNode", Type, 0}, + {"CommentedNode.Comments", Field, 0}, + {"CommentedNode.Node", Field, 0}, + {"Config", Type, 0}, + {"Config.Indent", Field, 1}, + {"Config.Mode", Field, 0}, + {"Config.Tabwidth", Field, 0}, + {"Fprint", Func, 0}, + {"Mode", Type, 0}, + {"RawFormat", Const, 0}, + {"SourcePos", Const, 0}, + {"TabIndent", Const, 0}, + {"UseSpaces", Const, 0}, + }, + "go/scanner": { + {"(*ErrorList).Add", Method, 0}, + {"(*ErrorList).RemoveMultiples", Method, 0}, + {"(*ErrorList).Reset", Method, 0}, + {"(*Scanner).Init", Method, 0}, + {"(*Scanner).Scan", Method, 0}, + {"(Error).Error", Method, 0}, + {"(ErrorList).Err", Method, 0}, + {"(ErrorList).Error", Method, 0}, + {"(ErrorList).Len", Method, 0}, + {"(ErrorList).Less", Method, 0}, + {"(ErrorList).Sort", Method, 0}, + {"(ErrorList).Swap", Method, 0}, + {"Error", Type, 0}, + {"Error.Msg", Field, 0}, + {"Error.Pos", Field, 0}, + {"ErrorHandler", Type, 0}, + {"ErrorList", Type, 0}, + {"Mode", Type, 0}, + {"PrintError", Func, 0}, + {"ScanComments", Const, 0}, + {"Scanner", Type, 0}, + {"Scanner.ErrorCount", Field, 0}, + }, + "go/token": { + {"(*File).AddLine", Method, 0}, + {"(*File).AddLineColumnInfo", Method, 11}, + {"(*File).AddLineInfo", Method, 0}, + {"(*File).Base", Method, 0}, + {"(*File).Line", Method, 0}, + {"(*File).LineCount", Method, 0}, + {"(*File).LineStart", Method, 12}, + {"(*File).Lines", Method, 21}, + {"(*File).MergeLine", Method, 2}, + {"(*File).Name", Method, 0}, + {"(*File).Offset", Method, 0}, + {"(*File).Pos", Method, 0}, + {"(*File).Position", Method, 0}, + {"(*File).PositionFor", Method, 4}, + {"(*File).SetLines", Method, 0}, + {"(*File).SetLinesForContent", Method, 0}, + {"(*File).Size", Method, 0}, + {"(*FileSet).AddFile", Method, 0}, + {"(*FileSet).Base", Method, 0}, + {"(*FileSet).File", Method, 0}, + {"(*FileSet).Iterate", Method, 0}, + {"(*FileSet).Position", Method, 0}, + {"(*FileSet).PositionFor", Method, 4}, + {"(*FileSet).Read", Method, 0}, + {"(*FileSet).RemoveFile", Method, 20}, + {"(*FileSet).Write", Method, 0}, + {"(*Position).IsValid", Method, 0}, + {"(Pos).IsValid", Method, 0}, + {"(Position).String", Method, 0}, + {"(Token).IsKeyword", Method, 0}, + {"(Token).IsLiteral", Method, 0}, + {"(Token).IsOperator", Method, 0}, + {"(Token).Precedence", Method, 0}, + {"(Token).String", Method, 0}, + {"ADD", Const, 0}, + {"ADD_ASSIGN", Const, 0}, + {"AND", Const, 0}, + {"AND_ASSIGN", Const, 0}, + {"AND_NOT", Const, 0}, + {"AND_NOT_ASSIGN", Const, 0}, + {"ARROW", Const, 0}, + {"ASSIGN", Const, 0}, + {"BREAK", Const, 0}, + {"CASE", Const, 0}, + {"CHAN", Const, 0}, + {"CHAR", Const, 0}, + {"COLON", Const, 0}, + {"COMMA", Const, 0}, + {"COMMENT", Const, 0}, + {"CONST", Const, 0}, + {"CONTINUE", Const, 0}, + {"DEC", Const, 0}, + {"DEFAULT", Const, 0}, + {"DEFER", Const, 0}, + {"DEFINE", Const, 0}, + {"ELLIPSIS", Const, 0}, + {"ELSE", Const, 0}, + {"EOF", Const, 0}, + {"EQL", Const, 0}, + {"FALLTHROUGH", Const, 0}, + {"FLOAT", Const, 0}, + {"FOR", Const, 0}, + {"FUNC", Const, 0}, + {"File", Type, 0}, + {"FileSet", Type, 0}, + {"GEQ", Const, 0}, + {"GO", Const, 0}, + {"GOTO", Const, 0}, + {"GTR", Const, 0}, + {"HighestPrec", Const, 0}, + {"IDENT", Const, 0}, + {"IF", Const, 0}, + {"ILLEGAL", Const, 0}, + {"IMAG", Const, 0}, + {"IMPORT", Const, 0}, + {"INC", Const, 0}, + {"INT", Const, 0}, + {"INTERFACE", Const, 0}, + {"IsExported", Func, 13}, + {"IsIdentifier", Func, 13}, + {"IsKeyword", Func, 13}, + {"LAND", Const, 0}, + {"LBRACE", Const, 0}, + {"LBRACK", Const, 0}, + {"LEQ", Const, 0}, + {"LOR", Const, 0}, + {"LPAREN", Const, 0}, + {"LSS", Const, 0}, + {"Lookup", Func, 0}, + {"LowestPrec", Const, 0}, + {"MAP", Const, 0}, + {"MUL", Const, 0}, + {"MUL_ASSIGN", Const, 0}, + {"NEQ", Const, 0}, + {"NOT", Const, 0}, + {"NewFileSet", Func, 0}, + {"NoPos", Const, 0}, + {"OR", Const, 0}, + {"OR_ASSIGN", Const, 0}, + {"PACKAGE", Const, 0}, + {"PERIOD", Const, 0}, + {"Pos", Type, 0}, + {"Position", Type, 0}, + {"Position.Column", Field, 0}, + {"Position.Filename", Field, 0}, + {"Position.Line", Field, 0}, + {"Position.Offset", Field, 0}, + {"QUO", Const, 0}, + {"QUO_ASSIGN", Const, 0}, + {"RANGE", Const, 0}, + {"RBRACE", Const, 0}, + {"RBRACK", Const, 0}, + {"REM", Const, 0}, + {"REM_ASSIGN", Const, 0}, + {"RETURN", Const, 0}, + {"RPAREN", Const, 0}, + {"SELECT", Const, 0}, + {"SEMICOLON", Const, 0}, + {"SHL", Const, 0}, + {"SHL_ASSIGN", Const, 0}, + {"SHR", Const, 0}, + {"SHR_ASSIGN", Const, 0}, + {"STRING", Const, 0}, + {"STRUCT", Const, 0}, + {"SUB", Const, 0}, + {"SUB_ASSIGN", Const, 0}, + {"SWITCH", Const, 0}, + {"TILDE", Const, 18}, + {"TYPE", Const, 0}, + {"Token", Type, 0}, + {"UnaryPrec", Const, 0}, + {"VAR", Const, 0}, + {"XOR", Const, 0}, + {"XOR_ASSIGN", Const, 0}, + }, + "go/types": { + {"(*Alias).Obj", Method, 22}, + {"(*Alias).String", Method, 22}, + {"(*Alias).Underlying", Method, 22}, + {"(*ArgumentError).Error", Method, 18}, + {"(*ArgumentError).Unwrap", Method, 18}, + {"(*Array).Elem", Method, 5}, + {"(*Array).Len", Method, 5}, + {"(*Array).String", Method, 5}, + {"(*Array).Underlying", Method, 5}, + {"(*Basic).Info", Method, 5}, + {"(*Basic).Kind", Method, 5}, + {"(*Basic).Name", Method, 5}, + {"(*Basic).String", Method, 5}, + {"(*Basic).Underlying", Method, 5}, + {"(*Builtin).Exported", Method, 5}, + {"(*Builtin).Id", Method, 5}, + {"(*Builtin).Name", Method, 5}, + {"(*Builtin).Parent", Method, 5}, + {"(*Builtin).Pkg", Method, 5}, + {"(*Builtin).Pos", Method, 5}, + {"(*Builtin).String", Method, 5}, + {"(*Builtin).Type", Method, 5}, + {"(*Chan).Dir", Method, 5}, + {"(*Chan).Elem", Method, 5}, + {"(*Chan).String", Method, 5}, + {"(*Chan).Underlying", Method, 5}, + {"(*Checker).Files", Method, 5}, + {"(*Config).Check", Method, 5}, + {"(*Const).Exported", Method, 5}, + {"(*Const).Id", Method, 5}, + {"(*Const).Name", Method, 5}, + {"(*Const).Parent", Method, 5}, + {"(*Const).Pkg", Method, 5}, + {"(*Const).Pos", Method, 5}, + {"(*Const).String", Method, 5}, + {"(*Const).Type", Method, 5}, + {"(*Const).Val", Method, 5}, + {"(*Func).Exported", Method, 5}, + {"(*Func).FullName", Method, 5}, + {"(*Func).Id", Method, 5}, + {"(*Func).Name", Method, 5}, + {"(*Func).Origin", Method, 19}, + {"(*Func).Parent", Method, 5}, + {"(*Func).Pkg", Method, 5}, + {"(*Func).Pos", Method, 5}, + {"(*Func).Scope", Method, 5}, + {"(*Func).String", Method, 5}, + {"(*Func).Type", Method, 5}, + {"(*Info).ObjectOf", Method, 5}, + {"(*Info).PkgNameOf", Method, 22}, + {"(*Info).TypeOf", Method, 5}, + {"(*Initializer).String", Method, 5}, + {"(*Interface).Complete", Method, 5}, + {"(*Interface).Embedded", Method, 5}, + {"(*Interface).EmbeddedType", Method, 11}, + {"(*Interface).Empty", Method, 5}, + {"(*Interface).ExplicitMethod", Method, 5}, + {"(*Interface).IsComparable", Method, 18}, + {"(*Interface).IsImplicit", Method, 18}, + {"(*Interface).IsMethodSet", Method, 18}, + {"(*Interface).MarkImplicit", Method, 18}, + {"(*Interface).Method", Method, 5}, + {"(*Interface).NumEmbeddeds", Method, 5}, + {"(*Interface).NumExplicitMethods", Method, 5}, + {"(*Interface).NumMethods", Method, 5}, + {"(*Interface).String", Method, 5}, + {"(*Interface).Underlying", Method, 5}, + {"(*Label).Exported", Method, 5}, + {"(*Label).Id", Method, 5}, + {"(*Label).Name", Method, 5}, + {"(*Label).Parent", Method, 5}, + {"(*Label).Pkg", Method, 5}, + {"(*Label).Pos", Method, 5}, + {"(*Label).String", Method, 5}, + {"(*Label).Type", Method, 5}, + {"(*Map).Elem", Method, 5}, + {"(*Map).Key", Method, 5}, + {"(*Map).String", Method, 5}, + {"(*Map).Underlying", Method, 5}, + {"(*MethodSet).At", Method, 5}, + {"(*MethodSet).Len", Method, 5}, + {"(*MethodSet).Lookup", Method, 5}, + {"(*MethodSet).String", Method, 5}, + {"(*Named).AddMethod", Method, 5}, + {"(*Named).Method", Method, 5}, + {"(*Named).NumMethods", Method, 5}, + {"(*Named).Obj", Method, 5}, + {"(*Named).Origin", Method, 18}, + {"(*Named).SetTypeParams", Method, 18}, + {"(*Named).SetUnderlying", Method, 5}, + {"(*Named).String", Method, 5}, + {"(*Named).TypeArgs", Method, 18}, + {"(*Named).TypeParams", Method, 18}, + {"(*Named).Underlying", Method, 5}, + {"(*Nil).Exported", Method, 5}, + {"(*Nil).Id", Method, 5}, + {"(*Nil).Name", Method, 5}, + {"(*Nil).Parent", Method, 5}, + {"(*Nil).Pkg", Method, 5}, + {"(*Nil).Pos", Method, 5}, + {"(*Nil).String", Method, 5}, + {"(*Nil).Type", Method, 5}, + {"(*Package).Complete", Method, 5}, + {"(*Package).GoVersion", Method, 21}, + {"(*Package).Imports", Method, 5}, + {"(*Package).MarkComplete", Method, 5}, + {"(*Package).Name", Method, 5}, + {"(*Package).Path", Method, 5}, + {"(*Package).Scope", Method, 5}, + {"(*Package).SetImports", Method, 5}, + {"(*Package).SetName", Method, 6}, + {"(*Package).String", Method, 5}, + {"(*PkgName).Exported", Method, 5}, + {"(*PkgName).Id", Method, 5}, + {"(*PkgName).Imported", Method, 5}, + {"(*PkgName).Name", Method, 5}, + {"(*PkgName).Parent", Method, 5}, + {"(*PkgName).Pkg", Method, 5}, + {"(*PkgName).Pos", Method, 5}, + {"(*PkgName).String", Method, 5}, + {"(*PkgName).Type", Method, 5}, + {"(*Pointer).Elem", Method, 5}, + {"(*Pointer).String", Method, 5}, + {"(*Pointer).Underlying", Method, 5}, + {"(*Scope).Child", Method, 5}, + {"(*Scope).Contains", Method, 5}, + {"(*Scope).End", Method, 5}, + {"(*Scope).Innermost", Method, 5}, + {"(*Scope).Insert", Method, 5}, + {"(*Scope).Len", Method, 5}, + {"(*Scope).Lookup", Method, 5}, + {"(*Scope).LookupParent", Method, 5}, + {"(*Scope).Names", Method, 5}, + {"(*Scope).NumChildren", Method, 5}, + {"(*Scope).Parent", Method, 5}, + {"(*Scope).Pos", Method, 5}, + {"(*Scope).String", Method, 5}, + {"(*Scope).WriteTo", Method, 5}, + {"(*Selection).Index", Method, 5}, + {"(*Selection).Indirect", Method, 5}, + {"(*Selection).Kind", Method, 5}, + {"(*Selection).Obj", Method, 5}, + {"(*Selection).Recv", Method, 5}, + {"(*Selection).String", Method, 5}, + {"(*Selection).Type", Method, 5}, + {"(*Signature).Params", Method, 5}, + {"(*Signature).Recv", Method, 5}, + {"(*Signature).RecvTypeParams", Method, 18}, + {"(*Signature).Results", Method, 5}, + {"(*Signature).String", Method, 5}, + {"(*Signature).TypeParams", Method, 18}, + {"(*Signature).Underlying", Method, 5}, + {"(*Signature).Variadic", Method, 5}, + {"(*Slice).Elem", Method, 5}, + {"(*Slice).String", Method, 5}, + {"(*Slice).Underlying", Method, 5}, + {"(*StdSizes).Alignof", Method, 5}, + {"(*StdSizes).Offsetsof", Method, 5}, + {"(*StdSizes).Sizeof", Method, 5}, + {"(*Struct).Field", Method, 5}, + {"(*Struct).NumFields", Method, 5}, + {"(*Struct).String", Method, 5}, + {"(*Struct).Tag", Method, 5}, + {"(*Struct).Underlying", Method, 5}, + {"(*Term).String", Method, 18}, + {"(*Term).Tilde", Method, 18}, + {"(*Term).Type", Method, 18}, + {"(*Tuple).At", Method, 5}, + {"(*Tuple).Len", Method, 5}, + {"(*Tuple).String", Method, 5}, + {"(*Tuple).Underlying", Method, 5}, + {"(*TypeList).At", Method, 18}, + {"(*TypeList).Len", Method, 18}, + {"(*TypeName).Exported", Method, 5}, + {"(*TypeName).Id", Method, 5}, + {"(*TypeName).IsAlias", Method, 9}, + {"(*TypeName).Name", Method, 5}, + {"(*TypeName).Parent", Method, 5}, + {"(*TypeName).Pkg", Method, 5}, + {"(*TypeName).Pos", Method, 5}, + {"(*TypeName).String", Method, 5}, + {"(*TypeName).Type", Method, 5}, + {"(*TypeParam).Constraint", Method, 18}, + {"(*TypeParam).Index", Method, 18}, + {"(*TypeParam).Obj", Method, 18}, + {"(*TypeParam).SetConstraint", Method, 18}, + {"(*TypeParam).String", Method, 18}, + {"(*TypeParam).Underlying", Method, 18}, + {"(*TypeParamList).At", Method, 18}, + {"(*TypeParamList).Len", Method, 18}, + {"(*Union).Len", Method, 18}, + {"(*Union).String", Method, 18}, + {"(*Union).Term", Method, 18}, + {"(*Union).Underlying", Method, 18}, + {"(*Var).Anonymous", Method, 5}, + {"(*Var).Embedded", Method, 11}, + {"(*Var).Exported", Method, 5}, + {"(*Var).Id", Method, 5}, + {"(*Var).IsField", Method, 5}, + {"(*Var).Name", Method, 5}, + {"(*Var).Origin", Method, 19}, + {"(*Var).Parent", Method, 5}, + {"(*Var).Pkg", Method, 5}, + {"(*Var).Pos", Method, 5}, + {"(*Var).String", Method, 5}, + {"(*Var).Type", Method, 5}, + {"(Checker).ObjectOf", Method, 5}, + {"(Checker).PkgNameOf", Method, 22}, + {"(Checker).TypeOf", Method, 5}, + {"(Error).Error", Method, 5}, + {"(TypeAndValue).Addressable", Method, 5}, + {"(TypeAndValue).Assignable", Method, 5}, + {"(TypeAndValue).HasOk", Method, 5}, + {"(TypeAndValue).IsBuiltin", Method, 5}, + {"(TypeAndValue).IsNil", Method, 5}, + {"(TypeAndValue).IsType", Method, 5}, + {"(TypeAndValue).IsValue", Method, 5}, + {"(TypeAndValue).IsVoid", Method, 5}, + {"Alias", Type, 22}, + {"ArgumentError", Type, 18}, + {"ArgumentError.Err", Field, 18}, + {"ArgumentError.Index", Field, 18}, + {"Array", Type, 5}, + {"AssertableTo", Func, 5}, + {"AssignableTo", Func, 5}, + {"Basic", Type, 5}, + {"BasicInfo", Type, 5}, + {"BasicKind", Type, 5}, + {"Bool", Const, 5}, + {"Builtin", Type, 5}, + {"Byte", Const, 5}, + {"Chan", Type, 5}, + {"ChanDir", Type, 5}, + {"CheckExpr", Func, 13}, + {"Checker", Type, 5}, + {"Checker.Info", Field, 5}, + {"Comparable", Func, 5}, + {"Complex128", Const, 5}, + {"Complex64", Const, 5}, + {"Config", Type, 5}, + {"Config.Context", Field, 18}, + {"Config.DisableUnusedImportCheck", Field, 5}, + {"Config.Error", Field, 5}, + {"Config.FakeImportC", Field, 5}, + {"Config.GoVersion", Field, 18}, + {"Config.IgnoreFuncBodies", Field, 5}, + {"Config.Importer", Field, 5}, + {"Config.Sizes", Field, 5}, + {"Const", Type, 5}, + {"Context", Type, 18}, + {"ConvertibleTo", Func, 5}, + {"DefPredeclaredTestFuncs", Func, 5}, + {"Default", Func, 8}, + {"Error", Type, 5}, + {"Error.Fset", Field, 5}, + {"Error.Msg", Field, 5}, + {"Error.Pos", Field, 5}, + {"Error.Soft", Field, 5}, + {"Eval", Func, 5}, + {"ExprString", Func, 5}, + {"FieldVal", Const, 5}, + {"Float32", Const, 5}, + {"Float64", Const, 5}, + {"Func", Type, 5}, + {"Id", Func, 5}, + {"Identical", Func, 5}, + {"IdenticalIgnoreTags", Func, 8}, + {"Implements", Func, 5}, + {"ImportMode", Type, 6}, + {"Importer", Type, 5}, + {"ImporterFrom", Type, 6}, + {"Info", Type, 5}, + {"Info.Defs", Field, 5}, + {"Info.FileVersions", Field, 22}, + {"Info.Implicits", Field, 5}, + {"Info.InitOrder", Field, 5}, + {"Info.Instances", Field, 18}, + {"Info.Scopes", Field, 5}, + {"Info.Selections", Field, 5}, + {"Info.Types", Field, 5}, + {"Info.Uses", Field, 5}, + {"Initializer", Type, 5}, + {"Initializer.Lhs", Field, 5}, + {"Initializer.Rhs", Field, 5}, + {"Instance", Type, 18}, + {"Instance.Type", Field, 18}, + {"Instance.TypeArgs", Field, 18}, + {"Instantiate", Func, 18}, + {"Int", Const, 5}, + {"Int16", Const, 5}, + {"Int32", Const, 5}, + {"Int64", Const, 5}, + {"Int8", Const, 5}, + {"Interface", Type, 5}, + {"Invalid", Const, 5}, + {"IsBoolean", Const, 5}, + {"IsComplex", Const, 5}, + {"IsConstType", Const, 5}, + {"IsFloat", Const, 5}, + {"IsInteger", Const, 5}, + {"IsInterface", Func, 5}, + {"IsNumeric", Const, 5}, + {"IsOrdered", Const, 5}, + {"IsString", Const, 5}, + {"IsUnsigned", Const, 5}, + {"IsUntyped", Const, 5}, + {"Label", Type, 5}, + {"LookupFieldOrMethod", Func, 5}, + {"Map", Type, 5}, + {"MethodExpr", Const, 5}, + {"MethodSet", Type, 5}, + {"MethodVal", Const, 5}, + {"MissingMethod", Func, 5}, + {"Named", Type, 5}, + {"NewAlias", Func, 22}, + {"NewArray", Func, 5}, + {"NewChan", Func, 5}, + {"NewChecker", Func, 5}, + {"NewConst", Func, 5}, + {"NewContext", Func, 18}, + {"NewField", Func, 5}, + {"NewFunc", Func, 5}, + {"NewInterface", Func, 5}, + {"NewInterfaceType", Func, 11}, + {"NewLabel", Func, 5}, + {"NewMap", Func, 5}, + {"NewMethodSet", Func, 5}, + {"NewNamed", Func, 5}, + {"NewPackage", Func, 5}, + {"NewParam", Func, 5}, + {"NewPkgName", Func, 5}, + {"NewPointer", Func, 5}, + {"NewScope", Func, 5}, + {"NewSignature", Func, 5}, + {"NewSignatureType", Func, 18}, + {"NewSlice", Func, 5}, + {"NewStruct", Func, 5}, + {"NewTerm", Func, 18}, + {"NewTuple", Func, 5}, + {"NewTypeName", Func, 5}, + {"NewTypeParam", Func, 18}, + {"NewUnion", Func, 18}, + {"NewVar", Func, 5}, + {"Nil", Type, 5}, + {"Object", Type, 5}, + {"ObjectString", Func, 5}, + {"Package", Type, 5}, + {"PkgName", Type, 5}, + {"Pointer", Type, 5}, + {"Qualifier", Type, 5}, + {"RecvOnly", Const, 5}, + {"RelativeTo", Func, 5}, + {"Rune", Const, 5}, + {"Satisfies", Func, 20}, + {"Scope", Type, 5}, + {"Selection", Type, 5}, + {"SelectionKind", Type, 5}, + {"SelectionString", Func, 5}, + {"SendOnly", Const, 5}, + {"SendRecv", Const, 5}, + {"Signature", Type, 5}, + {"Sizes", Type, 5}, + {"SizesFor", Func, 9}, + {"Slice", Type, 5}, + {"StdSizes", Type, 5}, + {"StdSizes.MaxAlign", Field, 5}, + {"StdSizes.WordSize", Field, 5}, + {"String", Const, 5}, + {"Struct", Type, 5}, + {"Term", Type, 18}, + {"Tuple", Type, 5}, + {"Typ", Var, 5}, + {"Type", Type, 5}, + {"TypeAndValue", Type, 5}, + {"TypeAndValue.Type", Field, 5}, + {"TypeAndValue.Value", Field, 5}, + {"TypeList", Type, 18}, + {"TypeName", Type, 5}, + {"TypeParam", Type, 18}, + {"TypeParamList", Type, 18}, + {"TypeString", Func, 5}, + {"Uint", Const, 5}, + {"Uint16", Const, 5}, + {"Uint32", Const, 5}, + {"Uint64", Const, 5}, + {"Uint8", Const, 5}, + {"Uintptr", Const, 5}, + {"Unalias", Func, 22}, + {"Union", Type, 18}, + {"Universe", Var, 5}, + {"Unsafe", Var, 5}, + {"UnsafePointer", Const, 5}, + {"UntypedBool", Const, 5}, + {"UntypedComplex", Const, 5}, + {"UntypedFloat", Const, 5}, + {"UntypedInt", Const, 5}, + {"UntypedNil", Const, 5}, + {"UntypedRune", Const, 5}, + {"UntypedString", Const, 5}, + {"Var", Type, 5}, + {"WriteExpr", Func, 5}, + {"WriteSignature", Func, 5}, + {"WriteType", Func, 5}, + }, + "go/version": { + {"Compare", Func, 22}, + {"IsValid", Func, 22}, + {"Lang", Func, 22}, + }, + "hash": { + {"Hash", Type, 0}, + {"Hash32", Type, 0}, + {"Hash64", Type, 0}, + }, + "hash/adler32": { + {"Checksum", Func, 0}, + {"New", Func, 0}, + {"Size", Const, 0}, + }, + "hash/crc32": { + {"Castagnoli", Const, 0}, + {"Checksum", Func, 0}, + {"ChecksumIEEE", Func, 0}, + {"IEEE", Const, 0}, + {"IEEETable", Var, 0}, + {"Koopman", Const, 0}, + {"MakeTable", Func, 0}, + {"New", Func, 0}, + {"NewIEEE", Func, 0}, + {"Size", Const, 0}, + {"Table", Type, 0}, + {"Update", Func, 0}, + }, + "hash/crc64": { + {"Checksum", Func, 0}, + {"ECMA", Const, 0}, + {"ISO", Const, 0}, + {"MakeTable", Func, 0}, + {"New", Func, 0}, + {"Size", Const, 0}, + {"Table", Type, 0}, + {"Update", Func, 0}, + }, + "hash/fnv": { + {"New128", Func, 9}, + {"New128a", Func, 9}, + {"New32", Func, 0}, + {"New32a", Func, 0}, + {"New64", Func, 0}, + {"New64a", Func, 0}, + }, + "hash/maphash": { + {"(*Hash).BlockSize", Method, 14}, + {"(*Hash).Reset", Method, 14}, + {"(*Hash).Seed", Method, 14}, + {"(*Hash).SetSeed", Method, 14}, + {"(*Hash).Size", Method, 14}, + {"(*Hash).Sum", Method, 14}, + {"(*Hash).Sum64", Method, 14}, + {"(*Hash).Write", Method, 14}, + {"(*Hash).WriteByte", Method, 14}, + {"(*Hash).WriteString", Method, 14}, + {"Bytes", Func, 19}, + {"Hash", Type, 14}, + {"MakeSeed", Func, 14}, + {"Seed", Type, 14}, + {"String", Func, 19}, + }, + "html": { + {"EscapeString", Func, 0}, + {"UnescapeString", Func, 0}, + }, + "html/template": { + {"(*Error).Error", Method, 0}, + {"(*Template).AddParseTree", Method, 0}, + {"(*Template).Clone", Method, 0}, + {"(*Template).DefinedTemplates", Method, 6}, + {"(*Template).Delims", Method, 0}, + {"(*Template).Execute", Method, 0}, + {"(*Template).ExecuteTemplate", Method, 0}, + {"(*Template).Funcs", Method, 0}, + {"(*Template).Lookup", Method, 0}, + {"(*Template).Name", Method, 0}, + {"(*Template).New", Method, 0}, + {"(*Template).Option", Method, 5}, + {"(*Template).Parse", Method, 0}, + {"(*Template).ParseFS", Method, 16}, + {"(*Template).ParseFiles", Method, 0}, + {"(*Template).ParseGlob", Method, 0}, + {"(*Template).Templates", Method, 0}, + {"CSS", Type, 0}, + {"ErrAmbigContext", Const, 0}, + {"ErrBadHTML", Const, 0}, + {"ErrBranchEnd", Const, 0}, + {"ErrEndContext", Const, 0}, + {"ErrJSTemplate", Const, 21}, + {"ErrNoSuchTemplate", Const, 0}, + {"ErrOutputContext", Const, 0}, + {"ErrPartialCharset", Const, 0}, + {"ErrPartialEscape", Const, 0}, + {"ErrPredefinedEscaper", Const, 9}, + {"ErrRangeLoopReentry", Const, 0}, + {"ErrSlashAmbig", Const, 0}, + {"Error", Type, 0}, + {"Error.Description", Field, 0}, + {"Error.ErrorCode", Field, 0}, + {"Error.Line", Field, 0}, + {"Error.Name", Field, 0}, + {"Error.Node", Field, 4}, + {"ErrorCode", Type, 0}, + {"FuncMap", Type, 0}, + {"HTML", Type, 0}, + {"HTMLAttr", Type, 0}, + {"HTMLEscape", Func, 0}, + {"HTMLEscapeString", Func, 0}, + {"HTMLEscaper", Func, 0}, + {"IsTrue", Func, 6}, + {"JS", Type, 0}, + {"JSEscape", Func, 0}, + {"JSEscapeString", Func, 0}, + {"JSEscaper", Func, 0}, + {"JSStr", Type, 0}, + {"Must", Func, 0}, + {"New", Func, 0}, + {"OK", Const, 0}, + {"ParseFS", Func, 16}, + {"ParseFiles", Func, 0}, + {"ParseGlob", Func, 0}, + {"Srcset", Type, 10}, + {"Template", Type, 0}, + {"Template.Tree", Field, 2}, + {"URL", Type, 0}, + {"URLQueryEscaper", Func, 0}, + }, + "image": { + {"(*Alpha).AlphaAt", Method, 4}, + {"(*Alpha).At", Method, 0}, + {"(*Alpha).Bounds", Method, 0}, + {"(*Alpha).ColorModel", Method, 0}, + {"(*Alpha).Opaque", Method, 0}, + {"(*Alpha).PixOffset", Method, 0}, + {"(*Alpha).RGBA64At", Method, 17}, + {"(*Alpha).Set", Method, 0}, + {"(*Alpha).SetAlpha", Method, 0}, + {"(*Alpha).SetRGBA64", Method, 17}, + {"(*Alpha).SubImage", Method, 0}, + {"(*Alpha16).Alpha16At", Method, 4}, + {"(*Alpha16).At", Method, 0}, + {"(*Alpha16).Bounds", Method, 0}, + {"(*Alpha16).ColorModel", Method, 0}, + {"(*Alpha16).Opaque", Method, 0}, + {"(*Alpha16).PixOffset", Method, 0}, + {"(*Alpha16).RGBA64At", Method, 17}, + {"(*Alpha16).Set", Method, 0}, + {"(*Alpha16).SetAlpha16", Method, 0}, + {"(*Alpha16).SetRGBA64", Method, 17}, + {"(*Alpha16).SubImage", Method, 0}, + {"(*CMYK).At", Method, 5}, + {"(*CMYK).Bounds", Method, 5}, + {"(*CMYK).CMYKAt", Method, 5}, + {"(*CMYK).ColorModel", Method, 5}, + {"(*CMYK).Opaque", Method, 5}, + {"(*CMYK).PixOffset", Method, 5}, + {"(*CMYK).RGBA64At", Method, 17}, + {"(*CMYK).Set", Method, 5}, + {"(*CMYK).SetCMYK", Method, 5}, + {"(*CMYK).SetRGBA64", Method, 17}, + {"(*CMYK).SubImage", Method, 5}, + {"(*Gray).At", Method, 0}, + {"(*Gray).Bounds", Method, 0}, + {"(*Gray).ColorModel", Method, 0}, + {"(*Gray).GrayAt", Method, 4}, + {"(*Gray).Opaque", Method, 0}, + {"(*Gray).PixOffset", Method, 0}, + {"(*Gray).RGBA64At", Method, 17}, + {"(*Gray).Set", Method, 0}, + {"(*Gray).SetGray", Method, 0}, + {"(*Gray).SetRGBA64", Method, 17}, + {"(*Gray).SubImage", Method, 0}, + {"(*Gray16).At", Method, 0}, + {"(*Gray16).Bounds", Method, 0}, + {"(*Gray16).ColorModel", Method, 0}, + {"(*Gray16).Gray16At", Method, 4}, + {"(*Gray16).Opaque", Method, 0}, + {"(*Gray16).PixOffset", Method, 0}, + {"(*Gray16).RGBA64At", Method, 17}, + {"(*Gray16).Set", Method, 0}, + {"(*Gray16).SetGray16", Method, 0}, + {"(*Gray16).SetRGBA64", Method, 17}, + {"(*Gray16).SubImage", Method, 0}, + {"(*NRGBA).At", Method, 0}, + {"(*NRGBA).Bounds", Method, 0}, + {"(*NRGBA).ColorModel", Method, 0}, + {"(*NRGBA).NRGBAAt", Method, 4}, + {"(*NRGBA).Opaque", Method, 0}, + {"(*NRGBA).PixOffset", Method, 0}, + {"(*NRGBA).RGBA64At", Method, 17}, + {"(*NRGBA).Set", Method, 0}, + {"(*NRGBA).SetNRGBA", Method, 0}, + {"(*NRGBA).SetRGBA64", Method, 17}, + {"(*NRGBA).SubImage", Method, 0}, + {"(*NRGBA64).At", Method, 0}, + {"(*NRGBA64).Bounds", Method, 0}, + {"(*NRGBA64).ColorModel", Method, 0}, + {"(*NRGBA64).NRGBA64At", Method, 4}, + {"(*NRGBA64).Opaque", Method, 0}, + {"(*NRGBA64).PixOffset", Method, 0}, + {"(*NRGBA64).RGBA64At", Method, 17}, + {"(*NRGBA64).Set", Method, 0}, + {"(*NRGBA64).SetNRGBA64", Method, 0}, + {"(*NRGBA64).SetRGBA64", Method, 17}, + {"(*NRGBA64).SubImage", Method, 0}, + {"(*NYCbCrA).AOffset", Method, 6}, + {"(*NYCbCrA).At", Method, 6}, + {"(*NYCbCrA).Bounds", Method, 6}, + {"(*NYCbCrA).COffset", Method, 6}, + {"(*NYCbCrA).ColorModel", Method, 6}, + {"(*NYCbCrA).NYCbCrAAt", Method, 6}, + {"(*NYCbCrA).Opaque", Method, 6}, + {"(*NYCbCrA).RGBA64At", Method, 17}, + {"(*NYCbCrA).SubImage", Method, 6}, + {"(*NYCbCrA).YCbCrAt", Method, 6}, + {"(*NYCbCrA).YOffset", Method, 6}, + {"(*Paletted).At", Method, 0}, + {"(*Paletted).Bounds", Method, 0}, + {"(*Paletted).ColorIndexAt", Method, 0}, + {"(*Paletted).ColorModel", Method, 0}, + {"(*Paletted).Opaque", Method, 0}, + {"(*Paletted).PixOffset", Method, 0}, + {"(*Paletted).RGBA64At", Method, 17}, + {"(*Paletted).Set", Method, 0}, + {"(*Paletted).SetColorIndex", Method, 0}, + {"(*Paletted).SetRGBA64", Method, 17}, + {"(*Paletted).SubImage", Method, 0}, + {"(*RGBA).At", Method, 0}, + {"(*RGBA).Bounds", Method, 0}, + {"(*RGBA).ColorModel", Method, 0}, + {"(*RGBA).Opaque", Method, 0}, + {"(*RGBA).PixOffset", Method, 0}, + {"(*RGBA).RGBA64At", Method, 17}, + {"(*RGBA).RGBAAt", Method, 4}, + {"(*RGBA).Set", Method, 0}, + {"(*RGBA).SetRGBA", Method, 0}, + {"(*RGBA).SetRGBA64", Method, 17}, + {"(*RGBA).SubImage", Method, 0}, + {"(*RGBA64).At", Method, 0}, + {"(*RGBA64).Bounds", Method, 0}, + {"(*RGBA64).ColorModel", Method, 0}, + {"(*RGBA64).Opaque", Method, 0}, + {"(*RGBA64).PixOffset", Method, 0}, + {"(*RGBA64).RGBA64At", Method, 4}, + {"(*RGBA64).Set", Method, 0}, + {"(*RGBA64).SetRGBA64", Method, 0}, + {"(*RGBA64).SubImage", Method, 0}, + {"(*Uniform).At", Method, 0}, + {"(*Uniform).Bounds", Method, 0}, + {"(*Uniform).ColorModel", Method, 0}, + {"(*Uniform).Convert", Method, 0}, + {"(*Uniform).Opaque", Method, 0}, + {"(*Uniform).RGBA", Method, 0}, + {"(*Uniform).RGBA64At", Method, 17}, + {"(*YCbCr).At", Method, 0}, + {"(*YCbCr).Bounds", Method, 0}, + {"(*YCbCr).COffset", Method, 0}, + {"(*YCbCr).ColorModel", Method, 0}, + {"(*YCbCr).Opaque", Method, 0}, + {"(*YCbCr).RGBA64At", Method, 17}, + {"(*YCbCr).SubImage", Method, 0}, + {"(*YCbCr).YCbCrAt", Method, 4}, + {"(*YCbCr).YOffset", Method, 0}, + {"(Point).Add", Method, 0}, + {"(Point).Div", Method, 0}, + {"(Point).Eq", Method, 0}, + {"(Point).In", Method, 0}, + {"(Point).Mod", Method, 0}, + {"(Point).Mul", Method, 0}, + {"(Point).String", Method, 0}, + {"(Point).Sub", Method, 0}, + {"(Rectangle).Add", Method, 0}, + {"(Rectangle).At", Method, 5}, + {"(Rectangle).Bounds", Method, 5}, + {"(Rectangle).Canon", Method, 0}, + {"(Rectangle).ColorModel", Method, 5}, + {"(Rectangle).Dx", Method, 0}, + {"(Rectangle).Dy", Method, 0}, + {"(Rectangle).Empty", Method, 0}, + {"(Rectangle).Eq", Method, 0}, + {"(Rectangle).In", Method, 0}, + {"(Rectangle).Inset", Method, 0}, + {"(Rectangle).Intersect", Method, 0}, + {"(Rectangle).Overlaps", Method, 0}, + {"(Rectangle).RGBA64At", Method, 17}, + {"(Rectangle).Size", Method, 0}, + {"(Rectangle).String", Method, 0}, + {"(Rectangle).Sub", Method, 0}, + {"(Rectangle).Union", Method, 0}, + {"(YCbCrSubsampleRatio).String", Method, 0}, + {"Alpha", Type, 0}, + {"Alpha.Pix", Field, 0}, + {"Alpha.Rect", Field, 0}, + {"Alpha.Stride", Field, 0}, + {"Alpha16", Type, 0}, + {"Alpha16.Pix", Field, 0}, + {"Alpha16.Rect", Field, 0}, + {"Alpha16.Stride", Field, 0}, + {"Black", Var, 0}, + {"CMYK", Type, 5}, + {"CMYK.Pix", Field, 5}, + {"CMYK.Rect", Field, 5}, + {"CMYK.Stride", Field, 5}, + {"Config", Type, 0}, + {"Config.ColorModel", Field, 0}, + {"Config.Height", Field, 0}, + {"Config.Width", Field, 0}, + {"Decode", Func, 0}, + {"DecodeConfig", Func, 0}, + {"ErrFormat", Var, 0}, + {"Gray", Type, 0}, + {"Gray.Pix", Field, 0}, + {"Gray.Rect", Field, 0}, + {"Gray.Stride", Field, 0}, + {"Gray16", Type, 0}, + {"Gray16.Pix", Field, 0}, + {"Gray16.Rect", Field, 0}, + {"Gray16.Stride", Field, 0}, + {"Image", Type, 0}, + {"NRGBA", Type, 0}, + {"NRGBA.Pix", Field, 0}, + {"NRGBA.Rect", Field, 0}, + {"NRGBA.Stride", Field, 0}, + {"NRGBA64", Type, 0}, + {"NRGBA64.Pix", Field, 0}, + {"NRGBA64.Rect", Field, 0}, + {"NRGBA64.Stride", Field, 0}, + {"NYCbCrA", Type, 6}, + {"NYCbCrA.A", Field, 6}, + {"NYCbCrA.AStride", Field, 6}, + {"NYCbCrA.YCbCr", Field, 6}, + {"NewAlpha", Func, 0}, + {"NewAlpha16", Func, 0}, + {"NewCMYK", Func, 5}, + {"NewGray", Func, 0}, + {"NewGray16", Func, 0}, + {"NewNRGBA", Func, 0}, + {"NewNRGBA64", Func, 0}, + {"NewNYCbCrA", Func, 6}, + {"NewPaletted", Func, 0}, + {"NewRGBA", Func, 0}, + {"NewRGBA64", Func, 0}, + {"NewUniform", Func, 0}, + {"NewYCbCr", Func, 0}, + {"Opaque", Var, 0}, + {"Paletted", Type, 0}, + {"Paletted.Palette", Field, 0}, + {"Paletted.Pix", Field, 0}, + {"Paletted.Rect", Field, 0}, + {"Paletted.Stride", Field, 0}, + {"PalettedImage", Type, 0}, + {"Point", Type, 0}, + {"Point.X", Field, 0}, + {"Point.Y", Field, 0}, + {"Pt", Func, 0}, + {"RGBA", Type, 0}, + {"RGBA.Pix", Field, 0}, + {"RGBA.Rect", Field, 0}, + {"RGBA.Stride", Field, 0}, + {"RGBA64", Type, 0}, + {"RGBA64.Pix", Field, 0}, + {"RGBA64.Rect", Field, 0}, + {"RGBA64.Stride", Field, 0}, + {"RGBA64Image", Type, 17}, + {"Rect", Func, 0}, + {"Rectangle", Type, 0}, + {"Rectangle.Max", Field, 0}, + {"Rectangle.Min", Field, 0}, + {"RegisterFormat", Func, 0}, + {"Transparent", Var, 0}, + {"Uniform", Type, 0}, + {"Uniform.C", Field, 0}, + {"White", Var, 0}, + {"YCbCr", Type, 0}, + {"YCbCr.CStride", Field, 0}, + {"YCbCr.Cb", Field, 0}, + {"YCbCr.Cr", Field, 0}, + {"YCbCr.Rect", Field, 0}, + {"YCbCr.SubsampleRatio", Field, 0}, + {"YCbCr.Y", Field, 0}, + {"YCbCr.YStride", Field, 0}, + {"YCbCrSubsampleRatio", Type, 0}, + {"YCbCrSubsampleRatio410", Const, 5}, + {"YCbCrSubsampleRatio411", Const, 5}, + {"YCbCrSubsampleRatio420", Const, 0}, + {"YCbCrSubsampleRatio422", Const, 0}, + {"YCbCrSubsampleRatio440", Const, 1}, + {"YCbCrSubsampleRatio444", Const, 0}, + {"ZP", Var, 0}, + {"ZR", Var, 0}, + }, + "image/color": { + {"(Alpha).RGBA", Method, 0}, + {"(Alpha16).RGBA", Method, 0}, + {"(CMYK).RGBA", Method, 5}, + {"(Gray).RGBA", Method, 0}, + {"(Gray16).RGBA", Method, 0}, + {"(NRGBA).RGBA", Method, 0}, + {"(NRGBA64).RGBA", Method, 0}, + {"(NYCbCrA).RGBA", Method, 6}, + {"(Palette).Convert", Method, 0}, + {"(Palette).Index", Method, 0}, + {"(RGBA).RGBA", Method, 0}, + {"(RGBA64).RGBA", Method, 0}, + {"(YCbCr).RGBA", Method, 0}, + {"Alpha", Type, 0}, + {"Alpha.A", Field, 0}, + {"Alpha16", Type, 0}, + {"Alpha16.A", Field, 0}, + {"Alpha16Model", Var, 0}, + {"AlphaModel", Var, 0}, + {"Black", Var, 0}, + {"CMYK", Type, 5}, + {"CMYK.C", Field, 5}, + {"CMYK.K", Field, 5}, + {"CMYK.M", Field, 5}, + {"CMYK.Y", Field, 5}, + {"CMYKModel", Var, 5}, + {"CMYKToRGB", Func, 5}, + {"Color", Type, 0}, + {"Gray", Type, 0}, + {"Gray.Y", Field, 0}, + {"Gray16", Type, 0}, + {"Gray16.Y", Field, 0}, + {"Gray16Model", Var, 0}, + {"GrayModel", Var, 0}, + {"Model", Type, 0}, + {"ModelFunc", Func, 0}, + {"NRGBA", Type, 0}, + {"NRGBA.A", Field, 0}, + {"NRGBA.B", Field, 0}, + {"NRGBA.G", Field, 0}, + {"NRGBA.R", Field, 0}, + {"NRGBA64", Type, 0}, + {"NRGBA64.A", Field, 0}, + {"NRGBA64.B", Field, 0}, + {"NRGBA64.G", Field, 0}, + {"NRGBA64.R", Field, 0}, + {"NRGBA64Model", Var, 0}, + {"NRGBAModel", Var, 0}, + {"NYCbCrA", Type, 6}, + {"NYCbCrA.A", Field, 6}, + {"NYCbCrA.YCbCr", Field, 6}, + {"NYCbCrAModel", Var, 6}, + {"Opaque", Var, 0}, + {"Palette", Type, 0}, + {"RGBA", Type, 0}, + {"RGBA.A", Field, 0}, + {"RGBA.B", Field, 0}, + {"RGBA.G", Field, 0}, + {"RGBA.R", Field, 0}, + {"RGBA64", Type, 0}, + {"RGBA64.A", Field, 0}, + {"RGBA64.B", Field, 0}, + {"RGBA64.G", Field, 0}, + {"RGBA64.R", Field, 0}, + {"RGBA64Model", Var, 0}, + {"RGBAModel", Var, 0}, + {"RGBToCMYK", Func, 5}, + {"RGBToYCbCr", Func, 0}, + {"Transparent", Var, 0}, + {"White", Var, 0}, + {"YCbCr", Type, 0}, + {"YCbCr.Cb", Field, 0}, + {"YCbCr.Cr", Field, 0}, + {"YCbCr.Y", Field, 0}, + {"YCbCrModel", Var, 0}, + {"YCbCrToRGB", Func, 0}, + }, + "image/color/palette": { + {"Plan9", Var, 2}, + {"WebSafe", Var, 2}, + }, + "image/draw": { + {"(Op).Draw", Method, 2}, + {"Draw", Func, 0}, + {"DrawMask", Func, 0}, + {"Drawer", Type, 2}, + {"FloydSteinberg", Var, 2}, + {"Image", Type, 0}, + {"Op", Type, 0}, + {"Over", Const, 0}, + {"Quantizer", Type, 2}, + {"RGBA64Image", Type, 17}, + {"Src", Const, 0}, + }, + "image/gif": { + {"Decode", Func, 0}, + {"DecodeAll", Func, 0}, + {"DecodeConfig", Func, 0}, + {"DisposalBackground", Const, 5}, + {"DisposalNone", Const, 5}, + {"DisposalPrevious", Const, 5}, + {"Encode", Func, 2}, + {"EncodeAll", Func, 2}, + {"GIF", Type, 0}, + {"GIF.BackgroundIndex", Field, 5}, + {"GIF.Config", Field, 5}, + {"GIF.Delay", Field, 0}, + {"GIF.Disposal", Field, 5}, + {"GIF.Image", Field, 0}, + {"GIF.LoopCount", Field, 0}, + {"Options", Type, 2}, + {"Options.Drawer", Field, 2}, + {"Options.NumColors", Field, 2}, + {"Options.Quantizer", Field, 2}, + }, + "image/jpeg": { + {"(FormatError).Error", Method, 0}, + {"(UnsupportedError).Error", Method, 0}, + {"Decode", Func, 0}, + {"DecodeConfig", Func, 0}, + {"DefaultQuality", Const, 0}, + {"Encode", Func, 0}, + {"FormatError", Type, 0}, + {"Options", Type, 0}, + {"Options.Quality", Field, 0}, + {"Reader", Type, 0}, + {"UnsupportedError", Type, 0}, + }, + "image/png": { + {"(*Encoder).Encode", Method, 4}, + {"(FormatError).Error", Method, 0}, + {"(UnsupportedError).Error", Method, 0}, + {"BestCompression", Const, 4}, + {"BestSpeed", Const, 4}, + {"CompressionLevel", Type, 4}, + {"Decode", Func, 0}, + {"DecodeConfig", Func, 0}, + {"DefaultCompression", Const, 4}, + {"Encode", Func, 0}, + {"Encoder", Type, 4}, + {"Encoder.BufferPool", Field, 9}, + {"Encoder.CompressionLevel", Field, 4}, + {"EncoderBuffer", Type, 9}, + {"EncoderBufferPool", Type, 9}, + {"FormatError", Type, 0}, + {"NoCompression", Const, 4}, + {"UnsupportedError", Type, 0}, + }, + "index/suffixarray": { + {"(*Index).Bytes", Method, 0}, + {"(*Index).FindAllIndex", Method, 0}, + {"(*Index).Lookup", Method, 0}, + {"(*Index).Read", Method, 0}, + {"(*Index).Write", Method, 0}, + {"Index", Type, 0}, + {"New", Func, 0}, + }, + "io": { + {"(*LimitedReader).Read", Method, 0}, + {"(*OffsetWriter).Seek", Method, 20}, + {"(*OffsetWriter).Write", Method, 20}, + {"(*OffsetWriter).WriteAt", Method, 20}, + {"(*PipeReader).Close", Method, 0}, + {"(*PipeReader).CloseWithError", Method, 0}, + {"(*PipeReader).Read", Method, 0}, + {"(*PipeWriter).Close", Method, 0}, + {"(*PipeWriter).CloseWithError", Method, 0}, + {"(*PipeWriter).Write", Method, 0}, + {"(*SectionReader).Outer", Method, 22}, + {"(*SectionReader).Read", Method, 0}, + {"(*SectionReader).ReadAt", Method, 0}, + {"(*SectionReader).Seek", Method, 0}, + {"(*SectionReader).Size", Method, 0}, + {"ByteReader", Type, 0}, + {"ByteScanner", Type, 0}, + {"ByteWriter", Type, 1}, + {"Closer", Type, 0}, + {"Copy", Func, 0}, + {"CopyBuffer", Func, 5}, + {"CopyN", Func, 0}, + {"Discard", Var, 16}, + {"EOF", Var, 0}, + {"ErrClosedPipe", Var, 0}, + {"ErrNoProgress", Var, 1}, + {"ErrShortBuffer", Var, 0}, + {"ErrShortWrite", Var, 0}, + {"ErrUnexpectedEOF", Var, 0}, + {"LimitReader", Func, 0}, + {"LimitedReader", Type, 0}, + {"LimitedReader.N", Field, 0}, + {"LimitedReader.R", Field, 0}, + {"MultiReader", Func, 0}, + {"MultiWriter", Func, 0}, + {"NewOffsetWriter", Func, 20}, + {"NewSectionReader", Func, 0}, + {"NopCloser", Func, 16}, + {"OffsetWriter", Type, 20}, + {"Pipe", Func, 0}, + {"PipeReader", Type, 0}, + {"PipeWriter", Type, 0}, + {"ReadAll", Func, 16}, + {"ReadAtLeast", Func, 0}, + {"ReadCloser", Type, 0}, + {"ReadFull", Func, 0}, + {"ReadSeekCloser", Type, 16}, + {"ReadSeeker", Type, 0}, + {"ReadWriteCloser", Type, 0}, + {"ReadWriteSeeker", Type, 0}, + {"ReadWriter", Type, 0}, + {"Reader", Type, 0}, + {"ReaderAt", Type, 0}, + {"ReaderFrom", Type, 0}, + {"RuneReader", Type, 0}, + {"RuneScanner", Type, 0}, + {"SectionReader", Type, 0}, + {"SeekCurrent", Const, 7}, + {"SeekEnd", Const, 7}, + {"SeekStart", Const, 7}, + {"Seeker", Type, 0}, + {"StringWriter", Type, 12}, + {"TeeReader", Func, 0}, + {"WriteCloser", Type, 0}, + {"WriteSeeker", Type, 0}, + {"WriteString", Func, 0}, + {"Writer", Type, 0}, + {"WriterAt", Type, 0}, + {"WriterTo", Type, 0}, + }, + "io/fs": { + {"(*PathError).Error", Method, 16}, + {"(*PathError).Timeout", Method, 16}, + {"(*PathError).Unwrap", Method, 16}, + {"(FileMode).IsDir", Method, 16}, + {"(FileMode).IsRegular", Method, 16}, + {"(FileMode).Perm", Method, 16}, + {"(FileMode).String", Method, 16}, + {"(FileMode).Type", Method, 16}, + {"DirEntry", Type, 16}, + {"ErrClosed", Var, 16}, + {"ErrExist", Var, 16}, + {"ErrInvalid", Var, 16}, + {"ErrNotExist", Var, 16}, + {"ErrPermission", Var, 16}, + {"FS", Type, 16}, + {"File", Type, 16}, + {"FileInfo", Type, 16}, + {"FileInfoToDirEntry", Func, 17}, + {"FileMode", Type, 16}, + {"FormatDirEntry", Func, 21}, + {"FormatFileInfo", Func, 21}, + {"Glob", Func, 16}, + {"GlobFS", Type, 16}, + {"ModeAppend", Const, 16}, + {"ModeCharDevice", Const, 16}, + {"ModeDevice", Const, 16}, + {"ModeDir", Const, 16}, + {"ModeExclusive", Const, 16}, + {"ModeIrregular", Const, 16}, + {"ModeNamedPipe", Const, 16}, + {"ModePerm", Const, 16}, + {"ModeSetgid", Const, 16}, + {"ModeSetuid", Const, 16}, + {"ModeSocket", Const, 16}, + {"ModeSticky", Const, 16}, + {"ModeSymlink", Const, 16}, + {"ModeTemporary", Const, 16}, + {"ModeType", Const, 16}, + {"PathError", Type, 16}, + {"PathError.Err", Field, 16}, + {"PathError.Op", Field, 16}, + {"PathError.Path", Field, 16}, + {"ReadDir", Func, 16}, + {"ReadDirFS", Type, 16}, + {"ReadDirFile", Type, 16}, + {"ReadFile", Func, 16}, + {"ReadFileFS", Type, 16}, + {"SkipAll", Var, 20}, + {"SkipDir", Var, 16}, + {"Stat", Func, 16}, + {"StatFS", Type, 16}, + {"Sub", Func, 16}, + {"SubFS", Type, 16}, + {"ValidPath", Func, 16}, + {"WalkDir", Func, 16}, + {"WalkDirFunc", Type, 16}, + }, + "io/ioutil": { + {"Discard", Var, 0}, + {"NopCloser", Func, 0}, + {"ReadAll", Func, 0}, + {"ReadDir", Func, 0}, + {"ReadFile", Func, 0}, + {"TempDir", Func, 0}, + {"TempFile", Func, 0}, + {"WriteFile", Func, 0}, + }, + "log": { + {"(*Logger).Fatal", Method, 0}, + {"(*Logger).Fatalf", Method, 0}, + {"(*Logger).Fatalln", Method, 0}, + {"(*Logger).Flags", Method, 0}, + {"(*Logger).Output", Method, 0}, + {"(*Logger).Panic", Method, 0}, + {"(*Logger).Panicf", Method, 0}, + {"(*Logger).Panicln", Method, 0}, + {"(*Logger).Prefix", Method, 0}, + {"(*Logger).Print", Method, 0}, + {"(*Logger).Printf", Method, 0}, + {"(*Logger).Println", Method, 0}, + {"(*Logger).SetFlags", Method, 0}, + {"(*Logger).SetOutput", Method, 5}, + {"(*Logger).SetPrefix", Method, 0}, + {"(*Logger).Writer", Method, 12}, + {"Default", Func, 16}, + {"Fatal", Func, 0}, + {"Fatalf", Func, 0}, + {"Fatalln", Func, 0}, + {"Flags", Func, 0}, + {"LUTC", Const, 5}, + {"Ldate", Const, 0}, + {"Llongfile", Const, 0}, + {"Lmicroseconds", Const, 0}, + {"Lmsgprefix", Const, 14}, + {"Logger", Type, 0}, + {"Lshortfile", Const, 0}, + {"LstdFlags", Const, 0}, + {"Ltime", Const, 0}, + {"New", Func, 0}, + {"Output", Func, 5}, + {"Panic", Func, 0}, + {"Panicf", Func, 0}, + {"Panicln", Func, 0}, + {"Prefix", Func, 0}, + {"Print", Func, 0}, + {"Printf", Func, 0}, + {"Println", Func, 0}, + {"SetFlags", Func, 0}, + {"SetOutput", Func, 0}, + {"SetPrefix", Func, 0}, + {"Writer", Func, 13}, + }, + "log/slog": { + {"(*JSONHandler).Enabled", Method, 21}, + {"(*JSONHandler).Handle", Method, 21}, + {"(*JSONHandler).WithAttrs", Method, 21}, + {"(*JSONHandler).WithGroup", Method, 21}, + {"(*Level).UnmarshalJSON", Method, 21}, + {"(*Level).UnmarshalText", Method, 21}, + {"(*LevelVar).Level", Method, 21}, + {"(*LevelVar).MarshalText", Method, 21}, + {"(*LevelVar).Set", Method, 21}, + {"(*LevelVar).String", Method, 21}, + {"(*LevelVar).UnmarshalText", Method, 21}, + {"(*Logger).Debug", Method, 21}, + {"(*Logger).DebugContext", Method, 21}, + {"(*Logger).Enabled", Method, 21}, + {"(*Logger).Error", Method, 21}, + {"(*Logger).ErrorContext", Method, 21}, + {"(*Logger).Handler", Method, 21}, + {"(*Logger).Info", Method, 21}, + {"(*Logger).InfoContext", Method, 21}, + {"(*Logger).Log", Method, 21}, + {"(*Logger).LogAttrs", Method, 21}, + {"(*Logger).Warn", Method, 21}, + {"(*Logger).WarnContext", Method, 21}, + {"(*Logger).With", Method, 21}, + {"(*Logger).WithGroup", Method, 21}, + {"(*Record).Add", Method, 21}, + {"(*Record).AddAttrs", Method, 21}, + {"(*TextHandler).Enabled", Method, 21}, + {"(*TextHandler).Handle", Method, 21}, + {"(*TextHandler).WithAttrs", Method, 21}, + {"(*TextHandler).WithGroup", Method, 21}, + {"(Attr).Equal", Method, 21}, + {"(Attr).String", Method, 21}, + {"(Kind).String", Method, 21}, + {"(Level).Level", Method, 21}, + {"(Level).MarshalJSON", Method, 21}, + {"(Level).MarshalText", Method, 21}, + {"(Level).String", Method, 21}, + {"(Record).Attrs", Method, 21}, + {"(Record).Clone", Method, 21}, + {"(Record).NumAttrs", Method, 21}, + {"(Value).Any", Method, 21}, + {"(Value).Bool", Method, 21}, + {"(Value).Duration", Method, 21}, + {"(Value).Equal", Method, 21}, + {"(Value).Float64", Method, 21}, + {"(Value).Group", Method, 21}, + {"(Value).Int64", Method, 21}, + {"(Value).Kind", Method, 21}, + {"(Value).LogValuer", Method, 21}, + {"(Value).Resolve", Method, 21}, + {"(Value).String", Method, 21}, + {"(Value).Time", Method, 21}, + {"(Value).Uint64", Method, 21}, + {"Any", Func, 21}, + {"AnyValue", Func, 21}, + {"Attr", Type, 21}, + {"Attr.Key", Field, 21}, + {"Attr.Value", Field, 21}, + {"Bool", Func, 21}, + {"BoolValue", Func, 21}, + {"Debug", Func, 21}, + {"DebugContext", Func, 21}, + {"Default", Func, 21}, + {"Duration", Func, 21}, + {"DurationValue", Func, 21}, + {"Error", Func, 21}, + {"ErrorContext", Func, 21}, + {"Float64", Func, 21}, + {"Float64Value", Func, 21}, + {"Group", Func, 21}, + {"GroupValue", Func, 21}, + {"Handler", Type, 21}, + {"HandlerOptions", Type, 21}, + {"HandlerOptions.AddSource", Field, 21}, + {"HandlerOptions.Level", Field, 21}, + {"HandlerOptions.ReplaceAttr", Field, 21}, + {"Info", Func, 21}, + {"InfoContext", Func, 21}, + {"Int", Func, 21}, + {"Int64", Func, 21}, + {"Int64Value", Func, 21}, + {"IntValue", Func, 21}, + {"JSONHandler", Type, 21}, + {"Kind", Type, 21}, + {"KindAny", Const, 21}, + {"KindBool", Const, 21}, + {"KindDuration", Const, 21}, + {"KindFloat64", Const, 21}, + {"KindGroup", Const, 21}, + {"KindInt64", Const, 21}, + {"KindLogValuer", Const, 21}, + {"KindString", Const, 21}, + {"KindTime", Const, 21}, + {"KindUint64", Const, 21}, + {"Level", Type, 21}, + {"LevelDebug", Const, 21}, + {"LevelError", Const, 21}, + {"LevelInfo", Const, 21}, + {"LevelKey", Const, 21}, + {"LevelVar", Type, 21}, + {"LevelWarn", Const, 21}, + {"Leveler", Type, 21}, + {"Log", Func, 21}, + {"LogAttrs", Func, 21}, + {"LogValuer", Type, 21}, + {"Logger", Type, 21}, + {"MessageKey", Const, 21}, + {"New", Func, 21}, + {"NewJSONHandler", Func, 21}, + {"NewLogLogger", Func, 21}, + {"NewRecord", Func, 21}, + {"NewTextHandler", Func, 21}, + {"Record", Type, 21}, + {"Record.Level", Field, 21}, + {"Record.Message", Field, 21}, + {"Record.PC", Field, 21}, + {"Record.Time", Field, 21}, + {"SetDefault", Func, 21}, + {"SetLogLoggerLevel", Func, 22}, + {"Source", Type, 21}, + {"Source.File", Field, 21}, + {"Source.Function", Field, 21}, + {"Source.Line", Field, 21}, + {"SourceKey", Const, 21}, + {"String", Func, 21}, + {"StringValue", Func, 21}, + {"TextHandler", Type, 21}, + {"Time", Func, 21}, + {"TimeKey", Const, 21}, + {"TimeValue", Func, 21}, + {"Uint64", Func, 21}, + {"Uint64Value", Func, 21}, + {"Value", Type, 21}, + {"Warn", Func, 21}, + {"WarnContext", Func, 21}, + {"With", Func, 21}, + }, + "log/syslog": { + {"(*Writer).Alert", Method, 0}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).Crit", Method, 0}, + {"(*Writer).Debug", Method, 0}, + {"(*Writer).Emerg", Method, 0}, + {"(*Writer).Err", Method, 0}, + {"(*Writer).Info", Method, 0}, + {"(*Writer).Notice", Method, 0}, + {"(*Writer).Warning", Method, 0}, + {"(*Writer).Write", Method, 0}, + {"Dial", Func, 0}, + {"LOG_ALERT", Const, 0}, + {"LOG_AUTH", Const, 1}, + {"LOG_AUTHPRIV", Const, 1}, + {"LOG_CRIT", Const, 0}, + {"LOG_CRON", Const, 1}, + {"LOG_DAEMON", Const, 1}, + {"LOG_DEBUG", Const, 0}, + {"LOG_EMERG", Const, 0}, + {"LOG_ERR", Const, 0}, + {"LOG_FTP", Const, 1}, + {"LOG_INFO", Const, 0}, + {"LOG_KERN", Const, 1}, + {"LOG_LOCAL0", Const, 1}, + {"LOG_LOCAL1", Const, 1}, + {"LOG_LOCAL2", Const, 1}, + {"LOG_LOCAL3", Const, 1}, + {"LOG_LOCAL4", Const, 1}, + {"LOG_LOCAL5", Const, 1}, + {"LOG_LOCAL6", Const, 1}, + {"LOG_LOCAL7", Const, 1}, + {"LOG_LPR", Const, 1}, + {"LOG_MAIL", Const, 1}, + {"LOG_NEWS", Const, 1}, + {"LOG_NOTICE", Const, 0}, + {"LOG_SYSLOG", Const, 1}, + {"LOG_USER", Const, 1}, + {"LOG_UUCP", Const, 1}, + {"LOG_WARNING", Const, 0}, + {"New", Func, 0}, + {"NewLogger", Func, 0}, + {"Priority", Type, 0}, + {"Writer", Type, 0}, + }, + "maps": { + {"Clone", Func, 21}, + {"Copy", Func, 21}, + {"DeleteFunc", Func, 21}, + {"Equal", Func, 21}, + {"EqualFunc", Func, 21}, + }, + "math": { + {"Abs", Func, 0}, + {"Acos", Func, 0}, + {"Acosh", Func, 0}, + {"Asin", Func, 0}, + {"Asinh", Func, 0}, + {"Atan", Func, 0}, + {"Atan2", Func, 0}, + {"Atanh", Func, 0}, + {"Cbrt", Func, 0}, + {"Ceil", Func, 0}, + {"Copysign", Func, 0}, + {"Cos", Func, 0}, + {"Cosh", Func, 0}, + {"Dim", Func, 0}, + {"E", Const, 0}, + {"Erf", Func, 0}, + {"Erfc", Func, 0}, + {"Erfcinv", Func, 10}, + {"Erfinv", Func, 10}, + {"Exp", Func, 0}, + {"Exp2", Func, 0}, + {"Expm1", Func, 0}, + {"FMA", Func, 14}, + {"Float32bits", Func, 0}, + {"Float32frombits", Func, 0}, + {"Float64bits", Func, 0}, + {"Float64frombits", Func, 0}, + {"Floor", Func, 0}, + {"Frexp", Func, 0}, + {"Gamma", Func, 0}, + {"Hypot", Func, 0}, + {"Ilogb", Func, 0}, + {"Inf", Func, 0}, + {"IsInf", Func, 0}, + {"IsNaN", Func, 0}, + {"J0", Func, 0}, + {"J1", Func, 0}, + {"Jn", Func, 0}, + {"Ldexp", Func, 0}, + {"Lgamma", Func, 0}, + {"Ln10", Const, 0}, + {"Ln2", Const, 0}, + {"Log", Func, 0}, + {"Log10", Func, 0}, + {"Log10E", Const, 0}, + {"Log1p", Func, 0}, + {"Log2", Func, 0}, + {"Log2E", Const, 0}, + {"Logb", Func, 0}, + {"Max", Func, 0}, + {"MaxFloat32", Const, 0}, + {"MaxFloat64", Const, 0}, + {"MaxInt", Const, 17}, + {"MaxInt16", Const, 0}, + {"MaxInt32", Const, 0}, + {"MaxInt64", Const, 0}, + {"MaxInt8", Const, 0}, + {"MaxUint", Const, 17}, + {"MaxUint16", Const, 0}, + {"MaxUint32", Const, 0}, + {"MaxUint64", Const, 0}, + {"MaxUint8", Const, 0}, + {"Min", Func, 0}, + {"MinInt", Const, 17}, + {"MinInt16", Const, 0}, + {"MinInt32", Const, 0}, + {"MinInt64", Const, 0}, + {"MinInt8", Const, 0}, + {"Mod", Func, 0}, + {"Modf", Func, 0}, + {"NaN", Func, 0}, + {"Nextafter", Func, 0}, + {"Nextafter32", Func, 4}, + {"Phi", Const, 0}, + {"Pi", Const, 0}, + {"Pow", Func, 0}, + {"Pow10", Func, 0}, + {"Remainder", Func, 0}, + {"Round", Func, 10}, + {"RoundToEven", Func, 10}, + {"Signbit", Func, 0}, + {"Sin", Func, 0}, + {"Sincos", Func, 0}, + {"Sinh", Func, 0}, + {"SmallestNonzeroFloat32", Const, 0}, + {"SmallestNonzeroFloat64", Const, 0}, + {"Sqrt", Func, 0}, + {"Sqrt2", Const, 0}, + {"SqrtE", Const, 0}, + {"SqrtPhi", Const, 0}, + {"SqrtPi", Const, 0}, + {"Tan", Func, 0}, + {"Tanh", Func, 0}, + {"Trunc", Func, 0}, + {"Y0", Func, 0}, + {"Y1", Func, 0}, + {"Yn", Func, 0}, + }, + "math/big": { + {"(*Float).Abs", Method, 5}, + {"(*Float).Acc", Method, 5}, + {"(*Float).Add", Method, 5}, + {"(*Float).Append", Method, 5}, + {"(*Float).Cmp", Method, 5}, + {"(*Float).Copy", Method, 5}, + {"(*Float).Float32", Method, 5}, + {"(*Float).Float64", Method, 5}, + {"(*Float).Format", Method, 5}, + {"(*Float).GobDecode", Method, 7}, + {"(*Float).GobEncode", Method, 7}, + {"(*Float).Int", Method, 5}, + {"(*Float).Int64", Method, 5}, + {"(*Float).IsInf", Method, 5}, + {"(*Float).IsInt", Method, 5}, + {"(*Float).MantExp", Method, 5}, + {"(*Float).MarshalText", Method, 6}, + {"(*Float).MinPrec", Method, 5}, + {"(*Float).Mode", Method, 5}, + {"(*Float).Mul", Method, 5}, + {"(*Float).Neg", Method, 5}, + {"(*Float).Parse", Method, 5}, + {"(*Float).Prec", Method, 5}, + {"(*Float).Quo", Method, 5}, + {"(*Float).Rat", Method, 5}, + {"(*Float).Scan", Method, 8}, + {"(*Float).Set", Method, 5}, + {"(*Float).SetFloat64", Method, 5}, + {"(*Float).SetInf", Method, 5}, + {"(*Float).SetInt", Method, 5}, + {"(*Float).SetInt64", Method, 5}, + {"(*Float).SetMantExp", Method, 5}, + {"(*Float).SetMode", Method, 5}, + {"(*Float).SetPrec", Method, 5}, + {"(*Float).SetRat", Method, 5}, + {"(*Float).SetString", Method, 5}, + {"(*Float).SetUint64", Method, 5}, + {"(*Float).Sign", Method, 5}, + {"(*Float).Signbit", Method, 5}, + {"(*Float).Sqrt", Method, 10}, + {"(*Float).String", Method, 5}, + {"(*Float).Sub", Method, 5}, + {"(*Float).Text", Method, 5}, + {"(*Float).Uint64", Method, 5}, + {"(*Float).UnmarshalText", Method, 6}, + {"(*Int).Abs", Method, 0}, + {"(*Int).Add", Method, 0}, + {"(*Int).And", Method, 0}, + {"(*Int).AndNot", Method, 0}, + {"(*Int).Append", Method, 6}, + {"(*Int).Binomial", Method, 0}, + {"(*Int).Bit", Method, 0}, + {"(*Int).BitLen", Method, 0}, + {"(*Int).Bits", Method, 0}, + {"(*Int).Bytes", Method, 0}, + {"(*Int).Cmp", Method, 0}, + {"(*Int).CmpAbs", Method, 10}, + {"(*Int).Div", Method, 0}, + {"(*Int).DivMod", Method, 0}, + {"(*Int).Exp", Method, 0}, + {"(*Int).FillBytes", Method, 15}, + {"(*Int).Float64", Method, 21}, + {"(*Int).Format", Method, 0}, + {"(*Int).GCD", Method, 0}, + {"(*Int).GobDecode", Method, 0}, + {"(*Int).GobEncode", Method, 0}, + {"(*Int).Int64", Method, 0}, + {"(*Int).IsInt64", Method, 9}, + {"(*Int).IsUint64", Method, 9}, + {"(*Int).Lsh", Method, 0}, + {"(*Int).MarshalJSON", Method, 1}, + {"(*Int).MarshalText", Method, 3}, + {"(*Int).Mod", Method, 0}, + {"(*Int).ModInverse", Method, 0}, + {"(*Int).ModSqrt", Method, 5}, + {"(*Int).Mul", Method, 0}, + {"(*Int).MulRange", Method, 0}, + {"(*Int).Neg", Method, 0}, + {"(*Int).Not", Method, 0}, + {"(*Int).Or", Method, 0}, + {"(*Int).ProbablyPrime", Method, 0}, + {"(*Int).Quo", Method, 0}, + {"(*Int).QuoRem", Method, 0}, + {"(*Int).Rand", Method, 0}, + {"(*Int).Rem", Method, 0}, + {"(*Int).Rsh", Method, 0}, + {"(*Int).Scan", Method, 0}, + {"(*Int).Set", Method, 0}, + {"(*Int).SetBit", Method, 0}, + {"(*Int).SetBits", Method, 0}, + {"(*Int).SetBytes", Method, 0}, + {"(*Int).SetInt64", Method, 0}, + {"(*Int).SetString", Method, 0}, + {"(*Int).SetUint64", Method, 1}, + {"(*Int).Sign", Method, 0}, + {"(*Int).Sqrt", Method, 8}, + {"(*Int).String", Method, 0}, + {"(*Int).Sub", Method, 0}, + {"(*Int).Text", Method, 6}, + {"(*Int).TrailingZeroBits", Method, 13}, + {"(*Int).Uint64", Method, 1}, + {"(*Int).UnmarshalJSON", Method, 1}, + {"(*Int).UnmarshalText", Method, 3}, + {"(*Int).Xor", Method, 0}, + {"(*Rat).Abs", Method, 0}, + {"(*Rat).Add", Method, 0}, + {"(*Rat).Cmp", Method, 0}, + {"(*Rat).Denom", Method, 0}, + {"(*Rat).Float32", Method, 4}, + {"(*Rat).Float64", Method, 1}, + {"(*Rat).FloatPrec", Method, 22}, + {"(*Rat).FloatString", Method, 0}, + {"(*Rat).GobDecode", Method, 0}, + {"(*Rat).GobEncode", Method, 0}, + {"(*Rat).Inv", Method, 0}, + {"(*Rat).IsInt", Method, 0}, + {"(*Rat).MarshalText", Method, 3}, + {"(*Rat).Mul", Method, 0}, + {"(*Rat).Neg", Method, 0}, + {"(*Rat).Num", Method, 0}, + {"(*Rat).Quo", Method, 0}, + {"(*Rat).RatString", Method, 0}, + {"(*Rat).Scan", Method, 0}, + {"(*Rat).Set", Method, 0}, + {"(*Rat).SetFloat64", Method, 1}, + {"(*Rat).SetFrac", Method, 0}, + {"(*Rat).SetFrac64", Method, 0}, + {"(*Rat).SetInt", Method, 0}, + {"(*Rat).SetInt64", Method, 0}, + {"(*Rat).SetString", Method, 0}, + {"(*Rat).SetUint64", Method, 13}, + {"(*Rat).Sign", Method, 0}, + {"(*Rat).String", Method, 0}, + {"(*Rat).Sub", Method, 0}, + {"(*Rat).UnmarshalText", Method, 3}, + {"(Accuracy).String", Method, 5}, + {"(ErrNaN).Error", Method, 5}, + {"(RoundingMode).String", Method, 5}, + {"Above", Const, 5}, + {"Accuracy", Type, 5}, + {"AwayFromZero", Const, 5}, + {"Below", Const, 5}, + {"ErrNaN", Type, 5}, + {"Exact", Const, 5}, + {"Float", Type, 5}, + {"Int", Type, 0}, + {"Jacobi", Func, 5}, + {"MaxBase", Const, 0}, + {"MaxExp", Const, 5}, + {"MaxPrec", Const, 5}, + {"MinExp", Const, 5}, + {"NewFloat", Func, 5}, + {"NewInt", Func, 0}, + {"NewRat", Func, 0}, + {"ParseFloat", Func, 5}, + {"Rat", Type, 0}, + {"RoundingMode", Type, 5}, + {"ToNearestAway", Const, 5}, + {"ToNearestEven", Const, 5}, + {"ToNegativeInf", Const, 5}, + {"ToPositiveInf", Const, 5}, + {"ToZero", Const, 5}, + {"Word", Type, 0}, + }, + "math/bits": { + {"Add", Func, 12}, + {"Add32", Func, 12}, + {"Add64", Func, 12}, + {"Div", Func, 12}, + {"Div32", Func, 12}, + {"Div64", Func, 12}, + {"LeadingZeros", Func, 9}, + {"LeadingZeros16", Func, 9}, + {"LeadingZeros32", Func, 9}, + {"LeadingZeros64", Func, 9}, + {"LeadingZeros8", Func, 9}, + {"Len", Func, 9}, + {"Len16", Func, 9}, + {"Len32", Func, 9}, + {"Len64", Func, 9}, + {"Len8", Func, 9}, + {"Mul", Func, 12}, + {"Mul32", Func, 12}, + {"Mul64", Func, 12}, + {"OnesCount", Func, 9}, + {"OnesCount16", Func, 9}, + {"OnesCount32", Func, 9}, + {"OnesCount64", Func, 9}, + {"OnesCount8", Func, 9}, + {"Rem", Func, 14}, + {"Rem32", Func, 14}, + {"Rem64", Func, 14}, + {"Reverse", Func, 9}, + {"Reverse16", Func, 9}, + {"Reverse32", Func, 9}, + {"Reverse64", Func, 9}, + {"Reverse8", Func, 9}, + {"ReverseBytes", Func, 9}, + {"ReverseBytes16", Func, 9}, + {"ReverseBytes32", Func, 9}, + {"ReverseBytes64", Func, 9}, + {"RotateLeft", Func, 9}, + {"RotateLeft16", Func, 9}, + {"RotateLeft32", Func, 9}, + {"RotateLeft64", Func, 9}, + {"RotateLeft8", Func, 9}, + {"Sub", Func, 12}, + {"Sub32", Func, 12}, + {"Sub64", Func, 12}, + {"TrailingZeros", Func, 9}, + {"TrailingZeros16", Func, 9}, + {"TrailingZeros32", Func, 9}, + {"TrailingZeros64", Func, 9}, + {"TrailingZeros8", Func, 9}, + {"UintSize", Const, 9}, + }, + "math/cmplx": { + {"Abs", Func, 0}, + {"Acos", Func, 0}, + {"Acosh", Func, 0}, + {"Asin", Func, 0}, + {"Asinh", Func, 0}, + {"Atan", Func, 0}, + {"Atanh", Func, 0}, + {"Conj", Func, 0}, + {"Cos", Func, 0}, + {"Cosh", Func, 0}, + {"Cot", Func, 0}, + {"Exp", Func, 0}, + {"Inf", Func, 0}, + {"IsInf", Func, 0}, + {"IsNaN", Func, 0}, + {"Log", Func, 0}, + {"Log10", Func, 0}, + {"NaN", Func, 0}, + {"Phase", Func, 0}, + {"Polar", Func, 0}, + {"Pow", Func, 0}, + {"Rect", Func, 0}, + {"Sin", Func, 0}, + {"Sinh", Func, 0}, + {"Sqrt", Func, 0}, + {"Tan", Func, 0}, + {"Tanh", Func, 0}, + }, + "math/rand": { + {"(*Rand).ExpFloat64", Method, 0}, + {"(*Rand).Float32", Method, 0}, + {"(*Rand).Float64", Method, 0}, + {"(*Rand).Int", Method, 0}, + {"(*Rand).Int31", Method, 0}, + {"(*Rand).Int31n", Method, 0}, + {"(*Rand).Int63", Method, 0}, + {"(*Rand).Int63n", Method, 0}, + {"(*Rand).Intn", Method, 0}, + {"(*Rand).NormFloat64", Method, 0}, + {"(*Rand).Perm", Method, 0}, + {"(*Rand).Read", Method, 6}, + {"(*Rand).Seed", Method, 0}, + {"(*Rand).Shuffle", Method, 10}, + {"(*Rand).Uint32", Method, 0}, + {"(*Rand).Uint64", Method, 8}, + {"(*Zipf).Uint64", Method, 0}, + {"ExpFloat64", Func, 0}, + {"Float32", Func, 0}, + {"Float64", Func, 0}, + {"Int", Func, 0}, + {"Int31", Func, 0}, + {"Int31n", Func, 0}, + {"Int63", Func, 0}, + {"Int63n", Func, 0}, + {"Intn", Func, 0}, + {"New", Func, 0}, + {"NewSource", Func, 0}, + {"NewZipf", Func, 0}, + {"NormFloat64", Func, 0}, + {"Perm", Func, 0}, + {"Rand", Type, 0}, + {"Read", Func, 6}, + {"Seed", Func, 0}, + {"Shuffle", Func, 10}, + {"Source", Type, 0}, + {"Source64", Type, 8}, + {"Uint32", Func, 0}, + {"Uint64", Func, 8}, + {"Zipf", Type, 0}, + }, + "math/rand/v2": { + {"(*ChaCha8).MarshalBinary", Method, 22}, + {"(*ChaCha8).Seed", Method, 22}, + {"(*ChaCha8).Uint64", Method, 22}, + {"(*ChaCha8).UnmarshalBinary", Method, 22}, + {"(*PCG).MarshalBinary", Method, 22}, + {"(*PCG).Seed", Method, 22}, + {"(*PCG).Uint64", Method, 22}, + {"(*PCG).UnmarshalBinary", Method, 22}, + {"(*Rand).ExpFloat64", Method, 22}, + {"(*Rand).Float32", Method, 22}, + {"(*Rand).Float64", Method, 22}, + {"(*Rand).Int", Method, 22}, + {"(*Rand).Int32", Method, 22}, + {"(*Rand).Int32N", Method, 22}, + {"(*Rand).Int64", Method, 22}, + {"(*Rand).Int64N", Method, 22}, + {"(*Rand).IntN", Method, 22}, + {"(*Rand).NormFloat64", Method, 22}, + {"(*Rand).Perm", Method, 22}, + {"(*Rand).Shuffle", Method, 22}, + {"(*Rand).Uint32", Method, 22}, + {"(*Rand).Uint32N", Method, 22}, + {"(*Rand).Uint64", Method, 22}, + {"(*Rand).Uint64N", Method, 22}, + {"(*Rand).UintN", Method, 22}, + {"(*Zipf).Uint64", Method, 22}, + {"ChaCha8", Type, 22}, + {"ExpFloat64", Func, 22}, + {"Float32", Func, 22}, + {"Float64", Func, 22}, + {"Int", Func, 22}, + {"Int32", Func, 22}, + {"Int32N", Func, 22}, + {"Int64", Func, 22}, + {"Int64N", Func, 22}, + {"IntN", Func, 22}, + {"N", Func, 22}, + {"New", Func, 22}, + {"NewChaCha8", Func, 22}, + {"NewPCG", Func, 22}, + {"NewZipf", Func, 22}, + {"NormFloat64", Func, 22}, + {"PCG", Type, 22}, + {"Perm", Func, 22}, + {"Rand", Type, 22}, + {"Shuffle", Func, 22}, + {"Source", Type, 22}, + {"Uint32", Func, 22}, + {"Uint32N", Func, 22}, + {"Uint64", Func, 22}, + {"Uint64N", Func, 22}, + {"UintN", Func, 22}, + {"Zipf", Type, 22}, + }, + "mime": { + {"(*WordDecoder).Decode", Method, 5}, + {"(*WordDecoder).DecodeHeader", Method, 5}, + {"(WordEncoder).Encode", Method, 5}, + {"AddExtensionType", Func, 0}, + {"BEncoding", Const, 5}, + {"ErrInvalidMediaParameter", Var, 9}, + {"ExtensionsByType", Func, 5}, + {"FormatMediaType", Func, 0}, + {"ParseMediaType", Func, 0}, + {"QEncoding", Const, 5}, + {"TypeByExtension", Func, 0}, + {"WordDecoder", Type, 5}, + {"WordDecoder.CharsetReader", Field, 5}, + {"WordEncoder", Type, 5}, + }, + "mime/multipart": { + {"(*FileHeader).Open", Method, 0}, + {"(*Form).RemoveAll", Method, 0}, + {"(*Part).Close", Method, 0}, + {"(*Part).FileName", Method, 0}, + {"(*Part).FormName", Method, 0}, + {"(*Part).Read", Method, 0}, + {"(*Reader).NextPart", Method, 0}, + {"(*Reader).NextRawPart", Method, 14}, + {"(*Reader).ReadForm", Method, 0}, + {"(*Writer).Boundary", Method, 0}, + {"(*Writer).Close", Method, 0}, + {"(*Writer).CreateFormField", Method, 0}, + {"(*Writer).CreateFormFile", Method, 0}, + {"(*Writer).CreatePart", Method, 0}, + {"(*Writer).FormDataContentType", Method, 0}, + {"(*Writer).SetBoundary", Method, 1}, + {"(*Writer).WriteField", Method, 0}, + {"ErrMessageTooLarge", Var, 9}, + {"File", Type, 0}, + {"FileHeader", Type, 0}, + {"FileHeader.Filename", Field, 0}, + {"FileHeader.Header", Field, 0}, + {"FileHeader.Size", Field, 9}, + {"Form", Type, 0}, + {"Form.File", Field, 0}, + {"Form.Value", Field, 0}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"Part", Type, 0}, + {"Part.Header", Field, 0}, + {"Reader", Type, 0}, + {"Writer", Type, 0}, + }, + "mime/quotedprintable": { + {"(*Reader).Read", Method, 5}, + {"(*Writer).Close", Method, 5}, + {"(*Writer).Write", Method, 5}, + {"NewReader", Func, 5}, + {"NewWriter", Func, 5}, + {"Reader", Type, 5}, + {"Writer", Type, 5}, + {"Writer.Binary", Field, 5}, + }, + "net": { + {"(*AddrError).Error", Method, 0}, + {"(*AddrError).Temporary", Method, 0}, + {"(*AddrError).Timeout", Method, 0}, + {"(*Buffers).Read", Method, 8}, + {"(*Buffers).WriteTo", Method, 8}, + {"(*DNSConfigError).Error", Method, 0}, + {"(*DNSConfigError).Temporary", Method, 0}, + {"(*DNSConfigError).Timeout", Method, 0}, + {"(*DNSConfigError).Unwrap", Method, 13}, + {"(*DNSError).Error", Method, 0}, + {"(*DNSError).Temporary", Method, 0}, + {"(*DNSError).Timeout", Method, 0}, + {"(*Dialer).Dial", Method, 1}, + {"(*Dialer).DialContext", Method, 7}, + {"(*Dialer).MultipathTCP", Method, 21}, + {"(*Dialer).SetMultipathTCP", Method, 21}, + {"(*IP).UnmarshalText", Method, 2}, + {"(*IPAddr).Network", Method, 0}, + {"(*IPAddr).String", Method, 0}, + {"(*IPConn).Close", Method, 0}, + {"(*IPConn).File", Method, 0}, + {"(*IPConn).LocalAddr", Method, 0}, + {"(*IPConn).Read", Method, 0}, + {"(*IPConn).ReadFrom", Method, 0}, + {"(*IPConn).ReadFromIP", Method, 0}, + {"(*IPConn).ReadMsgIP", Method, 1}, + {"(*IPConn).RemoteAddr", Method, 0}, + {"(*IPConn).SetDeadline", Method, 0}, + {"(*IPConn).SetReadBuffer", Method, 0}, + {"(*IPConn).SetReadDeadline", Method, 0}, + {"(*IPConn).SetWriteBuffer", Method, 0}, + {"(*IPConn).SetWriteDeadline", Method, 0}, + {"(*IPConn).SyscallConn", Method, 9}, + {"(*IPConn).Write", Method, 0}, + {"(*IPConn).WriteMsgIP", Method, 1}, + {"(*IPConn).WriteTo", Method, 0}, + {"(*IPConn).WriteToIP", Method, 0}, + {"(*IPNet).Contains", Method, 0}, + {"(*IPNet).Network", Method, 0}, + {"(*IPNet).String", Method, 0}, + {"(*Interface).Addrs", Method, 0}, + {"(*Interface).MulticastAddrs", Method, 0}, + {"(*ListenConfig).Listen", Method, 11}, + {"(*ListenConfig).ListenPacket", Method, 11}, + {"(*ListenConfig).MultipathTCP", Method, 21}, + {"(*ListenConfig).SetMultipathTCP", Method, 21}, + {"(*OpError).Error", Method, 0}, + {"(*OpError).Temporary", Method, 0}, + {"(*OpError).Timeout", Method, 0}, + {"(*OpError).Unwrap", Method, 13}, + {"(*ParseError).Error", Method, 0}, + {"(*ParseError).Temporary", Method, 17}, + {"(*ParseError).Timeout", Method, 17}, + {"(*Resolver).LookupAddr", Method, 8}, + {"(*Resolver).LookupCNAME", Method, 8}, + {"(*Resolver).LookupHost", Method, 8}, + {"(*Resolver).LookupIP", Method, 15}, + {"(*Resolver).LookupIPAddr", Method, 8}, + {"(*Resolver).LookupMX", Method, 8}, + {"(*Resolver).LookupNS", Method, 8}, + {"(*Resolver).LookupNetIP", Method, 18}, + {"(*Resolver).LookupPort", Method, 8}, + {"(*Resolver).LookupSRV", Method, 8}, + {"(*Resolver).LookupTXT", Method, 8}, + {"(*TCPAddr).AddrPort", Method, 18}, + {"(*TCPAddr).Network", Method, 0}, + {"(*TCPAddr).String", Method, 0}, + {"(*TCPConn).Close", Method, 0}, + {"(*TCPConn).CloseRead", Method, 0}, + {"(*TCPConn).CloseWrite", Method, 0}, + {"(*TCPConn).File", Method, 0}, + {"(*TCPConn).LocalAddr", Method, 0}, + {"(*TCPConn).MultipathTCP", Method, 21}, + {"(*TCPConn).Read", Method, 0}, + {"(*TCPConn).ReadFrom", Method, 0}, + {"(*TCPConn).RemoteAddr", Method, 0}, + {"(*TCPConn).SetDeadline", Method, 0}, + {"(*TCPConn).SetKeepAlive", Method, 0}, + {"(*TCPConn).SetKeepAlivePeriod", Method, 2}, + {"(*TCPConn).SetLinger", Method, 0}, + {"(*TCPConn).SetNoDelay", Method, 0}, + {"(*TCPConn).SetReadBuffer", Method, 0}, + {"(*TCPConn).SetReadDeadline", Method, 0}, + {"(*TCPConn).SetWriteBuffer", Method, 0}, + {"(*TCPConn).SetWriteDeadline", Method, 0}, + {"(*TCPConn).SyscallConn", Method, 9}, + {"(*TCPConn).Write", Method, 0}, + {"(*TCPConn).WriteTo", Method, 22}, + {"(*TCPListener).Accept", Method, 0}, + {"(*TCPListener).AcceptTCP", Method, 0}, + {"(*TCPListener).Addr", Method, 0}, + {"(*TCPListener).Close", Method, 0}, + {"(*TCPListener).File", Method, 0}, + {"(*TCPListener).SetDeadline", Method, 0}, + {"(*TCPListener).SyscallConn", Method, 10}, + {"(*UDPAddr).AddrPort", Method, 18}, + {"(*UDPAddr).Network", Method, 0}, + {"(*UDPAddr).String", Method, 0}, + {"(*UDPConn).Close", Method, 0}, + {"(*UDPConn).File", Method, 0}, + {"(*UDPConn).LocalAddr", Method, 0}, + {"(*UDPConn).Read", Method, 0}, + {"(*UDPConn).ReadFrom", Method, 0}, + {"(*UDPConn).ReadFromUDP", Method, 0}, + {"(*UDPConn).ReadFromUDPAddrPort", Method, 18}, + {"(*UDPConn).ReadMsgUDP", Method, 1}, + {"(*UDPConn).ReadMsgUDPAddrPort", Method, 18}, + {"(*UDPConn).RemoteAddr", Method, 0}, + {"(*UDPConn).SetDeadline", Method, 0}, + {"(*UDPConn).SetReadBuffer", Method, 0}, + {"(*UDPConn).SetReadDeadline", Method, 0}, + {"(*UDPConn).SetWriteBuffer", Method, 0}, + {"(*UDPConn).SetWriteDeadline", Method, 0}, + {"(*UDPConn).SyscallConn", Method, 9}, + {"(*UDPConn).Write", Method, 0}, + {"(*UDPConn).WriteMsgUDP", Method, 1}, + {"(*UDPConn).WriteMsgUDPAddrPort", Method, 18}, + {"(*UDPConn).WriteTo", Method, 0}, + {"(*UDPConn).WriteToUDP", Method, 0}, + {"(*UDPConn).WriteToUDPAddrPort", Method, 18}, + {"(*UnixAddr).Network", Method, 0}, + {"(*UnixAddr).String", Method, 0}, + {"(*UnixConn).Close", Method, 0}, + {"(*UnixConn).CloseRead", Method, 1}, + {"(*UnixConn).CloseWrite", Method, 1}, + {"(*UnixConn).File", Method, 0}, + {"(*UnixConn).LocalAddr", Method, 0}, + {"(*UnixConn).Read", Method, 0}, + {"(*UnixConn).ReadFrom", Method, 0}, + {"(*UnixConn).ReadFromUnix", Method, 0}, + {"(*UnixConn).ReadMsgUnix", Method, 0}, + {"(*UnixConn).RemoteAddr", Method, 0}, + {"(*UnixConn).SetDeadline", Method, 0}, + {"(*UnixConn).SetReadBuffer", Method, 0}, + {"(*UnixConn).SetReadDeadline", Method, 0}, + {"(*UnixConn).SetWriteBuffer", Method, 0}, + {"(*UnixConn).SetWriteDeadline", Method, 0}, + {"(*UnixConn).SyscallConn", Method, 9}, + {"(*UnixConn).Write", Method, 0}, + {"(*UnixConn).WriteMsgUnix", Method, 0}, + {"(*UnixConn).WriteTo", Method, 0}, + {"(*UnixConn).WriteToUnix", Method, 0}, + {"(*UnixListener).Accept", Method, 0}, + {"(*UnixListener).AcceptUnix", Method, 0}, + {"(*UnixListener).Addr", Method, 0}, + {"(*UnixListener).Close", Method, 0}, + {"(*UnixListener).File", Method, 0}, + {"(*UnixListener).SetDeadline", Method, 0}, + {"(*UnixListener).SetUnlinkOnClose", Method, 8}, + {"(*UnixListener).SyscallConn", Method, 10}, + {"(Flags).String", Method, 0}, + {"(HardwareAddr).String", Method, 0}, + {"(IP).DefaultMask", Method, 0}, + {"(IP).Equal", Method, 0}, + {"(IP).IsGlobalUnicast", Method, 0}, + {"(IP).IsInterfaceLocalMulticast", Method, 0}, + {"(IP).IsLinkLocalMulticast", Method, 0}, + {"(IP).IsLinkLocalUnicast", Method, 0}, + {"(IP).IsLoopback", Method, 0}, + {"(IP).IsMulticast", Method, 0}, + {"(IP).IsPrivate", Method, 17}, + {"(IP).IsUnspecified", Method, 0}, + {"(IP).MarshalText", Method, 2}, + {"(IP).Mask", Method, 0}, + {"(IP).String", Method, 0}, + {"(IP).To16", Method, 0}, + {"(IP).To4", Method, 0}, + {"(IPMask).Size", Method, 0}, + {"(IPMask).String", Method, 0}, + {"(InvalidAddrError).Error", Method, 0}, + {"(InvalidAddrError).Temporary", Method, 0}, + {"(InvalidAddrError).Timeout", Method, 0}, + {"(UnknownNetworkError).Error", Method, 0}, + {"(UnknownNetworkError).Temporary", Method, 0}, + {"(UnknownNetworkError).Timeout", Method, 0}, + {"Addr", Type, 0}, + {"AddrError", Type, 0}, + {"AddrError.Addr", Field, 0}, + {"AddrError.Err", Field, 0}, + {"Buffers", Type, 8}, + {"CIDRMask", Func, 0}, + {"Conn", Type, 0}, + {"DNSConfigError", Type, 0}, + {"DNSConfigError.Err", Field, 0}, + {"DNSError", Type, 0}, + {"DNSError.Err", Field, 0}, + {"DNSError.IsNotFound", Field, 13}, + {"DNSError.IsTemporary", Field, 6}, + {"DNSError.IsTimeout", Field, 0}, + {"DNSError.Name", Field, 0}, + {"DNSError.Server", Field, 0}, + {"DefaultResolver", Var, 8}, + {"Dial", Func, 0}, + {"DialIP", Func, 0}, + {"DialTCP", Func, 0}, + {"DialTimeout", Func, 0}, + {"DialUDP", Func, 0}, + {"DialUnix", Func, 0}, + {"Dialer", Type, 1}, + {"Dialer.Cancel", Field, 6}, + {"Dialer.Control", Field, 11}, + {"Dialer.ControlContext", Field, 20}, + {"Dialer.Deadline", Field, 1}, + {"Dialer.DualStack", Field, 2}, + {"Dialer.FallbackDelay", Field, 5}, + {"Dialer.KeepAlive", Field, 3}, + {"Dialer.LocalAddr", Field, 1}, + {"Dialer.Resolver", Field, 8}, + {"Dialer.Timeout", Field, 1}, + {"ErrClosed", Var, 16}, + {"ErrWriteToConnected", Var, 0}, + {"Error", Type, 0}, + {"FileConn", Func, 0}, + {"FileListener", Func, 0}, + {"FilePacketConn", Func, 0}, + {"FlagBroadcast", Const, 0}, + {"FlagLoopback", Const, 0}, + {"FlagMulticast", Const, 0}, + {"FlagPointToPoint", Const, 0}, + {"FlagRunning", Const, 20}, + {"FlagUp", Const, 0}, + {"Flags", Type, 0}, + {"HardwareAddr", Type, 0}, + {"IP", Type, 0}, + {"IPAddr", Type, 0}, + {"IPAddr.IP", Field, 0}, + {"IPAddr.Zone", Field, 1}, + {"IPConn", Type, 0}, + {"IPMask", Type, 0}, + {"IPNet", Type, 0}, + {"IPNet.IP", Field, 0}, + {"IPNet.Mask", Field, 0}, + {"IPv4", Func, 0}, + {"IPv4Mask", Func, 0}, + {"IPv4allrouter", Var, 0}, + {"IPv4allsys", Var, 0}, + {"IPv4bcast", Var, 0}, + {"IPv4len", Const, 0}, + {"IPv4zero", Var, 0}, + {"IPv6interfacelocalallnodes", Var, 0}, + {"IPv6len", Const, 0}, + {"IPv6linklocalallnodes", Var, 0}, + {"IPv6linklocalallrouters", Var, 0}, + {"IPv6loopback", Var, 0}, + {"IPv6unspecified", Var, 0}, + {"IPv6zero", Var, 0}, + {"Interface", Type, 0}, + {"Interface.Flags", Field, 0}, + {"Interface.HardwareAddr", Field, 0}, + {"Interface.Index", Field, 0}, + {"Interface.MTU", Field, 0}, + {"Interface.Name", Field, 0}, + {"InterfaceAddrs", Func, 0}, + {"InterfaceByIndex", Func, 0}, + {"InterfaceByName", Func, 0}, + {"Interfaces", Func, 0}, + {"InvalidAddrError", Type, 0}, + {"JoinHostPort", Func, 0}, + {"Listen", Func, 0}, + {"ListenConfig", Type, 11}, + {"ListenConfig.Control", Field, 11}, + {"ListenConfig.KeepAlive", Field, 13}, + {"ListenIP", Func, 0}, + {"ListenMulticastUDP", Func, 0}, + {"ListenPacket", Func, 0}, + {"ListenTCP", Func, 0}, + {"ListenUDP", Func, 0}, + {"ListenUnix", Func, 0}, + {"ListenUnixgram", Func, 0}, + {"Listener", Type, 0}, + {"LookupAddr", Func, 0}, + {"LookupCNAME", Func, 0}, + {"LookupHost", Func, 0}, + {"LookupIP", Func, 0}, + {"LookupMX", Func, 0}, + {"LookupNS", Func, 1}, + {"LookupPort", Func, 0}, + {"LookupSRV", Func, 0}, + {"LookupTXT", Func, 0}, + {"MX", Type, 0}, + {"MX.Host", Field, 0}, + {"MX.Pref", Field, 0}, + {"NS", Type, 1}, + {"NS.Host", Field, 1}, + {"OpError", Type, 0}, + {"OpError.Addr", Field, 0}, + {"OpError.Err", Field, 0}, + {"OpError.Net", Field, 0}, + {"OpError.Op", Field, 0}, + {"OpError.Source", Field, 5}, + {"PacketConn", Type, 0}, + {"ParseCIDR", Func, 0}, + {"ParseError", Type, 0}, + {"ParseError.Text", Field, 0}, + {"ParseError.Type", Field, 0}, + {"ParseIP", Func, 0}, + {"ParseMAC", Func, 0}, + {"Pipe", Func, 0}, + {"ResolveIPAddr", Func, 0}, + {"ResolveTCPAddr", Func, 0}, + {"ResolveUDPAddr", Func, 0}, + {"ResolveUnixAddr", Func, 0}, + {"Resolver", Type, 8}, + {"Resolver.Dial", Field, 9}, + {"Resolver.PreferGo", Field, 8}, + {"Resolver.StrictErrors", Field, 9}, + {"SRV", Type, 0}, + {"SRV.Port", Field, 0}, + {"SRV.Priority", Field, 0}, + {"SRV.Target", Field, 0}, + {"SRV.Weight", Field, 0}, + {"SplitHostPort", Func, 0}, + {"TCPAddr", Type, 0}, + {"TCPAddr.IP", Field, 0}, + {"TCPAddr.Port", Field, 0}, + {"TCPAddr.Zone", Field, 1}, + {"TCPAddrFromAddrPort", Func, 18}, + {"TCPConn", Type, 0}, + {"TCPListener", Type, 0}, + {"UDPAddr", Type, 0}, + {"UDPAddr.IP", Field, 0}, + {"UDPAddr.Port", Field, 0}, + {"UDPAddr.Zone", Field, 1}, + {"UDPAddrFromAddrPort", Func, 18}, + {"UDPConn", Type, 0}, + {"UnixAddr", Type, 0}, + {"UnixAddr.Name", Field, 0}, + {"UnixAddr.Net", Field, 0}, + {"UnixConn", Type, 0}, + {"UnixListener", Type, 0}, + {"UnknownNetworkError", Type, 0}, + }, + "net/http": { + {"(*Client).CloseIdleConnections", Method, 12}, + {"(*Client).Do", Method, 0}, + {"(*Client).Get", Method, 0}, + {"(*Client).Head", Method, 0}, + {"(*Client).Post", Method, 0}, + {"(*Client).PostForm", Method, 0}, + {"(*Cookie).String", Method, 0}, + {"(*Cookie).Valid", Method, 18}, + {"(*MaxBytesError).Error", Method, 19}, + {"(*ProtocolError).Error", Method, 0}, + {"(*ProtocolError).Is", Method, 21}, + {"(*Request).AddCookie", Method, 0}, + {"(*Request).BasicAuth", Method, 4}, + {"(*Request).Clone", Method, 13}, + {"(*Request).Context", Method, 7}, + {"(*Request).Cookie", Method, 0}, + {"(*Request).Cookies", Method, 0}, + {"(*Request).FormFile", Method, 0}, + {"(*Request).FormValue", Method, 0}, + {"(*Request).MultipartReader", Method, 0}, + {"(*Request).ParseForm", Method, 0}, + {"(*Request).ParseMultipartForm", Method, 0}, + {"(*Request).PathValue", Method, 22}, + {"(*Request).PostFormValue", Method, 1}, + {"(*Request).ProtoAtLeast", Method, 0}, + {"(*Request).Referer", Method, 0}, + {"(*Request).SetBasicAuth", Method, 0}, + {"(*Request).SetPathValue", Method, 22}, + {"(*Request).UserAgent", Method, 0}, + {"(*Request).WithContext", Method, 7}, + {"(*Request).Write", Method, 0}, + {"(*Request).WriteProxy", Method, 0}, + {"(*Response).Cookies", Method, 0}, + {"(*Response).Location", Method, 0}, + {"(*Response).ProtoAtLeast", Method, 0}, + {"(*Response).Write", Method, 0}, + {"(*ResponseController).EnableFullDuplex", Method, 21}, + {"(*ResponseController).Flush", Method, 20}, + {"(*ResponseController).Hijack", Method, 20}, + {"(*ResponseController).SetReadDeadline", Method, 20}, + {"(*ResponseController).SetWriteDeadline", Method, 20}, + {"(*ServeMux).Handle", Method, 0}, + {"(*ServeMux).HandleFunc", Method, 0}, + {"(*ServeMux).Handler", Method, 1}, + {"(*ServeMux).ServeHTTP", Method, 0}, + {"(*Server).Close", Method, 8}, + {"(*Server).ListenAndServe", Method, 0}, + {"(*Server).ListenAndServeTLS", Method, 0}, + {"(*Server).RegisterOnShutdown", Method, 9}, + {"(*Server).Serve", Method, 0}, + {"(*Server).ServeTLS", Method, 9}, + {"(*Server).SetKeepAlivesEnabled", Method, 3}, + {"(*Server).Shutdown", Method, 8}, + {"(*Transport).CancelRequest", Method, 1}, + {"(*Transport).Clone", Method, 13}, + {"(*Transport).CloseIdleConnections", Method, 0}, + {"(*Transport).RegisterProtocol", Method, 0}, + {"(*Transport).RoundTrip", Method, 0}, + {"(ConnState).String", Method, 3}, + {"(Dir).Open", Method, 0}, + {"(HandlerFunc).ServeHTTP", Method, 0}, + {"(Header).Add", Method, 0}, + {"(Header).Clone", Method, 13}, + {"(Header).Del", Method, 0}, + {"(Header).Get", Method, 0}, + {"(Header).Set", Method, 0}, + {"(Header).Values", Method, 14}, + {"(Header).Write", Method, 0}, + {"(Header).WriteSubset", Method, 0}, + {"AllowQuerySemicolons", Func, 17}, + {"CanonicalHeaderKey", Func, 0}, + {"Client", Type, 0}, + {"Client.CheckRedirect", Field, 0}, + {"Client.Jar", Field, 0}, + {"Client.Timeout", Field, 3}, + {"Client.Transport", Field, 0}, + {"CloseNotifier", Type, 1}, + {"ConnState", Type, 3}, + {"Cookie", Type, 0}, + {"Cookie.Domain", Field, 0}, + {"Cookie.Expires", Field, 0}, + {"Cookie.HttpOnly", Field, 0}, + {"Cookie.MaxAge", Field, 0}, + {"Cookie.Name", Field, 0}, + {"Cookie.Path", Field, 0}, + {"Cookie.Raw", Field, 0}, + {"Cookie.RawExpires", Field, 0}, + {"Cookie.SameSite", Field, 11}, + {"Cookie.Secure", Field, 0}, + {"Cookie.Unparsed", Field, 0}, + {"Cookie.Value", Field, 0}, + {"CookieJar", Type, 0}, + {"DefaultClient", Var, 0}, + {"DefaultMaxHeaderBytes", Const, 0}, + {"DefaultMaxIdleConnsPerHost", Const, 0}, + {"DefaultServeMux", Var, 0}, + {"DefaultTransport", Var, 0}, + {"DetectContentType", Func, 0}, + {"Dir", Type, 0}, + {"ErrAbortHandler", Var, 8}, + {"ErrBodyNotAllowed", Var, 0}, + {"ErrBodyReadAfterClose", Var, 0}, + {"ErrContentLength", Var, 0}, + {"ErrHandlerTimeout", Var, 0}, + {"ErrHeaderTooLong", Var, 0}, + {"ErrHijacked", Var, 0}, + {"ErrLineTooLong", Var, 0}, + {"ErrMissingBoundary", Var, 0}, + {"ErrMissingContentLength", Var, 0}, + {"ErrMissingFile", Var, 0}, + {"ErrNoCookie", Var, 0}, + {"ErrNoLocation", Var, 0}, + {"ErrNotMultipart", Var, 0}, + {"ErrNotSupported", Var, 0}, + {"ErrSchemeMismatch", Var, 21}, + {"ErrServerClosed", Var, 8}, + {"ErrShortBody", Var, 0}, + {"ErrSkipAltProtocol", Var, 6}, + {"ErrUnexpectedTrailer", Var, 0}, + {"ErrUseLastResponse", Var, 7}, + {"ErrWriteAfterFlush", Var, 0}, + {"Error", Func, 0}, + {"FS", Func, 16}, + {"File", Type, 0}, + {"FileServer", Func, 0}, + {"FileServerFS", Func, 22}, + {"FileSystem", Type, 0}, + {"Flusher", Type, 0}, + {"Get", Func, 0}, + {"Handle", Func, 0}, + {"HandleFunc", Func, 0}, + {"Handler", Type, 0}, + {"HandlerFunc", Type, 0}, + {"Head", Func, 0}, + {"Header", Type, 0}, + {"Hijacker", Type, 0}, + {"ListenAndServe", Func, 0}, + {"ListenAndServeTLS", Func, 0}, + {"LocalAddrContextKey", Var, 7}, + {"MaxBytesError", Type, 19}, + {"MaxBytesError.Limit", Field, 19}, + {"MaxBytesHandler", Func, 18}, + {"MaxBytesReader", Func, 0}, + {"MethodConnect", Const, 6}, + {"MethodDelete", Const, 6}, + {"MethodGet", Const, 6}, + {"MethodHead", Const, 6}, + {"MethodOptions", Const, 6}, + {"MethodPatch", Const, 6}, + {"MethodPost", Const, 6}, + {"MethodPut", Const, 6}, + {"MethodTrace", Const, 6}, + {"NewFileTransport", Func, 0}, + {"NewFileTransportFS", Func, 22}, + {"NewRequest", Func, 0}, + {"NewRequestWithContext", Func, 13}, + {"NewResponseController", Func, 20}, + {"NewServeMux", Func, 0}, + {"NoBody", Var, 8}, + {"NotFound", Func, 0}, + {"NotFoundHandler", Func, 0}, + {"ParseHTTPVersion", Func, 0}, + {"ParseTime", Func, 1}, + {"Post", Func, 0}, + {"PostForm", Func, 0}, + {"ProtocolError", Type, 0}, + {"ProtocolError.ErrorString", Field, 0}, + {"ProxyFromEnvironment", Func, 0}, + {"ProxyURL", Func, 0}, + {"PushOptions", Type, 8}, + {"PushOptions.Header", Field, 8}, + {"PushOptions.Method", Field, 8}, + {"Pusher", Type, 8}, + {"ReadRequest", Func, 0}, + {"ReadResponse", Func, 0}, + {"Redirect", Func, 0}, + {"RedirectHandler", Func, 0}, + {"Request", Type, 0}, + {"Request.Body", Field, 0}, + {"Request.Cancel", Field, 5}, + {"Request.Close", Field, 0}, + {"Request.ContentLength", Field, 0}, + {"Request.Form", Field, 0}, + {"Request.GetBody", Field, 8}, + {"Request.Header", Field, 0}, + {"Request.Host", Field, 0}, + {"Request.Method", Field, 0}, + {"Request.MultipartForm", Field, 0}, + {"Request.PostForm", Field, 1}, + {"Request.Proto", Field, 0}, + {"Request.ProtoMajor", Field, 0}, + {"Request.ProtoMinor", Field, 0}, + {"Request.RemoteAddr", Field, 0}, + {"Request.RequestURI", Field, 0}, + {"Request.Response", Field, 7}, + {"Request.TLS", Field, 0}, + {"Request.Trailer", Field, 0}, + {"Request.TransferEncoding", Field, 0}, + {"Request.URL", Field, 0}, + {"Response", Type, 0}, + {"Response.Body", Field, 0}, + {"Response.Close", Field, 0}, + {"Response.ContentLength", Field, 0}, + {"Response.Header", Field, 0}, + {"Response.Proto", Field, 0}, + {"Response.ProtoMajor", Field, 0}, + {"Response.ProtoMinor", Field, 0}, + {"Response.Request", Field, 0}, + {"Response.Status", Field, 0}, + {"Response.StatusCode", Field, 0}, + {"Response.TLS", Field, 3}, + {"Response.Trailer", Field, 0}, + {"Response.TransferEncoding", Field, 0}, + {"Response.Uncompressed", Field, 7}, + {"ResponseController", Type, 20}, + {"ResponseWriter", Type, 0}, + {"RoundTripper", Type, 0}, + {"SameSite", Type, 11}, + {"SameSiteDefaultMode", Const, 11}, + {"SameSiteLaxMode", Const, 11}, + {"SameSiteNoneMode", Const, 13}, + {"SameSiteStrictMode", Const, 11}, + {"Serve", Func, 0}, + {"ServeContent", Func, 0}, + {"ServeFile", Func, 0}, + {"ServeFileFS", Func, 22}, + {"ServeMux", Type, 0}, + {"ServeTLS", Func, 9}, + {"Server", Type, 0}, + {"Server.Addr", Field, 0}, + {"Server.BaseContext", Field, 13}, + {"Server.ConnContext", Field, 13}, + {"Server.ConnState", Field, 3}, + {"Server.DisableGeneralOptionsHandler", Field, 20}, + {"Server.ErrorLog", Field, 3}, + {"Server.Handler", Field, 0}, + {"Server.IdleTimeout", Field, 8}, + {"Server.MaxHeaderBytes", Field, 0}, + {"Server.ReadHeaderTimeout", Field, 8}, + {"Server.ReadTimeout", Field, 0}, + {"Server.TLSConfig", Field, 0}, + {"Server.TLSNextProto", Field, 1}, + {"Server.WriteTimeout", Field, 0}, + {"ServerContextKey", Var, 7}, + {"SetCookie", Func, 0}, + {"StateActive", Const, 3}, + {"StateClosed", Const, 3}, + {"StateHijacked", Const, 3}, + {"StateIdle", Const, 3}, + {"StateNew", Const, 3}, + {"StatusAccepted", Const, 0}, + {"StatusAlreadyReported", Const, 7}, + {"StatusBadGateway", Const, 0}, + {"StatusBadRequest", Const, 0}, + {"StatusConflict", Const, 0}, + {"StatusContinue", Const, 0}, + {"StatusCreated", Const, 0}, + {"StatusEarlyHints", Const, 13}, + {"StatusExpectationFailed", Const, 0}, + {"StatusFailedDependency", Const, 7}, + {"StatusForbidden", Const, 0}, + {"StatusFound", Const, 0}, + {"StatusGatewayTimeout", Const, 0}, + {"StatusGone", Const, 0}, + {"StatusHTTPVersionNotSupported", Const, 0}, + {"StatusIMUsed", Const, 7}, + {"StatusInsufficientStorage", Const, 7}, + {"StatusInternalServerError", Const, 0}, + {"StatusLengthRequired", Const, 0}, + {"StatusLocked", Const, 7}, + {"StatusLoopDetected", Const, 7}, + {"StatusMethodNotAllowed", Const, 0}, + {"StatusMisdirectedRequest", Const, 11}, + {"StatusMovedPermanently", Const, 0}, + {"StatusMultiStatus", Const, 7}, + {"StatusMultipleChoices", Const, 0}, + {"StatusNetworkAuthenticationRequired", Const, 6}, + {"StatusNoContent", Const, 0}, + {"StatusNonAuthoritativeInfo", Const, 0}, + {"StatusNotAcceptable", Const, 0}, + {"StatusNotExtended", Const, 7}, + {"StatusNotFound", Const, 0}, + {"StatusNotImplemented", Const, 0}, + {"StatusNotModified", Const, 0}, + {"StatusOK", Const, 0}, + {"StatusPartialContent", Const, 0}, + {"StatusPaymentRequired", Const, 0}, + {"StatusPermanentRedirect", Const, 7}, + {"StatusPreconditionFailed", Const, 0}, + {"StatusPreconditionRequired", Const, 6}, + {"StatusProcessing", Const, 7}, + {"StatusProxyAuthRequired", Const, 0}, + {"StatusRequestEntityTooLarge", Const, 0}, + {"StatusRequestHeaderFieldsTooLarge", Const, 6}, + {"StatusRequestTimeout", Const, 0}, + {"StatusRequestURITooLong", Const, 0}, + {"StatusRequestedRangeNotSatisfiable", Const, 0}, + {"StatusResetContent", Const, 0}, + {"StatusSeeOther", Const, 0}, + {"StatusServiceUnavailable", Const, 0}, + {"StatusSwitchingProtocols", Const, 0}, + {"StatusTeapot", Const, 0}, + {"StatusTemporaryRedirect", Const, 0}, + {"StatusText", Func, 0}, + {"StatusTooEarly", Const, 12}, + {"StatusTooManyRequests", Const, 6}, + {"StatusUnauthorized", Const, 0}, + {"StatusUnavailableForLegalReasons", Const, 6}, + {"StatusUnprocessableEntity", Const, 7}, + {"StatusUnsupportedMediaType", Const, 0}, + {"StatusUpgradeRequired", Const, 7}, + {"StatusUseProxy", Const, 0}, + {"StatusVariantAlsoNegotiates", Const, 7}, + {"StripPrefix", Func, 0}, + {"TimeFormat", Const, 0}, + {"TimeoutHandler", Func, 0}, + {"TrailerPrefix", Const, 8}, + {"Transport", Type, 0}, + {"Transport.Dial", Field, 0}, + {"Transport.DialContext", Field, 7}, + {"Transport.DialTLS", Field, 4}, + {"Transport.DialTLSContext", Field, 14}, + {"Transport.DisableCompression", Field, 0}, + {"Transport.DisableKeepAlives", Field, 0}, + {"Transport.ExpectContinueTimeout", Field, 6}, + {"Transport.ForceAttemptHTTP2", Field, 13}, + {"Transport.GetProxyConnectHeader", Field, 16}, + {"Transport.IdleConnTimeout", Field, 7}, + {"Transport.MaxConnsPerHost", Field, 11}, + {"Transport.MaxIdleConns", Field, 7}, + {"Transport.MaxIdleConnsPerHost", Field, 0}, + {"Transport.MaxResponseHeaderBytes", Field, 7}, + {"Transport.OnProxyConnectResponse", Field, 20}, + {"Transport.Proxy", Field, 0}, + {"Transport.ProxyConnectHeader", Field, 8}, + {"Transport.ReadBufferSize", Field, 13}, + {"Transport.ResponseHeaderTimeout", Field, 1}, + {"Transport.TLSClientConfig", Field, 0}, + {"Transport.TLSHandshakeTimeout", Field, 3}, + {"Transport.TLSNextProto", Field, 6}, + {"Transport.WriteBufferSize", Field, 13}, + }, + "net/http/cgi": { + {"(*Handler).ServeHTTP", Method, 0}, + {"Handler", Type, 0}, + {"Handler.Args", Field, 0}, + {"Handler.Dir", Field, 0}, + {"Handler.Env", Field, 0}, + {"Handler.InheritEnv", Field, 0}, + {"Handler.Logger", Field, 0}, + {"Handler.Path", Field, 0}, + {"Handler.PathLocationHandler", Field, 0}, + {"Handler.Root", Field, 0}, + {"Handler.Stderr", Field, 7}, + {"Request", Func, 0}, + {"RequestFromMap", Func, 0}, + {"Serve", Func, 0}, + }, + "net/http/cookiejar": { + {"(*Jar).Cookies", Method, 1}, + {"(*Jar).SetCookies", Method, 1}, + {"Jar", Type, 1}, + {"New", Func, 1}, + {"Options", Type, 1}, + {"Options.PublicSuffixList", Field, 1}, + {"PublicSuffixList", Type, 1}, + }, + "net/http/fcgi": { + {"ErrConnClosed", Var, 5}, + {"ErrRequestAborted", Var, 5}, + {"ProcessEnv", Func, 9}, + {"Serve", Func, 0}, + }, + "net/http/httptest": { + {"(*ResponseRecorder).Flush", Method, 0}, + {"(*ResponseRecorder).Header", Method, 0}, + {"(*ResponseRecorder).Result", Method, 7}, + {"(*ResponseRecorder).Write", Method, 0}, + {"(*ResponseRecorder).WriteHeader", Method, 0}, + {"(*ResponseRecorder).WriteString", Method, 6}, + {"(*Server).Certificate", Method, 9}, + {"(*Server).Client", Method, 9}, + {"(*Server).Close", Method, 0}, + {"(*Server).CloseClientConnections", Method, 0}, + {"(*Server).Start", Method, 0}, + {"(*Server).StartTLS", Method, 0}, + {"DefaultRemoteAddr", Const, 0}, + {"NewRecorder", Func, 0}, + {"NewRequest", Func, 7}, + {"NewServer", Func, 0}, + {"NewTLSServer", Func, 0}, + {"NewUnstartedServer", Func, 0}, + {"ResponseRecorder", Type, 0}, + {"ResponseRecorder.Body", Field, 0}, + {"ResponseRecorder.Code", Field, 0}, + {"ResponseRecorder.Flushed", Field, 0}, + {"ResponseRecorder.HeaderMap", Field, 0}, + {"Server", Type, 0}, + {"Server.Config", Field, 0}, + {"Server.EnableHTTP2", Field, 14}, + {"Server.Listener", Field, 0}, + {"Server.TLS", Field, 0}, + {"Server.URL", Field, 0}, + }, + "net/http/httptrace": { + {"ClientTrace", Type, 7}, + {"ClientTrace.ConnectDone", Field, 7}, + {"ClientTrace.ConnectStart", Field, 7}, + {"ClientTrace.DNSDone", Field, 7}, + {"ClientTrace.DNSStart", Field, 7}, + {"ClientTrace.GetConn", Field, 7}, + {"ClientTrace.Got100Continue", Field, 7}, + {"ClientTrace.Got1xxResponse", Field, 11}, + {"ClientTrace.GotConn", Field, 7}, + {"ClientTrace.GotFirstResponseByte", Field, 7}, + {"ClientTrace.PutIdleConn", Field, 7}, + {"ClientTrace.TLSHandshakeDone", Field, 8}, + {"ClientTrace.TLSHandshakeStart", Field, 8}, + {"ClientTrace.Wait100Continue", Field, 7}, + {"ClientTrace.WroteHeaderField", Field, 11}, + {"ClientTrace.WroteHeaders", Field, 7}, + {"ClientTrace.WroteRequest", Field, 7}, + {"ContextClientTrace", Func, 7}, + {"DNSDoneInfo", Type, 7}, + {"DNSDoneInfo.Addrs", Field, 7}, + {"DNSDoneInfo.Coalesced", Field, 7}, + {"DNSDoneInfo.Err", Field, 7}, + {"DNSStartInfo", Type, 7}, + {"DNSStartInfo.Host", Field, 7}, + {"GotConnInfo", Type, 7}, + {"GotConnInfo.Conn", Field, 7}, + {"GotConnInfo.IdleTime", Field, 7}, + {"GotConnInfo.Reused", Field, 7}, + {"GotConnInfo.WasIdle", Field, 7}, + {"WithClientTrace", Func, 7}, + {"WroteRequestInfo", Type, 7}, + {"WroteRequestInfo.Err", Field, 7}, + }, + "net/http/httputil": { + {"(*ClientConn).Close", Method, 0}, + {"(*ClientConn).Do", Method, 0}, + {"(*ClientConn).Hijack", Method, 0}, + {"(*ClientConn).Pending", Method, 0}, + {"(*ClientConn).Read", Method, 0}, + {"(*ClientConn).Write", Method, 0}, + {"(*ProxyRequest).SetURL", Method, 20}, + {"(*ProxyRequest).SetXForwarded", Method, 20}, + {"(*ReverseProxy).ServeHTTP", Method, 0}, + {"(*ServerConn).Close", Method, 0}, + {"(*ServerConn).Hijack", Method, 0}, + {"(*ServerConn).Pending", Method, 0}, + {"(*ServerConn).Read", Method, 0}, + {"(*ServerConn).Write", Method, 0}, + {"BufferPool", Type, 6}, + {"ClientConn", Type, 0}, + {"DumpRequest", Func, 0}, + {"DumpRequestOut", Func, 0}, + {"DumpResponse", Func, 0}, + {"ErrClosed", Var, 0}, + {"ErrLineTooLong", Var, 0}, + {"ErrPersistEOF", Var, 0}, + {"ErrPipeline", Var, 0}, + {"NewChunkedReader", Func, 0}, + {"NewChunkedWriter", Func, 0}, + {"NewClientConn", Func, 0}, + {"NewProxyClientConn", Func, 0}, + {"NewServerConn", Func, 0}, + {"NewSingleHostReverseProxy", Func, 0}, + {"ProxyRequest", Type, 20}, + {"ProxyRequest.In", Field, 20}, + {"ProxyRequest.Out", Field, 20}, + {"ReverseProxy", Type, 0}, + {"ReverseProxy.BufferPool", Field, 6}, + {"ReverseProxy.Director", Field, 0}, + {"ReverseProxy.ErrorHandler", Field, 11}, + {"ReverseProxy.ErrorLog", Field, 4}, + {"ReverseProxy.FlushInterval", Field, 0}, + {"ReverseProxy.ModifyResponse", Field, 8}, + {"ReverseProxy.Rewrite", Field, 20}, + {"ReverseProxy.Transport", Field, 0}, + {"ServerConn", Type, 0}, + }, + "net/http/pprof": { + {"Cmdline", Func, 0}, + {"Handler", Func, 0}, + {"Index", Func, 0}, + {"Profile", Func, 0}, + {"Symbol", Func, 0}, + {"Trace", Func, 5}, + }, + "net/mail": { + {"(*Address).String", Method, 0}, + {"(*AddressParser).Parse", Method, 5}, + {"(*AddressParser).ParseList", Method, 5}, + {"(Header).AddressList", Method, 0}, + {"(Header).Date", Method, 0}, + {"(Header).Get", Method, 0}, + {"Address", Type, 0}, + {"Address.Address", Field, 0}, + {"Address.Name", Field, 0}, + {"AddressParser", Type, 5}, + {"AddressParser.WordDecoder", Field, 5}, + {"ErrHeaderNotPresent", Var, 0}, + {"Header", Type, 0}, + {"Message", Type, 0}, + {"Message.Body", Field, 0}, + {"Message.Header", Field, 0}, + {"ParseAddress", Func, 1}, + {"ParseAddressList", Func, 1}, + {"ParseDate", Func, 8}, + {"ReadMessage", Func, 0}, + }, + "net/netip": { + {"(*Addr).UnmarshalBinary", Method, 18}, + {"(*Addr).UnmarshalText", Method, 18}, + {"(*AddrPort).UnmarshalBinary", Method, 18}, + {"(*AddrPort).UnmarshalText", Method, 18}, + {"(*Prefix).UnmarshalBinary", Method, 18}, + {"(*Prefix).UnmarshalText", Method, 18}, + {"(Addr).AppendTo", Method, 18}, + {"(Addr).As16", Method, 18}, + {"(Addr).As4", Method, 18}, + {"(Addr).AsSlice", Method, 18}, + {"(Addr).BitLen", Method, 18}, + {"(Addr).Compare", Method, 18}, + {"(Addr).Is4", Method, 18}, + {"(Addr).Is4In6", Method, 18}, + {"(Addr).Is6", Method, 18}, + {"(Addr).IsGlobalUnicast", Method, 18}, + {"(Addr).IsInterfaceLocalMulticast", Method, 18}, + {"(Addr).IsLinkLocalMulticast", Method, 18}, + {"(Addr).IsLinkLocalUnicast", Method, 18}, + {"(Addr).IsLoopback", Method, 18}, + {"(Addr).IsMulticast", Method, 18}, + {"(Addr).IsPrivate", Method, 18}, + {"(Addr).IsUnspecified", Method, 18}, + {"(Addr).IsValid", Method, 18}, + {"(Addr).Less", Method, 18}, + {"(Addr).MarshalBinary", Method, 18}, + {"(Addr).MarshalText", Method, 18}, + {"(Addr).Next", Method, 18}, + {"(Addr).Prefix", Method, 18}, + {"(Addr).Prev", Method, 18}, + {"(Addr).String", Method, 18}, + {"(Addr).StringExpanded", Method, 18}, + {"(Addr).Unmap", Method, 18}, + {"(Addr).WithZone", Method, 18}, + {"(Addr).Zone", Method, 18}, + {"(AddrPort).Addr", Method, 18}, + {"(AddrPort).AppendTo", Method, 18}, + {"(AddrPort).Compare", Method, 22}, + {"(AddrPort).IsValid", Method, 18}, + {"(AddrPort).MarshalBinary", Method, 18}, + {"(AddrPort).MarshalText", Method, 18}, + {"(AddrPort).Port", Method, 18}, + {"(AddrPort).String", Method, 18}, + {"(Prefix).Addr", Method, 18}, + {"(Prefix).AppendTo", Method, 18}, + {"(Prefix).Bits", Method, 18}, + {"(Prefix).Contains", Method, 18}, + {"(Prefix).IsSingleIP", Method, 18}, + {"(Prefix).IsValid", Method, 18}, + {"(Prefix).MarshalBinary", Method, 18}, + {"(Prefix).MarshalText", Method, 18}, + {"(Prefix).Masked", Method, 18}, + {"(Prefix).Overlaps", Method, 18}, + {"(Prefix).String", Method, 18}, + {"Addr", Type, 18}, + {"AddrFrom16", Func, 18}, + {"AddrFrom4", Func, 18}, + {"AddrFromSlice", Func, 18}, + {"AddrPort", Type, 18}, + {"AddrPortFrom", Func, 18}, + {"IPv4Unspecified", Func, 18}, + {"IPv6LinkLocalAllNodes", Func, 18}, + {"IPv6LinkLocalAllRouters", Func, 20}, + {"IPv6Loopback", Func, 20}, + {"IPv6Unspecified", Func, 18}, + {"MustParseAddr", Func, 18}, + {"MustParseAddrPort", Func, 18}, + {"MustParsePrefix", Func, 18}, + {"ParseAddr", Func, 18}, + {"ParseAddrPort", Func, 18}, + {"ParsePrefix", Func, 18}, + {"Prefix", Type, 18}, + {"PrefixFrom", Func, 18}, + }, + "net/rpc": { + {"(*Client).Call", Method, 0}, + {"(*Client).Close", Method, 0}, + {"(*Client).Go", Method, 0}, + {"(*Server).Accept", Method, 0}, + {"(*Server).HandleHTTP", Method, 0}, + {"(*Server).Register", Method, 0}, + {"(*Server).RegisterName", Method, 0}, + {"(*Server).ServeCodec", Method, 0}, + {"(*Server).ServeConn", Method, 0}, + {"(*Server).ServeHTTP", Method, 0}, + {"(*Server).ServeRequest", Method, 0}, + {"(ServerError).Error", Method, 0}, + {"Accept", Func, 0}, + {"Call", Type, 0}, + {"Call.Args", Field, 0}, + {"Call.Done", Field, 0}, + {"Call.Error", Field, 0}, + {"Call.Reply", Field, 0}, + {"Call.ServiceMethod", Field, 0}, + {"Client", Type, 0}, + {"ClientCodec", Type, 0}, + {"DefaultDebugPath", Const, 0}, + {"DefaultRPCPath", Const, 0}, + {"DefaultServer", Var, 0}, + {"Dial", Func, 0}, + {"DialHTTP", Func, 0}, + {"DialHTTPPath", Func, 0}, + {"ErrShutdown", Var, 0}, + {"HandleHTTP", Func, 0}, + {"NewClient", Func, 0}, + {"NewClientWithCodec", Func, 0}, + {"NewServer", Func, 0}, + {"Register", Func, 0}, + {"RegisterName", Func, 0}, + {"Request", Type, 0}, + {"Request.Seq", Field, 0}, + {"Request.ServiceMethod", Field, 0}, + {"Response", Type, 0}, + {"Response.Error", Field, 0}, + {"Response.Seq", Field, 0}, + {"Response.ServiceMethod", Field, 0}, + {"ServeCodec", Func, 0}, + {"ServeConn", Func, 0}, + {"ServeRequest", Func, 0}, + {"Server", Type, 0}, + {"ServerCodec", Type, 0}, + {"ServerError", Type, 0}, + }, + "net/rpc/jsonrpc": { + {"Dial", Func, 0}, + {"NewClient", Func, 0}, + {"NewClientCodec", Func, 0}, + {"NewServerCodec", Func, 0}, + {"ServeConn", Func, 0}, + }, + "net/smtp": { + {"(*Client).Auth", Method, 0}, + {"(*Client).Close", Method, 2}, + {"(*Client).Data", Method, 0}, + {"(*Client).Extension", Method, 0}, + {"(*Client).Hello", Method, 1}, + {"(*Client).Mail", Method, 0}, + {"(*Client).Noop", Method, 10}, + {"(*Client).Quit", Method, 0}, + {"(*Client).Rcpt", Method, 0}, + {"(*Client).Reset", Method, 0}, + {"(*Client).StartTLS", Method, 0}, + {"(*Client).TLSConnectionState", Method, 5}, + {"(*Client).Verify", Method, 0}, + {"Auth", Type, 0}, + {"CRAMMD5Auth", Func, 0}, + {"Client", Type, 0}, + {"Client.Text", Field, 0}, + {"Dial", Func, 0}, + {"NewClient", Func, 0}, + {"PlainAuth", Func, 0}, + {"SendMail", Func, 0}, + {"ServerInfo", Type, 0}, + {"ServerInfo.Auth", Field, 0}, + {"ServerInfo.Name", Field, 0}, + {"ServerInfo.TLS", Field, 0}, + }, + "net/textproto": { + {"(*Conn).Close", Method, 0}, + {"(*Conn).Cmd", Method, 0}, + {"(*Conn).DotReader", Method, 0}, + {"(*Conn).DotWriter", Method, 0}, + {"(*Conn).EndRequest", Method, 0}, + {"(*Conn).EndResponse", Method, 0}, + {"(*Conn).Next", Method, 0}, + {"(*Conn).PrintfLine", Method, 0}, + {"(*Conn).ReadCodeLine", Method, 0}, + {"(*Conn).ReadContinuedLine", Method, 0}, + {"(*Conn).ReadContinuedLineBytes", Method, 0}, + {"(*Conn).ReadDotBytes", Method, 0}, + {"(*Conn).ReadDotLines", Method, 0}, + {"(*Conn).ReadLine", Method, 0}, + {"(*Conn).ReadLineBytes", Method, 0}, + {"(*Conn).ReadMIMEHeader", Method, 0}, + {"(*Conn).ReadResponse", Method, 0}, + {"(*Conn).StartRequest", Method, 0}, + {"(*Conn).StartResponse", Method, 0}, + {"(*Error).Error", Method, 0}, + {"(*Pipeline).EndRequest", Method, 0}, + {"(*Pipeline).EndResponse", Method, 0}, + {"(*Pipeline).Next", Method, 0}, + {"(*Pipeline).StartRequest", Method, 0}, + {"(*Pipeline).StartResponse", Method, 0}, + {"(*Reader).DotReader", Method, 0}, + {"(*Reader).ReadCodeLine", Method, 0}, + {"(*Reader).ReadContinuedLine", Method, 0}, + {"(*Reader).ReadContinuedLineBytes", Method, 0}, + {"(*Reader).ReadDotBytes", Method, 0}, + {"(*Reader).ReadDotLines", Method, 0}, + {"(*Reader).ReadLine", Method, 0}, + {"(*Reader).ReadLineBytes", Method, 0}, + {"(*Reader).ReadMIMEHeader", Method, 0}, + {"(*Reader).ReadResponse", Method, 0}, + {"(*Writer).DotWriter", Method, 0}, + {"(*Writer).PrintfLine", Method, 0}, + {"(MIMEHeader).Add", Method, 0}, + {"(MIMEHeader).Del", Method, 0}, + {"(MIMEHeader).Get", Method, 0}, + {"(MIMEHeader).Set", Method, 0}, + {"(MIMEHeader).Values", Method, 14}, + {"(ProtocolError).Error", Method, 0}, + {"CanonicalMIMEHeaderKey", Func, 0}, + {"Conn", Type, 0}, + {"Conn.Pipeline", Field, 0}, + {"Conn.Reader", Field, 0}, + {"Conn.Writer", Field, 0}, + {"Dial", Func, 0}, + {"Error", Type, 0}, + {"Error.Code", Field, 0}, + {"Error.Msg", Field, 0}, + {"MIMEHeader", Type, 0}, + {"NewConn", Func, 0}, + {"NewReader", Func, 0}, + {"NewWriter", Func, 0}, + {"Pipeline", Type, 0}, + {"ProtocolError", Type, 0}, + {"Reader", Type, 0}, + {"Reader.R", Field, 0}, + {"TrimBytes", Func, 1}, + {"TrimString", Func, 1}, + {"Writer", Type, 0}, + {"Writer.W", Field, 0}, + }, + "net/url": { + {"(*Error).Error", Method, 0}, + {"(*Error).Temporary", Method, 6}, + {"(*Error).Timeout", Method, 6}, + {"(*Error).Unwrap", Method, 13}, + {"(*URL).EscapedFragment", Method, 15}, + {"(*URL).EscapedPath", Method, 5}, + {"(*URL).Hostname", Method, 8}, + {"(*URL).IsAbs", Method, 0}, + {"(*URL).JoinPath", Method, 19}, + {"(*URL).MarshalBinary", Method, 8}, + {"(*URL).Parse", Method, 0}, + {"(*URL).Port", Method, 8}, + {"(*URL).Query", Method, 0}, + {"(*URL).Redacted", Method, 15}, + {"(*URL).RequestURI", Method, 0}, + {"(*URL).ResolveReference", Method, 0}, + {"(*URL).String", Method, 0}, + {"(*URL).UnmarshalBinary", Method, 8}, + {"(*Userinfo).Password", Method, 0}, + {"(*Userinfo).String", Method, 0}, + {"(*Userinfo).Username", Method, 0}, + {"(EscapeError).Error", Method, 0}, + {"(InvalidHostError).Error", Method, 6}, + {"(Values).Add", Method, 0}, + {"(Values).Del", Method, 0}, + {"(Values).Encode", Method, 0}, + {"(Values).Get", Method, 0}, + {"(Values).Has", Method, 17}, + {"(Values).Set", Method, 0}, + {"Error", Type, 0}, + {"Error.Err", Field, 0}, + {"Error.Op", Field, 0}, + {"Error.URL", Field, 0}, + {"EscapeError", Type, 0}, + {"InvalidHostError", Type, 6}, + {"JoinPath", Func, 19}, + {"Parse", Func, 0}, + {"ParseQuery", Func, 0}, + {"ParseRequestURI", Func, 0}, + {"PathEscape", Func, 8}, + {"PathUnescape", Func, 8}, + {"QueryEscape", Func, 0}, + {"QueryUnescape", Func, 0}, + {"URL", Type, 0}, + {"URL.ForceQuery", Field, 7}, + {"URL.Fragment", Field, 0}, + {"URL.Host", Field, 0}, + {"URL.OmitHost", Field, 19}, + {"URL.Opaque", Field, 0}, + {"URL.Path", Field, 0}, + {"URL.RawFragment", Field, 15}, + {"URL.RawPath", Field, 5}, + {"URL.RawQuery", Field, 0}, + {"URL.Scheme", Field, 0}, + {"URL.User", Field, 0}, + {"User", Func, 0}, + {"UserPassword", Func, 0}, + {"Userinfo", Type, 0}, + {"Values", Type, 0}, + }, + "os": { + {"(*File).Chdir", Method, 0}, + {"(*File).Chmod", Method, 0}, + {"(*File).Chown", Method, 0}, + {"(*File).Close", Method, 0}, + {"(*File).Fd", Method, 0}, + {"(*File).Name", Method, 0}, + {"(*File).Read", Method, 0}, + {"(*File).ReadAt", Method, 0}, + {"(*File).ReadDir", Method, 16}, + {"(*File).ReadFrom", Method, 15}, + {"(*File).Readdir", Method, 0}, + {"(*File).Readdirnames", Method, 0}, + {"(*File).Seek", Method, 0}, + {"(*File).SetDeadline", Method, 10}, + {"(*File).SetReadDeadline", Method, 10}, + {"(*File).SetWriteDeadline", Method, 10}, + {"(*File).Stat", Method, 0}, + {"(*File).Sync", Method, 0}, + {"(*File).SyscallConn", Method, 12}, + {"(*File).Truncate", Method, 0}, + {"(*File).Write", Method, 0}, + {"(*File).WriteAt", Method, 0}, + {"(*File).WriteString", Method, 0}, + {"(*File).WriteTo", Method, 22}, + {"(*LinkError).Error", Method, 0}, + {"(*LinkError).Unwrap", Method, 13}, + {"(*PathError).Error", Method, 0}, + {"(*PathError).Timeout", Method, 10}, + {"(*PathError).Unwrap", Method, 13}, + {"(*Process).Kill", Method, 0}, + {"(*Process).Release", Method, 0}, + {"(*Process).Signal", Method, 0}, + {"(*Process).Wait", Method, 0}, + {"(*ProcessState).ExitCode", Method, 12}, + {"(*ProcessState).Exited", Method, 0}, + {"(*ProcessState).Pid", Method, 0}, + {"(*ProcessState).String", Method, 0}, + {"(*ProcessState).Success", Method, 0}, + {"(*ProcessState).Sys", Method, 0}, + {"(*ProcessState).SysUsage", Method, 0}, + {"(*ProcessState).SystemTime", Method, 0}, + {"(*ProcessState).UserTime", Method, 0}, + {"(*SyscallError).Error", Method, 0}, + {"(*SyscallError).Timeout", Method, 10}, + {"(*SyscallError).Unwrap", Method, 13}, + {"(FileMode).IsDir", Method, 0}, + {"(FileMode).IsRegular", Method, 1}, + {"(FileMode).Perm", Method, 0}, + {"(FileMode).String", Method, 0}, + {"Args", Var, 0}, + {"Chdir", Func, 0}, + {"Chmod", Func, 0}, + {"Chown", Func, 0}, + {"Chtimes", Func, 0}, + {"Clearenv", Func, 0}, + {"Create", Func, 0}, + {"CreateTemp", Func, 16}, + {"DevNull", Const, 0}, + {"DirEntry", Type, 16}, + {"DirFS", Func, 16}, + {"Environ", Func, 0}, + {"ErrClosed", Var, 8}, + {"ErrDeadlineExceeded", Var, 15}, + {"ErrExist", Var, 0}, + {"ErrInvalid", Var, 0}, + {"ErrNoDeadline", Var, 10}, + {"ErrNotExist", Var, 0}, + {"ErrPermission", Var, 0}, + {"ErrProcessDone", Var, 16}, + {"Executable", Func, 8}, + {"Exit", Func, 0}, + {"Expand", Func, 0}, + {"ExpandEnv", Func, 0}, + {"File", Type, 0}, + {"FileInfo", Type, 0}, + {"FileMode", Type, 0}, + {"FindProcess", Func, 0}, + {"Getegid", Func, 0}, + {"Getenv", Func, 0}, + {"Geteuid", Func, 0}, + {"Getgid", Func, 0}, + {"Getgroups", Func, 0}, + {"Getpagesize", Func, 0}, + {"Getpid", Func, 0}, + {"Getppid", Func, 0}, + {"Getuid", Func, 0}, + {"Getwd", Func, 0}, + {"Hostname", Func, 0}, + {"Interrupt", Var, 0}, + {"IsExist", Func, 0}, + {"IsNotExist", Func, 0}, + {"IsPathSeparator", Func, 0}, + {"IsPermission", Func, 0}, + {"IsTimeout", Func, 10}, + {"Kill", Var, 0}, + {"Lchown", Func, 0}, + {"Link", Func, 0}, + {"LinkError", Type, 0}, + {"LinkError.Err", Field, 0}, + {"LinkError.New", Field, 0}, + {"LinkError.Old", Field, 0}, + {"LinkError.Op", Field, 0}, + {"LookupEnv", Func, 5}, + {"Lstat", Func, 0}, + {"Mkdir", Func, 0}, + {"MkdirAll", Func, 0}, + {"MkdirTemp", Func, 16}, + {"ModeAppend", Const, 0}, + {"ModeCharDevice", Const, 0}, + {"ModeDevice", Const, 0}, + {"ModeDir", Const, 0}, + {"ModeExclusive", Const, 0}, + {"ModeIrregular", Const, 11}, + {"ModeNamedPipe", Const, 0}, + {"ModePerm", Const, 0}, + {"ModeSetgid", Const, 0}, + {"ModeSetuid", Const, 0}, + {"ModeSocket", Const, 0}, + {"ModeSticky", Const, 0}, + {"ModeSymlink", Const, 0}, + {"ModeTemporary", Const, 0}, + {"ModeType", Const, 0}, + {"NewFile", Func, 0}, + {"NewSyscallError", Func, 0}, + {"O_APPEND", Const, 0}, + {"O_CREATE", Const, 0}, + {"O_EXCL", Const, 0}, + {"O_RDONLY", Const, 0}, + {"O_RDWR", Const, 0}, + {"O_SYNC", Const, 0}, + {"O_TRUNC", Const, 0}, + {"O_WRONLY", Const, 0}, + {"Open", Func, 0}, + {"OpenFile", Func, 0}, + {"PathError", Type, 0}, + {"PathError.Err", Field, 0}, + {"PathError.Op", Field, 0}, + {"PathError.Path", Field, 0}, + {"PathListSeparator", Const, 0}, + {"PathSeparator", Const, 0}, + {"Pipe", Func, 0}, + {"ProcAttr", Type, 0}, + {"ProcAttr.Dir", Field, 0}, + {"ProcAttr.Env", Field, 0}, + {"ProcAttr.Files", Field, 0}, + {"ProcAttr.Sys", Field, 0}, + {"Process", Type, 0}, + {"Process.Pid", Field, 0}, + {"ProcessState", Type, 0}, + {"ReadDir", Func, 16}, + {"ReadFile", Func, 16}, + {"Readlink", Func, 0}, + {"Remove", Func, 0}, + {"RemoveAll", Func, 0}, + {"Rename", Func, 0}, + {"SEEK_CUR", Const, 0}, + {"SEEK_END", Const, 0}, + {"SEEK_SET", Const, 0}, + {"SameFile", Func, 0}, + {"Setenv", Func, 0}, + {"Signal", Type, 0}, + {"StartProcess", Func, 0}, + {"Stat", Func, 0}, + {"Stderr", Var, 0}, + {"Stdin", Var, 0}, + {"Stdout", Var, 0}, + {"Symlink", Func, 0}, + {"SyscallError", Type, 0}, + {"SyscallError.Err", Field, 0}, + {"SyscallError.Syscall", Field, 0}, + {"TempDir", Func, 0}, + {"Truncate", Func, 0}, + {"Unsetenv", Func, 4}, + {"UserCacheDir", Func, 11}, + {"UserConfigDir", Func, 13}, + {"UserHomeDir", Func, 12}, + {"WriteFile", Func, 16}, + }, + "os/exec": { + {"(*Cmd).CombinedOutput", Method, 0}, + {"(*Cmd).Environ", Method, 19}, + {"(*Cmd).Output", Method, 0}, + {"(*Cmd).Run", Method, 0}, + {"(*Cmd).Start", Method, 0}, + {"(*Cmd).StderrPipe", Method, 0}, + {"(*Cmd).StdinPipe", Method, 0}, + {"(*Cmd).StdoutPipe", Method, 0}, + {"(*Cmd).String", Method, 13}, + {"(*Cmd).Wait", Method, 0}, + {"(*Error).Error", Method, 0}, + {"(*Error).Unwrap", Method, 13}, + {"(*ExitError).Error", Method, 0}, + {"(ExitError).ExitCode", Method, 12}, + {"(ExitError).Exited", Method, 0}, + {"(ExitError).Pid", Method, 0}, + {"(ExitError).String", Method, 0}, + {"(ExitError).Success", Method, 0}, + {"(ExitError).Sys", Method, 0}, + {"(ExitError).SysUsage", Method, 0}, + {"(ExitError).SystemTime", Method, 0}, + {"(ExitError).UserTime", Method, 0}, + {"Cmd", Type, 0}, + {"Cmd.Args", Field, 0}, + {"Cmd.Cancel", Field, 20}, + {"Cmd.Dir", Field, 0}, + {"Cmd.Env", Field, 0}, + {"Cmd.Err", Field, 19}, + {"Cmd.ExtraFiles", Field, 0}, + {"Cmd.Path", Field, 0}, + {"Cmd.Process", Field, 0}, + {"Cmd.ProcessState", Field, 0}, + {"Cmd.Stderr", Field, 0}, + {"Cmd.Stdin", Field, 0}, + {"Cmd.Stdout", Field, 0}, + {"Cmd.SysProcAttr", Field, 0}, + {"Cmd.WaitDelay", Field, 20}, + {"Command", Func, 0}, + {"CommandContext", Func, 7}, + {"ErrDot", Var, 19}, + {"ErrNotFound", Var, 0}, + {"ErrWaitDelay", Var, 20}, + {"Error", Type, 0}, + {"Error.Err", Field, 0}, + {"Error.Name", Field, 0}, + {"ExitError", Type, 0}, + {"ExitError.ProcessState", Field, 0}, + {"ExitError.Stderr", Field, 6}, + {"LookPath", Func, 0}, + }, + "os/signal": { + {"Ignore", Func, 5}, + {"Ignored", Func, 11}, + {"Notify", Func, 0}, + {"NotifyContext", Func, 16}, + {"Reset", Func, 5}, + {"Stop", Func, 1}, + }, + "os/user": { + {"(*User).GroupIds", Method, 7}, + {"(UnknownGroupError).Error", Method, 7}, + {"(UnknownGroupIdError).Error", Method, 7}, + {"(UnknownUserError).Error", Method, 0}, + {"(UnknownUserIdError).Error", Method, 0}, + {"Current", Func, 0}, + {"Group", Type, 7}, + {"Group.Gid", Field, 7}, + {"Group.Name", Field, 7}, + {"Lookup", Func, 0}, + {"LookupGroup", Func, 7}, + {"LookupGroupId", Func, 7}, + {"LookupId", Func, 0}, + {"UnknownGroupError", Type, 7}, + {"UnknownGroupIdError", Type, 7}, + {"UnknownUserError", Type, 0}, + {"UnknownUserIdError", Type, 0}, + {"User", Type, 0}, + {"User.Gid", Field, 0}, + {"User.HomeDir", Field, 0}, + {"User.Name", Field, 0}, + {"User.Uid", Field, 0}, + {"User.Username", Field, 0}, + }, + "path": { + {"Base", Func, 0}, + {"Clean", Func, 0}, + {"Dir", Func, 0}, + {"ErrBadPattern", Var, 0}, + {"Ext", Func, 0}, + {"IsAbs", Func, 0}, + {"Join", Func, 0}, + {"Match", Func, 0}, + {"Split", Func, 0}, + }, + "path/filepath": { + {"Abs", Func, 0}, + {"Base", Func, 0}, + {"Clean", Func, 0}, + {"Dir", Func, 0}, + {"ErrBadPattern", Var, 0}, + {"EvalSymlinks", Func, 0}, + {"Ext", Func, 0}, + {"FromSlash", Func, 0}, + {"Glob", Func, 0}, + {"HasPrefix", Func, 0}, + {"IsAbs", Func, 0}, + {"IsLocal", Func, 20}, + {"Join", Func, 0}, + {"ListSeparator", Const, 0}, + {"Match", Func, 0}, + {"Rel", Func, 0}, + {"Separator", Const, 0}, + {"SkipAll", Var, 20}, + {"SkipDir", Var, 0}, + {"Split", Func, 0}, + {"SplitList", Func, 0}, + {"ToSlash", Func, 0}, + {"VolumeName", Func, 0}, + {"Walk", Func, 0}, + {"WalkDir", Func, 16}, + {"WalkFunc", Type, 0}, + }, + "plugin": { + {"(*Plugin).Lookup", Method, 8}, + {"Open", Func, 8}, + {"Plugin", Type, 8}, + {"Symbol", Type, 8}, + }, + "reflect": { + {"(*MapIter).Key", Method, 12}, + {"(*MapIter).Next", Method, 12}, + {"(*MapIter).Reset", Method, 18}, + {"(*MapIter).Value", Method, 12}, + {"(*ValueError).Error", Method, 0}, + {"(ChanDir).String", Method, 0}, + {"(Kind).String", Method, 0}, + {"(Method).IsExported", Method, 17}, + {"(StructField).IsExported", Method, 17}, + {"(StructTag).Get", Method, 0}, + {"(StructTag).Lookup", Method, 7}, + {"(Value).Addr", Method, 0}, + {"(Value).Bool", Method, 0}, + {"(Value).Bytes", Method, 0}, + {"(Value).Call", Method, 0}, + {"(Value).CallSlice", Method, 0}, + {"(Value).CanAddr", Method, 0}, + {"(Value).CanComplex", Method, 18}, + {"(Value).CanConvert", Method, 17}, + {"(Value).CanFloat", Method, 18}, + {"(Value).CanInt", Method, 18}, + {"(Value).CanInterface", Method, 0}, + {"(Value).CanSet", Method, 0}, + {"(Value).CanUint", Method, 18}, + {"(Value).Cap", Method, 0}, + {"(Value).Clear", Method, 21}, + {"(Value).Close", Method, 0}, + {"(Value).Comparable", Method, 20}, + {"(Value).Complex", Method, 0}, + {"(Value).Convert", Method, 1}, + {"(Value).Elem", Method, 0}, + {"(Value).Equal", Method, 20}, + {"(Value).Field", Method, 0}, + {"(Value).FieldByIndex", Method, 0}, + {"(Value).FieldByIndexErr", Method, 18}, + {"(Value).FieldByName", Method, 0}, + {"(Value).FieldByNameFunc", Method, 0}, + {"(Value).Float", Method, 0}, + {"(Value).Grow", Method, 20}, + {"(Value).Index", Method, 0}, + {"(Value).Int", Method, 0}, + {"(Value).Interface", Method, 0}, + {"(Value).InterfaceData", Method, 0}, + {"(Value).IsNil", Method, 0}, + {"(Value).IsValid", Method, 0}, + {"(Value).IsZero", Method, 13}, + {"(Value).Kind", Method, 0}, + {"(Value).Len", Method, 0}, + {"(Value).MapIndex", Method, 0}, + {"(Value).MapKeys", Method, 0}, + {"(Value).MapRange", Method, 12}, + {"(Value).Method", Method, 0}, + {"(Value).MethodByName", Method, 0}, + {"(Value).NumField", Method, 0}, + {"(Value).NumMethod", Method, 0}, + {"(Value).OverflowComplex", Method, 0}, + {"(Value).OverflowFloat", Method, 0}, + {"(Value).OverflowInt", Method, 0}, + {"(Value).OverflowUint", Method, 0}, + {"(Value).Pointer", Method, 0}, + {"(Value).Recv", Method, 0}, + {"(Value).Send", Method, 0}, + {"(Value).Set", Method, 0}, + {"(Value).SetBool", Method, 0}, + {"(Value).SetBytes", Method, 0}, + {"(Value).SetCap", Method, 2}, + {"(Value).SetComplex", Method, 0}, + {"(Value).SetFloat", Method, 0}, + {"(Value).SetInt", Method, 0}, + {"(Value).SetIterKey", Method, 18}, + {"(Value).SetIterValue", Method, 18}, + {"(Value).SetLen", Method, 0}, + {"(Value).SetMapIndex", Method, 0}, + {"(Value).SetPointer", Method, 0}, + {"(Value).SetString", Method, 0}, + {"(Value).SetUint", Method, 0}, + {"(Value).SetZero", Method, 20}, + {"(Value).Slice", Method, 0}, + {"(Value).Slice3", Method, 2}, + {"(Value).String", Method, 0}, + {"(Value).TryRecv", Method, 0}, + {"(Value).TrySend", Method, 0}, + {"(Value).Type", Method, 0}, + {"(Value).Uint", Method, 0}, + {"(Value).UnsafeAddr", Method, 0}, + {"(Value).UnsafePointer", Method, 18}, + {"Append", Func, 0}, + {"AppendSlice", Func, 0}, + {"Array", Const, 0}, + {"ArrayOf", Func, 5}, + {"Bool", Const, 0}, + {"BothDir", Const, 0}, + {"Chan", Const, 0}, + {"ChanDir", Type, 0}, + {"ChanOf", Func, 1}, + {"Complex128", Const, 0}, + {"Complex64", Const, 0}, + {"Copy", Func, 0}, + {"DeepEqual", Func, 0}, + {"Float32", Const, 0}, + {"Float64", Const, 0}, + {"Func", Const, 0}, + {"FuncOf", Func, 5}, + {"Indirect", Func, 0}, + {"Int", Const, 0}, + {"Int16", Const, 0}, + {"Int32", Const, 0}, + {"Int64", Const, 0}, + {"Int8", Const, 0}, + {"Interface", Const, 0}, + {"Invalid", Const, 0}, + {"Kind", Type, 0}, + {"MakeChan", Func, 0}, + {"MakeFunc", Func, 1}, + {"MakeMap", Func, 0}, + {"MakeMapWithSize", Func, 9}, + {"MakeSlice", Func, 0}, + {"Map", Const, 0}, + {"MapIter", Type, 12}, + {"MapOf", Func, 1}, + {"Method", Type, 0}, + {"Method.Func", Field, 0}, + {"Method.Index", Field, 0}, + {"Method.Name", Field, 0}, + {"Method.PkgPath", Field, 0}, + {"Method.Type", Field, 0}, + {"New", Func, 0}, + {"NewAt", Func, 0}, + {"Pointer", Const, 18}, + {"PointerTo", Func, 18}, + {"Ptr", Const, 0}, + {"PtrTo", Func, 0}, + {"RecvDir", Const, 0}, + {"Select", Func, 1}, + {"SelectCase", Type, 1}, + {"SelectCase.Chan", Field, 1}, + {"SelectCase.Dir", Field, 1}, + {"SelectCase.Send", Field, 1}, + {"SelectDefault", Const, 1}, + {"SelectDir", Type, 1}, + {"SelectRecv", Const, 1}, + {"SelectSend", Const, 1}, + {"SendDir", Const, 0}, + {"Slice", Const, 0}, + {"SliceHeader", Type, 0}, + {"SliceHeader.Cap", Field, 0}, + {"SliceHeader.Data", Field, 0}, + {"SliceHeader.Len", Field, 0}, + {"SliceOf", Func, 1}, + {"String", Const, 0}, + {"StringHeader", Type, 0}, + {"StringHeader.Data", Field, 0}, + {"StringHeader.Len", Field, 0}, + {"Struct", Const, 0}, + {"StructField", Type, 0}, + {"StructField.Anonymous", Field, 0}, + {"StructField.Index", Field, 0}, + {"StructField.Name", Field, 0}, + {"StructField.Offset", Field, 0}, + {"StructField.PkgPath", Field, 0}, + {"StructField.Tag", Field, 0}, + {"StructField.Type", Field, 0}, + {"StructOf", Func, 7}, + {"StructTag", Type, 0}, + {"Swapper", Func, 8}, + {"Type", Type, 0}, + {"TypeFor", Func, 22}, + {"TypeOf", Func, 0}, + {"Uint", Const, 0}, + {"Uint16", Const, 0}, + {"Uint32", Const, 0}, + {"Uint64", Const, 0}, + {"Uint8", Const, 0}, + {"Uintptr", Const, 0}, + {"UnsafePointer", Const, 0}, + {"Value", Type, 0}, + {"ValueError", Type, 0}, + {"ValueError.Kind", Field, 0}, + {"ValueError.Method", Field, 0}, + {"ValueOf", Func, 0}, + {"VisibleFields", Func, 17}, + {"Zero", Func, 0}, + }, + "regexp": { + {"(*Regexp).Copy", Method, 6}, + {"(*Regexp).Expand", Method, 0}, + {"(*Regexp).ExpandString", Method, 0}, + {"(*Regexp).Find", Method, 0}, + {"(*Regexp).FindAll", Method, 0}, + {"(*Regexp).FindAllIndex", Method, 0}, + {"(*Regexp).FindAllString", Method, 0}, + {"(*Regexp).FindAllStringIndex", Method, 0}, + {"(*Regexp).FindAllStringSubmatch", Method, 0}, + {"(*Regexp).FindAllStringSubmatchIndex", Method, 0}, + {"(*Regexp).FindAllSubmatch", Method, 0}, + {"(*Regexp).FindAllSubmatchIndex", Method, 0}, + {"(*Regexp).FindIndex", Method, 0}, + {"(*Regexp).FindReaderIndex", Method, 0}, + {"(*Regexp).FindReaderSubmatchIndex", Method, 0}, + {"(*Regexp).FindString", Method, 0}, + {"(*Regexp).FindStringIndex", Method, 0}, + {"(*Regexp).FindStringSubmatch", Method, 0}, + {"(*Regexp).FindStringSubmatchIndex", Method, 0}, + {"(*Regexp).FindSubmatch", Method, 0}, + {"(*Regexp).FindSubmatchIndex", Method, 0}, + {"(*Regexp).LiteralPrefix", Method, 0}, + {"(*Regexp).Longest", Method, 1}, + {"(*Regexp).MarshalText", Method, 21}, + {"(*Regexp).Match", Method, 0}, + {"(*Regexp).MatchReader", Method, 0}, + {"(*Regexp).MatchString", Method, 0}, + {"(*Regexp).NumSubexp", Method, 0}, + {"(*Regexp).ReplaceAll", Method, 0}, + {"(*Regexp).ReplaceAllFunc", Method, 0}, + {"(*Regexp).ReplaceAllLiteral", Method, 0}, + {"(*Regexp).ReplaceAllLiteralString", Method, 0}, + {"(*Regexp).ReplaceAllString", Method, 0}, + {"(*Regexp).ReplaceAllStringFunc", Method, 0}, + {"(*Regexp).Split", Method, 1}, + {"(*Regexp).String", Method, 0}, + {"(*Regexp).SubexpIndex", Method, 15}, + {"(*Regexp).SubexpNames", Method, 0}, + {"(*Regexp).UnmarshalText", Method, 21}, + {"Compile", Func, 0}, + {"CompilePOSIX", Func, 0}, + {"Match", Func, 0}, + {"MatchReader", Func, 0}, + {"MatchString", Func, 0}, + {"MustCompile", Func, 0}, + {"MustCompilePOSIX", Func, 0}, + {"QuoteMeta", Func, 0}, + {"Regexp", Type, 0}, + }, + "regexp/syntax": { + {"(*Error).Error", Method, 0}, + {"(*Inst).MatchEmptyWidth", Method, 0}, + {"(*Inst).MatchRune", Method, 0}, + {"(*Inst).MatchRunePos", Method, 3}, + {"(*Inst).String", Method, 0}, + {"(*Prog).Prefix", Method, 0}, + {"(*Prog).StartCond", Method, 0}, + {"(*Prog).String", Method, 0}, + {"(*Regexp).CapNames", Method, 0}, + {"(*Regexp).Equal", Method, 0}, + {"(*Regexp).MaxCap", Method, 0}, + {"(*Regexp).Simplify", Method, 0}, + {"(*Regexp).String", Method, 0}, + {"(ErrorCode).String", Method, 0}, + {"(InstOp).String", Method, 3}, + {"(Op).String", Method, 11}, + {"ClassNL", Const, 0}, + {"Compile", Func, 0}, + {"DotNL", Const, 0}, + {"EmptyBeginLine", Const, 0}, + {"EmptyBeginText", Const, 0}, + {"EmptyEndLine", Const, 0}, + {"EmptyEndText", Const, 0}, + {"EmptyNoWordBoundary", Const, 0}, + {"EmptyOp", Type, 0}, + {"EmptyOpContext", Func, 0}, + {"EmptyWordBoundary", Const, 0}, + {"ErrInternalError", Const, 0}, + {"ErrInvalidCharClass", Const, 0}, + {"ErrInvalidCharRange", Const, 0}, + {"ErrInvalidEscape", Const, 0}, + {"ErrInvalidNamedCapture", Const, 0}, + {"ErrInvalidPerlOp", Const, 0}, + {"ErrInvalidRepeatOp", Const, 0}, + {"ErrInvalidRepeatSize", Const, 0}, + {"ErrInvalidUTF8", Const, 0}, + {"ErrLarge", Const, 20}, + {"ErrMissingBracket", Const, 0}, + {"ErrMissingParen", Const, 0}, + {"ErrMissingRepeatArgument", Const, 0}, + {"ErrNestingDepth", Const, 19}, + {"ErrTrailingBackslash", Const, 0}, + {"ErrUnexpectedParen", Const, 1}, + {"Error", Type, 0}, + {"Error.Code", Field, 0}, + {"Error.Expr", Field, 0}, + {"ErrorCode", Type, 0}, + {"Flags", Type, 0}, + {"FoldCase", Const, 0}, + {"Inst", Type, 0}, + {"Inst.Arg", Field, 0}, + {"Inst.Op", Field, 0}, + {"Inst.Out", Field, 0}, + {"Inst.Rune", Field, 0}, + {"InstAlt", Const, 0}, + {"InstAltMatch", Const, 0}, + {"InstCapture", Const, 0}, + {"InstEmptyWidth", Const, 0}, + {"InstFail", Const, 0}, + {"InstMatch", Const, 0}, + {"InstNop", Const, 0}, + {"InstOp", Type, 0}, + {"InstRune", Const, 0}, + {"InstRune1", Const, 0}, + {"InstRuneAny", Const, 0}, + {"InstRuneAnyNotNL", Const, 0}, + {"IsWordChar", Func, 0}, + {"Literal", Const, 0}, + {"MatchNL", Const, 0}, + {"NonGreedy", Const, 0}, + {"OneLine", Const, 0}, + {"Op", Type, 0}, + {"OpAlternate", Const, 0}, + {"OpAnyChar", Const, 0}, + {"OpAnyCharNotNL", Const, 0}, + {"OpBeginLine", Const, 0}, + {"OpBeginText", Const, 0}, + {"OpCapture", Const, 0}, + {"OpCharClass", Const, 0}, + {"OpConcat", Const, 0}, + {"OpEmptyMatch", Const, 0}, + {"OpEndLine", Const, 0}, + {"OpEndText", Const, 0}, + {"OpLiteral", Const, 0}, + {"OpNoMatch", Const, 0}, + {"OpNoWordBoundary", Const, 0}, + {"OpPlus", Const, 0}, + {"OpQuest", Const, 0}, + {"OpRepeat", Const, 0}, + {"OpStar", Const, 0}, + {"OpWordBoundary", Const, 0}, + {"POSIX", Const, 0}, + {"Parse", Func, 0}, + {"Perl", Const, 0}, + {"PerlX", Const, 0}, + {"Prog", Type, 0}, + {"Prog.Inst", Field, 0}, + {"Prog.NumCap", Field, 0}, + {"Prog.Start", Field, 0}, + {"Regexp", Type, 0}, + {"Regexp.Cap", Field, 0}, + {"Regexp.Flags", Field, 0}, + {"Regexp.Max", Field, 0}, + {"Regexp.Min", Field, 0}, + {"Regexp.Name", Field, 0}, + {"Regexp.Op", Field, 0}, + {"Regexp.Rune", Field, 0}, + {"Regexp.Rune0", Field, 0}, + {"Regexp.Sub", Field, 0}, + {"Regexp.Sub0", Field, 0}, + {"Simple", Const, 0}, + {"UnicodeGroups", Const, 0}, + {"WasDollar", Const, 0}, + }, + "runtime": { + {"(*BlockProfileRecord).Stack", Method, 1}, + {"(*Frames).Next", Method, 7}, + {"(*Func).Entry", Method, 0}, + {"(*Func).FileLine", Method, 0}, + {"(*Func).Name", Method, 0}, + {"(*MemProfileRecord).InUseBytes", Method, 0}, + {"(*MemProfileRecord).InUseObjects", Method, 0}, + {"(*MemProfileRecord).Stack", Method, 0}, + {"(*PanicNilError).Error", Method, 21}, + {"(*PanicNilError).RuntimeError", Method, 21}, + {"(*Pinner).Pin", Method, 21}, + {"(*Pinner).Unpin", Method, 21}, + {"(*StackRecord).Stack", Method, 0}, + {"(*TypeAssertionError).Error", Method, 0}, + {"(*TypeAssertionError).RuntimeError", Method, 0}, + {"BlockProfile", Func, 1}, + {"BlockProfileRecord", Type, 1}, + {"BlockProfileRecord.Count", Field, 1}, + {"BlockProfileRecord.Cycles", Field, 1}, + {"BlockProfileRecord.StackRecord", Field, 1}, + {"Breakpoint", Func, 0}, + {"CPUProfile", Func, 0}, + {"Caller", Func, 0}, + {"Callers", Func, 0}, + {"CallersFrames", Func, 7}, + {"Compiler", Const, 0}, + {"Error", Type, 0}, + {"Frame", Type, 7}, + {"Frame.Entry", Field, 7}, + {"Frame.File", Field, 7}, + {"Frame.Func", Field, 7}, + {"Frame.Function", Field, 7}, + {"Frame.Line", Field, 7}, + {"Frame.PC", Field, 7}, + {"Frames", Type, 7}, + {"Func", Type, 0}, + {"FuncForPC", Func, 0}, + {"GC", Func, 0}, + {"GOARCH", Const, 0}, + {"GOMAXPROCS", Func, 0}, + {"GOOS", Const, 0}, + {"GOROOT", Func, 0}, + {"Goexit", Func, 0}, + {"GoroutineProfile", Func, 0}, + {"Gosched", Func, 0}, + {"KeepAlive", Func, 7}, + {"LockOSThread", Func, 0}, + {"MemProfile", Func, 0}, + {"MemProfileRate", Var, 0}, + {"MemProfileRecord", Type, 0}, + {"MemProfileRecord.AllocBytes", Field, 0}, + {"MemProfileRecord.AllocObjects", Field, 0}, + {"MemProfileRecord.FreeBytes", Field, 0}, + {"MemProfileRecord.FreeObjects", Field, 0}, + {"MemProfileRecord.Stack0", Field, 0}, + {"MemStats", Type, 0}, + {"MemStats.Alloc", Field, 0}, + {"MemStats.BuckHashSys", Field, 0}, + {"MemStats.BySize", Field, 0}, + {"MemStats.DebugGC", Field, 0}, + {"MemStats.EnableGC", Field, 0}, + {"MemStats.Frees", Field, 0}, + {"MemStats.GCCPUFraction", Field, 5}, + {"MemStats.GCSys", Field, 2}, + {"MemStats.HeapAlloc", Field, 0}, + {"MemStats.HeapIdle", Field, 0}, + {"MemStats.HeapInuse", Field, 0}, + {"MemStats.HeapObjects", Field, 0}, + {"MemStats.HeapReleased", Field, 0}, + {"MemStats.HeapSys", Field, 0}, + {"MemStats.LastGC", Field, 0}, + {"MemStats.Lookups", Field, 0}, + {"MemStats.MCacheInuse", Field, 0}, + {"MemStats.MCacheSys", Field, 0}, + {"MemStats.MSpanInuse", Field, 0}, + {"MemStats.MSpanSys", Field, 0}, + {"MemStats.Mallocs", Field, 0}, + {"MemStats.NextGC", Field, 0}, + {"MemStats.NumForcedGC", Field, 8}, + {"MemStats.NumGC", Field, 0}, + {"MemStats.OtherSys", Field, 2}, + {"MemStats.PauseEnd", Field, 4}, + {"MemStats.PauseNs", Field, 0}, + {"MemStats.PauseTotalNs", Field, 0}, + {"MemStats.StackInuse", Field, 0}, + {"MemStats.StackSys", Field, 0}, + {"MemStats.Sys", Field, 0}, + {"MemStats.TotalAlloc", Field, 0}, + {"MutexProfile", Func, 8}, + {"NumCPU", Func, 0}, + {"NumCgoCall", Func, 0}, + {"NumGoroutine", Func, 0}, + {"PanicNilError", Type, 21}, + {"Pinner", Type, 21}, + {"ReadMemStats", Func, 0}, + {"ReadTrace", Func, 5}, + {"SetBlockProfileRate", Func, 1}, + {"SetCPUProfileRate", Func, 0}, + {"SetCgoTraceback", Func, 7}, + {"SetFinalizer", Func, 0}, + {"SetMutexProfileFraction", Func, 8}, + {"Stack", Func, 0}, + {"StackRecord", Type, 0}, + {"StackRecord.Stack0", Field, 0}, + {"StartTrace", Func, 5}, + {"StopTrace", Func, 5}, + {"ThreadCreateProfile", Func, 0}, + {"TypeAssertionError", Type, 0}, + {"UnlockOSThread", Func, 0}, + {"Version", Func, 0}, + }, + "runtime/cgo": { + {"(Handle).Delete", Method, 17}, + {"(Handle).Value", Method, 17}, + {"Handle", Type, 17}, + {"Incomplete", Type, 20}, + {"NewHandle", Func, 17}, + }, + "runtime/coverage": { + {"ClearCounters", Func, 20}, + {"WriteCounters", Func, 20}, + {"WriteCountersDir", Func, 20}, + {"WriteMeta", Func, 20}, + {"WriteMetaDir", Func, 20}, + }, + "runtime/debug": { + {"(*BuildInfo).String", Method, 18}, + {"BuildInfo", Type, 12}, + {"BuildInfo.Deps", Field, 12}, + {"BuildInfo.GoVersion", Field, 18}, + {"BuildInfo.Main", Field, 12}, + {"BuildInfo.Path", Field, 12}, + {"BuildInfo.Settings", Field, 18}, + {"BuildSetting", Type, 18}, + {"BuildSetting.Key", Field, 18}, + {"BuildSetting.Value", Field, 18}, + {"FreeOSMemory", Func, 1}, + {"GCStats", Type, 1}, + {"GCStats.LastGC", Field, 1}, + {"GCStats.NumGC", Field, 1}, + {"GCStats.Pause", Field, 1}, + {"GCStats.PauseEnd", Field, 4}, + {"GCStats.PauseQuantiles", Field, 1}, + {"GCStats.PauseTotal", Field, 1}, + {"Module", Type, 12}, + {"Module.Path", Field, 12}, + {"Module.Replace", Field, 12}, + {"Module.Sum", Field, 12}, + {"Module.Version", Field, 12}, + {"ParseBuildInfo", Func, 18}, + {"PrintStack", Func, 0}, + {"ReadBuildInfo", Func, 12}, + {"ReadGCStats", Func, 1}, + {"SetGCPercent", Func, 1}, + {"SetMaxStack", Func, 2}, + {"SetMaxThreads", Func, 2}, + {"SetMemoryLimit", Func, 19}, + {"SetPanicOnFault", Func, 3}, + {"SetTraceback", Func, 6}, + {"Stack", Func, 0}, + {"WriteHeapDump", Func, 3}, + }, + "runtime/metrics": { + {"(Value).Float64", Method, 16}, + {"(Value).Float64Histogram", Method, 16}, + {"(Value).Kind", Method, 16}, + {"(Value).Uint64", Method, 16}, + {"All", Func, 16}, + {"Description", Type, 16}, + {"Description.Cumulative", Field, 16}, + {"Description.Description", Field, 16}, + {"Description.Kind", Field, 16}, + {"Description.Name", Field, 16}, + {"Float64Histogram", Type, 16}, + {"Float64Histogram.Buckets", Field, 16}, + {"Float64Histogram.Counts", Field, 16}, + {"KindBad", Const, 16}, + {"KindFloat64", Const, 16}, + {"KindFloat64Histogram", Const, 16}, + {"KindUint64", Const, 16}, + {"Read", Func, 16}, + {"Sample", Type, 16}, + {"Sample.Name", Field, 16}, + {"Sample.Value", Field, 16}, + {"Value", Type, 16}, + {"ValueKind", Type, 16}, + }, + "runtime/pprof": { + {"(*Profile).Add", Method, 0}, + {"(*Profile).Count", Method, 0}, + {"(*Profile).Name", Method, 0}, + {"(*Profile).Remove", Method, 0}, + {"(*Profile).WriteTo", Method, 0}, + {"Do", Func, 9}, + {"ForLabels", Func, 9}, + {"Label", Func, 9}, + {"LabelSet", Type, 9}, + {"Labels", Func, 9}, + {"Lookup", Func, 0}, + {"NewProfile", Func, 0}, + {"Profile", Type, 0}, + {"Profiles", Func, 0}, + {"SetGoroutineLabels", Func, 9}, + {"StartCPUProfile", Func, 0}, + {"StopCPUProfile", Func, 0}, + {"WithLabels", Func, 9}, + {"WriteHeapProfile", Func, 0}, + }, + "runtime/trace": { + {"(*Region).End", Method, 11}, + {"(*Task).End", Method, 11}, + {"IsEnabled", Func, 11}, + {"Log", Func, 11}, + {"Logf", Func, 11}, + {"NewTask", Func, 11}, + {"Region", Type, 11}, + {"Start", Func, 5}, + {"StartRegion", Func, 11}, + {"Stop", Func, 5}, + {"Task", Type, 11}, + {"WithRegion", Func, 11}, + }, + "slices": { + {"BinarySearch", Func, 21}, + {"BinarySearchFunc", Func, 21}, + {"Clip", Func, 21}, + {"Clone", Func, 21}, + {"Compact", Func, 21}, + {"CompactFunc", Func, 21}, + {"Compare", Func, 21}, + {"CompareFunc", Func, 21}, + {"Concat", Func, 22}, + {"Contains", Func, 21}, + {"ContainsFunc", Func, 21}, + {"Delete", Func, 21}, + {"DeleteFunc", Func, 21}, + {"Equal", Func, 21}, + {"EqualFunc", Func, 21}, + {"Grow", Func, 21}, + {"Index", Func, 21}, + {"IndexFunc", Func, 21}, + {"Insert", Func, 21}, + {"IsSorted", Func, 21}, + {"IsSortedFunc", Func, 21}, + {"Max", Func, 21}, + {"MaxFunc", Func, 21}, + {"Min", Func, 21}, + {"MinFunc", Func, 21}, + {"Replace", Func, 21}, + {"Reverse", Func, 21}, + {"Sort", Func, 21}, + {"SortFunc", Func, 21}, + {"SortStableFunc", Func, 21}, + }, + "sort": { + {"(Float64Slice).Len", Method, 0}, + {"(Float64Slice).Less", Method, 0}, + {"(Float64Slice).Search", Method, 0}, + {"(Float64Slice).Sort", Method, 0}, + {"(Float64Slice).Swap", Method, 0}, + {"(IntSlice).Len", Method, 0}, + {"(IntSlice).Less", Method, 0}, + {"(IntSlice).Search", Method, 0}, + {"(IntSlice).Sort", Method, 0}, + {"(IntSlice).Swap", Method, 0}, + {"(StringSlice).Len", Method, 0}, + {"(StringSlice).Less", Method, 0}, + {"(StringSlice).Search", Method, 0}, + {"(StringSlice).Sort", Method, 0}, + {"(StringSlice).Swap", Method, 0}, + {"Find", Func, 19}, + {"Float64Slice", Type, 0}, + {"Float64s", Func, 0}, + {"Float64sAreSorted", Func, 0}, + {"IntSlice", Type, 0}, + {"Interface", Type, 0}, + {"Ints", Func, 0}, + {"IntsAreSorted", Func, 0}, + {"IsSorted", Func, 0}, + {"Reverse", Func, 1}, + {"Search", Func, 0}, + {"SearchFloat64s", Func, 0}, + {"SearchInts", Func, 0}, + {"SearchStrings", Func, 0}, + {"Slice", Func, 8}, + {"SliceIsSorted", Func, 8}, + {"SliceStable", Func, 8}, + {"Sort", Func, 0}, + {"Stable", Func, 2}, + {"StringSlice", Type, 0}, + {"Strings", Func, 0}, + {"StringsAreSorted", Func, 0}, + }, + "strconv": { + {"(*NumError).Error", Method, 0}, + {"(*NumError).Unwrap", Method, 14}, + {"AppendBool", Func, 0}, + {"AppendFloat", Func, 0}, + {"AppendInt", Func, 0}, + {"AppendQuote", Func, 0}, + {"AppendQuoteRune", Func, 0}, + {"AppendQuoteRuneToASCII", Func, 0}, + {"AppendQuoteRuneToGraphic", Func, 6}, + {"AppendQuoteToASCII", Func, 0}, + {"AppendQuoteToGraphic", Func, 6}, + {"AppendUint", Func, 0}, + {"Atoi", Func, 0}, + {"CanBackquote", Func, 0}, + {"ErrRange", Var, 0}, + {"ErrSyntax", Var, 0}, + {"FormatBool", Func, 0}, + {"FormatComplex", Func, 15}, + {"FormatFloat", Func, 0}, + {"FormatInt", Func, 0}, + {"FormatUint", Func, 0}, + {"IntSize", Const, 0}, + {"IsGraphic", Func, 6}, + {"IsPrint", Func, 0}, + {"Itoa", Func, 0}, + {"NumError", Type, 0}, + {"NumError.Err", Field, 0}, + {"NumError.Func", Field, 0}, + {"NumError.Num", Field, 0}, + {"ParseBool", Func, 0}, + {"ParseComplex", Func, 15}, + {"ParseFloat", Func, 0}, + {"ParseInt", Func, 0}, + {"ParseUint", Func, 0}, + {"Quote", Func, 0}, + {"QuoteRune", Func, 0}, + {"QuoteRuneToASCII", Func, 0}, + {"QuoteRuneToGraphic", Func, 6}, + {"QuoteToASCII", Func, 0}, + {"QuoteToGraphic", Func, 6}, + {"QuotedPrefix", Func, 17}, + {"Unquote", Func, 0}, + {"UnquoteChar", Func, 0}, + }, + "strings": { + {"(*Builder).Cap", Method, 12}, + {"(*Builder).Grow", Method, 10}, + {"(*Builder).Len", Method, 10}, + {"(*Builder).Reset", Method, 10}, + {"(*Builder).String", Method, 10}, + {"(*Builder).Write", Method, 10}, + {"(*Builder).WriteByte", Method, 10}, + {"(*Builder).WriteRune", Method, 10}, + {"(*Builder).WriteString", Method, 10}, + {"(*Reader).Len", Method, 0}, + {"(*Reader).Read", Method, 0}, + {"(*Reader).ReadAt", Method, 0}, + {"(*Reader).ReadByte", Method, 0}, + {"(*Reader).ReadRune", Method, 0}, + {"(*Reader).Reset", Method, 7}, + {"(*Reader).Seek", Method, 0}, + {"(*Reader).Size", Method, 5}, + {"(*Reader).UnreadByte", Method, 0}, + {"(*Reader).UnreadRune", Method, 0}, + {"(*Reader).WriteTo", Method, 1}, + {"(*Replacer).Replace", Method, 0}, + {"(*Replacer).WriteString", Method, 0}, + {"Builder", Type, 10}, + {"Clone", Func, 18}, + {"Compare", Func, 5}, + {"Contains", Func, 0}, + {"ContainsAny", Func, 0}, + {"ContainsFunc", Func, 21}, + {"ContainsRune", Func, 0}, + {"Count", Func, 0}, + {"Cut", Func, 18}, + {"CutPrefix", Func, 20}, + {"CutSuffix", Func, 20}, + {"EqualFold", Func, 0}, + {"Fields", Func, 0}, + {"FieldsFunc", Func, 0}, + {"HasPrefix", Func, 0}, + {"HasSuffix", Func, 0}, + {"Index", Func, 0}, + {"IndexAny", Func, 0}, + {"IndexByte", Func, 2}, + {"IndexFunc", Func, 0}, + {"IndexRune", Func, 0}, + {"Join", Func, 0}, + {"LastIndex", Func, 0}, + {"LastIndexAny", Func, 0}, + {"LastIndexByte", Func, 5}, + {"LastIndexFunc", Func, 0}, + {"Map", Func, 0}, + {"NewReader", Func, 0}, + {"NewReplacer", Func, 0}, + {"Reader", Type, 0}, + {"Repeat", Func, 0}, + {"Replace", Func, 0}, + {"ReplaceAll", Func, 12}, + {"Replacer", Type, 0}, + {"Split", Func, 0}, + {"SplitAfter", Func, 0}, + {"SplitAfterN", Func, 0}, + {"SplitN", Func, 0}, + {"Title", Func, 0}, + {"ToLower", Func, 0}, + {"ToLowerSpecial", Func, 0}, + {"ToTitle", Func, 0}, + {"ToTitleSpecial", Func, 0}, + {"ToUpper", Func, 0}, + {"ToUpperSpecial", Func, 0}, + {"ToValidUTF8", Func, 13}, + {"Trim", Func, 0}, + {"TrimFunc", Func, 0}, + {"TrimLeft", Func, 0}, + {"TrimLeftFunc", Func, 0}, + {"TrimPrefix", Func, 1}, + {"TrimRight", Func, 0}, + {"TrimRightFunc", Func, 0}, + {"TrimSpace", Func, 0}, + {"TrimSuffix", Func, 1}, + }, + "sync": { + {"(*Cond).Broadcast", Method, 0}, + {"(*Cond).Signal", Method, 0}, + {"(*Cond).Wait", Method, 0}, + {"(*Map).CompareAndDelete", Method, 20}, + {"(*Map).CompareAndSwap", Method, 20}, + {"(*Map).Delete", Method, 9}, + {"(*Map).Load", Method, 9}, + {"(*Map).LoadAndDelete", Method, 15}, + {"(*Map).LoadOrStore", Method, 9}, + {"(*Map).Range", Method, 9}, + {"(*Map).Store", Method, 9}, + {"(*Map).Swap", Method, 20}, + {"(*Mutex).Lock", Method, 0}, + {"(*Mutex).TryLock", Method, 18}, + {"(*Mutex).Unlock", Method, 0}, + {"(*Once).Do", Method, 0}, + {"(*Pool).Get", Method, 3}, + {"(*Pool).Put", Method, 3}, + {"(*RWMutex).Lock", Method, 0}, + {"(*RWMutex).RLock", Method, 0}, + {"(*RWMutex).RLocker", Method, 0}, + {"(*RWMutex).RUnlock", Method, 0}, + {"(*RWMutex).TryLock", Method, 18}, + {"(*RWMutex).TryRLock", Method, 18}, + {"(*RWMutex).Unlock", Method, 0}, + {"(*WaitGroup).Add", Method, 0}, + {"(*WaitGroup).Done", Method, 0}, + {"(*WaitGroup).Wait", Method, 0}, + {"Cond", Type, 0}, + {"Cond.L", Field, 0}, + {"Locker", Type, 0}, + {"Map", Type, 9}, + {"Mutex", Type, 0}, + {"NewCond", Func, 0}, + {"Once", Type, 0}, + {"OnceFunc", Func, 21}, + {"OnceValue", Func, 21}, + {"OnceValues", Func, 21}, + {"Pool", Type, 3}, + {"Pool.New", Field, 3}, + {"RWMutex", Type, 0}, + {"WaitGroup", Type, 0}, + }, + "sync/atomic": { + {"(*Bool).CompareAndSwap", Method, 19}, + {"(*Bool).Load", Method, 19}, + {"(*Bool).Store", Method, 19}, + {"(*Bool).Swap", Method, 19}, + {"(*Int32).Add", Method, 19}, + {"(*Int32).CompareAndSwap", Method, 19}, + {"(*Int32).Load", Method, 19}, + {"(*Int32).Store", Method, 19}, + {"(*Int32).Swap", Method, 19}, + {"(*Int64).Add", Method, 19}, + {"(*Int64).CompareAndSwap", Method, 19}, + {"(*Int64).Load", Method, 19}, + {"(*Int64).Store", Method, 19}, + {"(*Int64).Swap", Method, 19}, + {"(*Pointer).CompareAndSwap", Method, 19}, + {"(*Pointer).Load", Method, 19}, + {"(*Pointer).Store", Method, 19}, + {"(*Pointer).Swap", Method, 19}, + {"(*Uint32).Add", Method, 19}, + {"(*Uint32).CompareAndSwap", Method, 19}, + {"(*Uint32).Load", Method, 19}, + {"(*Uint32).Store", Method, 19}, + {"(*Uint32).Swap", Method, 19}, + {"(*Uint64).Add", Method, 19}, + {"(*Uint64).CompareAndSwap", Method, 19}, + {"(*Uint64).Load", Method, 19}, + {"(*Uint64).Store", Method, 19}, + {"(*Uint64).Swap", Method, 19}, + {"(*Uintptr).Add", Method, 19}, + {"(*Uintptr).CompareAndSwap", Method, 19}, + {"(*Uintptr).Load", Method, 19}, + {"(*Uintptr).Store", Method, 19}, + {"(*Uintptr).Swap", Method, 19}, + {"(*Value).CompareAndSwap", Method, 17}, + {"(*Value).Load", Method, 4}, + {"(*Value).Store", Method, 4}, + {"(*Value).Swap", Method, 17}, + {"AddInt32", Func, 0}, + {"AddInt64", Func, 0}, + {"AddUint32", Func, 0}, + {"AddUint64", Func, 0}, + {"AddUintptr", Func, 0}, + {"Bool", Type, 19}, + {"CompareAndSwapInt32", Func, 0}, + {"CompareAndSwapInt64", Func, 0}, + {"CompareAndSwapPointer", Func, 0}, + {"CompareAndSwapUint32", Func, 0}, + {"CompareAndSwapUint64", Func, 0}, + {"CompareAndSwapUintptr", Func, 0}, + {"Int32", Type, 19}, + {"Int64", Type, 19}, + {"LoadInt32", Func, 0}, + {"LoadInt64", Func, 0}, + {"LoadPointer", Func, 0}, + {"LoadUint32", Func, 0}, + {"LoadUint64", Func, 0}, + {"LoadUintptr", Func, 0}, + {"Pointer", Type, 19}, + {"StoreInt32", Func, 0}, + {"StoreInt64", Func, 0}, + {"StorePointer", Func, 0}, + {"StoreUint32", Func, 0}, + {"StoreUint64", Func, 0}, + {"StoreUintptr", Func, 0}, + {"SwapInt32", Func, 2}, + {"SwapInt64", Func, 2}, + {"SwapPointer", Func, 2}, + {"SwapUint32", Func, 2}, + {"SwapUint64", Func, 2}, + {"SwapUintptr", Func, 2}, + {"Uint32", Type, 19}, + {"Uint64", Type, 19}, + {"Uintptr", Type, 19}, + {"Value", Type, 4}, + }, + "syscall": { + {"(*Cmsghdr).SetLen", Method, 0}, + {"(*DLL).FindProc", Method, 0}, + {"(*DLL).MustFindProc", Method, 0}, + {"(*DLL).Release", Method, 0}, + {"(*DLLError).Error", Method, 0}, + {"(*DLLError).Unwrap", Method, 16}, + {"(*Filetime).Nanoseconds", Method, 0}, + {"(*Iovec).SetLen", Method, 0}, + {"(*LazyDLL).Handle", Method, 0}, + {"(*LazyDLL).Load", Method, 0}, + {"(*LazyDLL).NewProc", Method, 0}, + {"(*LazyProc).Addr", Method, 0}, + {"(*LazyProc).Call", Method, 0}, + {"(*LazyProc).Find", Method, 0}, + {"(*Msghdr).SetControllen", Method, 0}, + {"(*Proc).Addr", Method, 0}, + {"(*Proc).Call", Method, 0}, + {"(*PtraceRegs).PC", Method, 0}, + {"(*PtraceRegs).SetPC", Method, 0}, + {"(*RawSockaddrAny).Sockaddr", Method, 0}, + {"(*SID).Copy", Method, 0}, + {"(*SID).Len", Method, 0}, + {"(*SID).LookupAccount", Method, 0}, + {"(*SID).String", Method, 0}, + {"(*Timespec).Nano", Method, 0}, + {"(*Timespec).Unix", Method, 0}, + {"(*Timeval).Nano", Method, 0}, + {"(*Timeval).Nanoseconds", Method, 0}, + {"(*Timeval).Unix", Method, 0}, + {"(Errno).Error", Method, 0}, + {"(Errno).Is", Method, 13}, + {"(Errno).Temporary", Method, 0}, + {"(Errno).Timeout", Method, 0}, + {"(Signal).Signal", Method, 0}, + {"(Signal).String", Method, 0}, + {"(Token).Close", Method, 0}, + {"(Token).GetTokenPrimaryGroup", Method, 0}, + {"(Token).GetTokenUser", Method, 0}, + {"(Token).GetUserProfileDirectory", Method, 0}, + {"(WaitStatus).Continued", Method, 0}, + {"(WaitStatus).CoreDump", Method, 0}, + {"(WaitStatus).ExitStatus", Method, 0}, + {"(WaitStatus).Exited", Method, 0}, + {"(WaitStatus).Signal", Method, 0}, + {"(WaitStatus).Signaled", Method, 0}, + {"(WaitStatus).StopSignal", Method, 0}, + {"(WaitStatus).Stopped", Method, 0}, + {"(WaitStatus).TrapCause", Method, 0}, + {"AF_ALG", Const, 0}, + {"AF_APPLETALK", Const, 0}, + {"AF_ARP", Const, 0}, + {"AF_ASH", Const, 0}, + {"AF_ATM", Const, 0}, + {"AF_ATMPVC", Const, 0}, + {"AF_ATMSVC", Const, 0}, + {"AF_AX25", Const, 0}, + {"AF_BLUETOOTH", Const, 0}, + {"AF_BRIDGE", Const, 0}, + {"AF_CAIF", Const, 0}, + {"AF_CAN", Const, 0}, + {"AF_CCITT", Const, 0}, + {"AF_CHAOS", Const, 0}, + {"AF_CNT", Const, 0}, + {"AF_COIP", Const, 0}, + {"AF_DATAKIT", Const, 0}, + {"AF_DECnet", Const, 0}, + {"AF_DLI", Const, 0}, + {"AF_E164", Const, 0}, + {"AF_ECMA", Const, 0}, + {"AF_ECONET", Const, 0}, + {"AF_ENCAP", Const, 1}, + {"AF_FILE", Const, 0}, + {"AF_HYLINK", Const, 0}, + {"AF_IEEE80211", Const, 0}, + {"AF_IEEE802154", Const, 0}, + {"AF_IMPLINK", Const, 0}, + {"AF_INET", Const, 0}, + {"AF_INET6", Const, 0}, + {"AF_INET6_SDP", Const, 3}, + {"AF_INET_SDP", Const, 3}, + {"AF_IPX", Const, 0}, + {"AF_IRDA", Const, 0}, + {"AF_ISDN", Const, 0}, + {"AF_ISO", Const, 0}, + {"AF_IUCV", Const, 0}, + {"AF_KEY", Const, 0}, + {"AF_LAT", Const, 0}, + {"AF_LINK", Const, 0}, + {"AF_LLC", Const, 0}, + {"AF_LOCAL", Const, 0}, + {"AF_MAX", Const, 0}, + {"AF_MPLS", Const, 1}, + {"AF_NATM", Const, 0}, + {"AF_NDRV", Const, 0}, + {"AF_NETBEUI", Const, 0}, + {"AF_NETBIOS", Const, 0}, + {"AF_NETGRAPH", Const, 0}, + {"AF_NETLINK", Const, 0}, + {"AF_NETROM", Const, 0}, + {"AF_NS", Const, 0}, + {"AF_OROUTE", Const, 1}, + {"AF_OSI", Const, 0}, + {"AF_PACKET", Const, 0}, + {"AF_PHONET", Const, 0}, + {"AF_PPP", Const, 0}, + {"AF_PPPOX", Const, 0}, + {"AF_PUP", Const, 0}, + {"AF_RDS", Const, 0}, + {"AF_RESERVED_36", Const, 0}, + {"AF_ROSE", Const, 0}, + {"AF_ROUTE", Const, 0}, + {"AF_RXRPC", Const, 0}, + {"AF_SCLUSTER", Const, 0}, + {"AF_SECURITY", Const, 0}, + {"AF_SIP", Const, 0}, + {"AF_SLOW", Const, 0}, + {"AF_SNA", Const, 0}, + {"AF_SYSTEM", Const, 0}, + {"AF_TIPC", Const, 0}, + {"AF_UNIX", Const, 0}, + {"AF_UNSPEC", Const, 0}, + {"AF_UTUN", Const, 16}, + {"AF_VENDOR00", Const, 0}, + {"AF_VENDOR01", Const, 0}, + {"AF_VENDOR02", Const, 0}, + {"AF_VENDOR03", Const, 0}, + {"AF_VENDOR04", Const, 0}, + {"AF_VENDOR05", Const, 0}, + {"AF_VENDOR06", Const, 0}, + {"AF_VENDOR07", Const, 0}, + {"AF_VENDOR08", Const, 0}, + {"AF_VENDOR09", Const, 0}, + {"AF_VENDOR10", Const, 0}, + {"AF_VENDOR11", Const, 0}, + {"AF_VENDOR12", Const, 0}, + {"AF_VENDOR13", Const, 0}, + {"AF_VENDOR14", Const, 0}, + {"AF_VENDOR15", Const, 0}, + {"AF_VENDOR16", Const, 0}, + {"AF_VENDOR17", Const, 0}, + {"AF_VENDOR18", Const, 0}, + {"AF_VENDOR19", Const, 0}, + {"AF_VENDOR20", Const, 0}, + {"AF_VENDOR21", Const, 0}, + {"AF_VENDOR22", Const, 0}, + {"AF_VENDOR23", Const, 0}, + {"AF_VENDOR24", Const, 0}, + {"AF_VENDOR25", Const, 0}, + {"AF_VENDOR26", Const, 0}, + {"AF_VENDOR27", Const, 0}, + {"AF_VENDOR28", Const, 0}, + {"AF_VENDOR29", Const, 0}, + {"AF_VENDOR30", Const, 0}, + {"AF_VENDOR31", Const, 0}, + {"AF_VENDOR32", Const, 0}, + {"AF_VENDOR33", Const, 0}, + {"AF_VENDOR34", Const, 0}, + {"AF_VENDOR35", Const, 0}, + {"AF_VENDOR36", Const, 0}, + {"AF_VENDOR37", Const, 0}, + {"AF_VENDOR38", Const, 0}, + {"AF_VENDOR39", Const, 0}, + {"AF_VENDOR40", Const, 0}, + {"AF_VENDOR41", Const, 0}, + {"AF_VENDOR42", Const, 0}, + {"AF_VENDOR43", Const, 0}, + {"AF_VENDOR44", Const, 0}, + {"AF_VENDOR45", Const, 0}, + {"AF_VENDOR46", Const, 0}, + {"AF_VENDOR47", Const, 0}, + {"AF_WANPIPE", Const, 0}, + {"AF_X25", Const, 0}, + {"AI_CANONNAME", Const, 1}, + {"AI_NUMERICHOST", Const, 1}, + {"AI_PASSIVE", Const, 1}, + {"APPLICATION_ERROR", Const, 0}, + {"ARPHRD_ADAPT", Const, 0}, + {"ARPHRD_APPLETLK", Const, 0}, + {"ARPHRD_ARCNET", Const, 0}, + {"ARPHRD_ASH", Const, 0}, + {"ARPHRD_ATM", Const, 0}, + {"ARPHRD_AX25", Const, 0}, + {"ARPHRD_BIF", Const, 0}, + {"ARPHRD_CHAOS", Const, 0}, + {"ARPHRD_CISCO", Const, 0}, + {"ARPHRD_CSLIP", Const, 0}, + {"ARPHRD_CSLIP6", Const, 0}, + {"ARPHRD_DDCMP", Const, 0}, + {"ARPHRD_DLCI", Const, 0}, + {"ARPHRD_ECONET", Const, 0}, + {"ARPHRD_EETHER", Const, 0}, + {"ARPHRD_ETHER", Const, 0}, + {"ARPHRD_EUI64", Const, 0}, + {"ARPHRD_FCAL", Const, 0}, + {"ARPHRD_FCFABRIC", Const, 0}, + {"ARPHRD_FCPL", Const, 0}, + {"ARPHRD_FCPP", Const, 0}, + {"ARPHRD_FDDI", Const, 0}, + {"ARPHRD_FRAD", Const, 0}, + {"ARPHRD_FRELAY", Const, 1}, + {"ARPHRD_HDLC", Const, 0}, + {"ARPHRD_HIPPI", Const, 0}, + {"ARPHRD_HWX25", Const, 0}, + {"ARPHRD_IEEE1394", Const, 0}, + {"ARPHRD_IEEE802", Const, 0}, + {"ARPHRD_IEEE80211", Const, 0}, + {"ARPHRD_IEEE80211_PRISM", Const, 0}, + {"ARPHRD_IEEE80211_RADIOTAP", Const, 0}, + {"ARPHRD_IEEE802154", Const, 0}, + {"ARPHRD_IEEE802154_PHY", Const, 0}, + {"ARPHRD_IEEE802_TR", Const, 0}, + {"ARPHRD_INFINIBAND", Const, 0}, + {"ARPHRD_IPDDP", Const, 0}, + {"ARPHRD_IPGRE", Const, 0}, + {"ARPHRD_IRDA", Const, 0}, + {"ARPHRD_LAPB", Const, 0}, + {"ARPHRD_LOCALTLK", Const, 0}, + {"ARPHRD_LOOPBACK", Const, 0}, + {"ARPHRD_METRICOM", Const, 0}, + {"ARPHRD_NETROM", Const, 0}, + {"ARPHRD_NONE", Const, 0}, + {"ARPHRD_PIMREG", Const, 0}, + {"ARPHRD_PPP", Const, 0}, + {"ARPHRD_PRONET", Const, 0}, + {"ARPHRD_RAWHDLC", Const, 0}, + {"ARPHRD_ROSE", Const, 0}, + {"ARPHRD_RSRVD", Const, 0}, + {"ARPHRD_SIT", Const, 0}, + {"ARPHRD_SKIP", Const, 0}, + {"ARPHRD_SLIP", Const, 0}, + {"ARPHRD_SLIP6", Const, 0}, + {"ARPHRD_STRIP", Const, 1}, + {"ARPHRD_TUNNEL", Const, 0}, + {"ARPHRD_TUNNEL6", Const, 0}, + {"ARPHRD_VOID", Const, 0}, + {"ARPHRD_X25", Const, 0}, + {"AUTHTYPE_CLIENT", Const, 0}, + {"AUTHTYPE_SERVER", Const, 0}, + {"Accept", Func, 0}, + {"Accept4", Func, 1}, + {"AcceptEx", Func, 0}, + {"Access", Func, 0}, + {"Acct", Func, 0}, + {"AddrinfoW", Type, 1}, + {"AddrinfoW.Addr", Field, 1}, + {"AddrinfoW.Addrlen", Field, 1}, + {"AddrinfoW.Canonname", Field, 1}, + {"AddrinfoW.Family", Field, 1}, + {"AddrinfoW.Flags", Field, 1}, + {"AddrinfoW.Next", Field, 1}, + {"AddrinfoW.Protocol", Field, 1}, + {"AddrinfoW.Socktype", Field, 1}, + {"Adjtime", Func, 0}, + {"Adjtimex", Func, 0}, + {"AllThreadsSyscall", Func, 16}, + {"AllThreadsSyscall6", Func, 16}, + {"AttachLsf", Func, 0}, + {"B0", Const, 0}, + {"B1000000", Const, 0}, + {"B110", Const, 0}, + {"B115200", Const, 0}, + {"B1152000", Const, 0}, + {"B1200", Const, 0}, + {"B134", Const, 0}, + {"B14400", Const, 1}, + {"B150", Const, 0}, + {"B1500000", Const, 0}, + {"B1800", Const, 0}, + {"B19200", Const, 0}, + {"B200", Const, 0}, + {"B2000000", Const, 0}, + {"B230400", Const, 0}, + {"B2400", Const, 0}, + {"B2500000", Const, 0}, + {"B28800", Const, 1}, + {"B300", Const, 0}, + {"B3000000", Const, 0}, + {"B3500000", Const, 0}, + {"B38400", Const, 0}, + {"B4000000", Const, 0}, + {"B460800", Const, 0}, + {"B4800", Const, 0}, + {"B50", Const, 0}, + {"B500000", Const, 0}, + {"B57600", Const, 0}, + {"B576000", Const, 0}, + {"B600", Const, 0}, + {"B7200", Const, 1}, + {"B75", Const, 0}, + {"B76800", Const, 1}, + {"B921600", Const, 0}, + {"B9600", Const, 0}, + {"BASE_PROTOCOL", Const, 2}, + {"BIOCFEEDBACK", Const, 0}, + {"BIOCFLUSH", Const, 0}, + {"BIOCGBLEN", Const, 0}, + {"BIOCGDIRECTION", Const, 0}, + {"BIOCGDIRFILT", Const, 1}, + {"BIOCGDLT", Const, 0}, + {"BIOCGDLTLIST", Const, 0}, + {"BIOCGETBUFMODE", Const, 0}, + {"BIOCGETIF", Const, 0}, + {"BIOCGETZMAX", Const, 0}, + {"BIOCGFEEDBACK", Const, 1}, + {"BIOCGFILDROP", Const, 1}, + {"BIOCGHDRCMPLT", Const, 0}, + {"BIOCGRSIG", Const, 0}, + {"BIOCGRTIMEOUT", Const, 0}, + {"BIOCGSEESENT", Const, 0}, + {"BIOCGSTATS", Const, 0}, + {"BIOCGSTATSOLD", Const, 1}, + {"BIOCGTSTAMP", Const, 1}, + {"BIOCIMMEDIATE", Const, 0}, + {"BIOCLOCK", Const, 0}, + {"BIOCPROMISC", Const, 0}, + {"BIOCROTZBUF", Const, 0}, + {"BIOCSBLEN", Const, 0}, + {"BIOCSDIRECTION", Const, 0}, + {"BIOCSDIRFILT", Const, 1}, + {"BIOCSDLT", Const, 0}, + {"BIOCSETBUFMODE", Const, 0}, + {"BIOCSETF", Const, 0}, + {"BIOCSETFNR", Const, 0}, + {"BIOCSETIF", Const, 0}, + {"BIOCSETWF", Const, 0}, + {"BIOCSETZBUF", Const, 0}, + {"BIOCSFEEDBACK", Const, 1}, + {"BIOCSFILDROP", Const, 1}, + {"BIOCSHDRCMPLT", Const, 0}, + {"BIOCSRSIG", Const, 0}, + {"BIOCSRTIMEOUT", Const, 0}, + {"BIOCSSEESENT", Const, 0}, + {"BIOCSTCPF", Const, 1}, + {"BIOCSTSTAMP", Const, 1}, + {"BIOCSUDPF", Const, 1}, + {"BIOCVERSION", Const, 0}, + {"BPF_A", Const, 0}, + {"BPF_ABS", Const, 0}, + {"BPF_ADD", Const, 0}, + {"BPF_ALIGNMENT", Const, 0}, + {"BPF_ALIGNMENT32", Const, 1}, + {"BPF_ALU", Const, 0}, + {"BPF_AND", Const, 0}, + {"BPF_B", Const, 0}, + {"BPF_BUFMODE_BUFFER", Const, 0}, + {"BPF_BUFMODE_ZBUF", Const, 0}, + {"BPF_DFLTBUFSIZE", Const, 1}, + {"BPF_DIRECTION_IN", Const, 1}, + {"BPF_DIRECTION_OUT", Const, 1}, + {"BPF_DIV", Const, 0}, + {"BPF_H", Const, 0}, + {"BPF_IMM", Const, 0}, + {"BPF_IND", Const, 0}, + {"BPF_JA", Const, 0}, + {"BPF_JEQ", Const, 0}, + {"BPF_JGE", Const, 0}, + {"BPF_JGT", Const, 0}, + {"BPF_JMP", Const, 0}, + {"BPF_JSET", Const, 0}, + {"BPF_K", Const, 0}, + {"BPF_LD", Const, 0}, + {"BPF_LDX", Const, 0}, + {"BPF_LEN", Const, 0}, + {"BPF_LSH", Const, 0}, + {"BPF_MAJOR_VERSION", Const, 0}, + {"BPF_MAXBUFSIZE", Const, 0}, + {"BPF_MAXINSNS", Const, 0}, + {"BPF_MEM", Const, 0}, + {"BPF_MEMWORDS", Const, 0}, + {"BPF_MINBUFSIZE", Const, 0}, + {"BPF_MINOR_VERSION", Const, 0}, + {"BPF_MISC", Const, 0}, + {"BPF_MSH", Const, 0}, + {"BPF_MUL", Const, 0}, + {"BPF_NEG", Const, 0}, + {"BPF_OR", Const, 0}, + {"BPF_RELEASE", Const, 0}, + {"BPF_RET", Const, 0}, + {"BPF_RSH", Const, 0}, + {"BPF_ST", Const, 0}, + {"BPF_STX", Const, 0}, + {"BPF_SUB", Const, 0}, + {"BPF_TAX", Const, 0}, + {"BPF_TXA", Const, 0}, + {"BPF_T_BINTIME", Const, 1}, + {"BPF_T_BINTIME_FAST", Const, 1}, + {"BPF_T_BINTIME_MONOTONIC", Const, 1}, + {"BPF_T_BINTIME_MONOTONIC_FAST", Const, 1}, + {"BPF_T_FAST", Const, 1}, + {"BPF_T_FLAG_MASK", Const, 1}, + {"BPF_T_FORMAT_MASK", Const, 1}, + {"BPF_T_MICROTIME", Const, 1}, + {"BPF_T_MICROTIME_FAST", Const, 1}, + {"BPF_T_MICROTIME_MONOTONIC", Const, 1}, + {"BPF_T_MICROTIME_MONOTONIC_FAST", Const, 1}, + {"BPF_T_MONOTONIC", Const, 1}, + {"BPF_T_MONOTONIC_FAST", Const, 1}, + {"BPF_T_NANOTIME", Const, 1}, + {"BPF_T_NANOTIME_FAST", Const, 1}, + {"BPF_T_NANOTIME_MONOTONIC", Const, 1}, + {"BPF_T_NANOTIME_MONOTONIC_FAST", Const, 1}, + {"BPF_T_NONE", Const, 1}, + {"BPF_T_NORMAL", Const, 1}, + {"BPF_W", Const, 0}, + {"BPF_X", Const, 0}, + {"BRKINT", Const, 0}, + {"Bind", Func, 0}, + {"BindToDevice", Func, 0}, + {"BpfBuflen", Func, 0}, + {"BpfDatalink", Func, 0}, + {"BpfHdr", Type, 0}, + {"BpfHdr.Caplen", Field, 0}, + {"BpfHdr.Datalen", Field, 0}, + {"BpfHdr.Hdrlen", Field, 0}, + {"BpfHdr.Pad_cgo_0", Field, 0}, + {"BpfHdr.Tstamp", Field, 0}, + {"BpfHeadercmpl", Func, 0}, + {"BpfInsn", Type, 0}, + {"BpfInsn.Code", Field, 0}, + {"BpfInsn.Jf", Field, 0}, + {"BpfInsn.Jt", Field, 0}, + {"BpfInsn.K", Field, 0}, + {"BpfInterface", Func, 0}, + {"BpfJump", Func, 0}, + {"BpfProgram", Type, 0}, + {"BpfProgram.Insns", Field, 0}, + {"BpfProgram.Len", Field, 0}, + {"BpfProgram.Pad_cgo_0", Field, 0}, + {"BpfStat", Type, 0}, + {"BpfStat.Capt", Field, 2}, + {"BpfStat.Drop", Field, 0}, + {"BpfStat.Padding", Field, 2}, + {"BpfStat.Recv", Field, 0}, + {"BpfStats", Func, 0}, + {"BpfStmt", Func, 0}, + {"BpfTimeout", Func, 0}, + {"BpfTimeval", Type, 2}, + {"BpfTimeval.Sec", Field, 2}, + {"BpfTimeval.Usec", Field, 2}, + {"BpfVersion", Type, 0}, + {"BpfVersion.Major", Field, 0}, + {"BpfVersion.Minor", Field, 0}, + {"BpfZbuf", Type, 0}, + {"BpfZbuf.Bufa", Field, 0}, + {"BpfZbuf.Bufb", Field, 0}, + {"BpfZbuf.Buflen", Field, 0}, + {"BpfZbufHeader", Type, 0}, + {"BpfZbufHeader.Kernel_gen", Field, 0}, + {"BpfZbufHeader.Kernel_len", Field, 0}, + {"BpfZbufHeader.User_gen", Field, 0}, + {"BpfZbufHeader.X_bzh_pad", Field, 0}, + {"ByHandleFileInformation", Type, 0}, + {"ByHandleFileInformation.CreationTime", Field, 0}, + {"ByHandleFileInformation.FileAttributes", Field, 0}, + {"ByHandleFileInformation.FileIndexHigh", Field, 0}, + {"ByHandleFileInformation.FileIndexLow", Field, 0}, + {"ByHandleFileInformation.FileSizeHigh", Field, 0}, + {"ByHandleFileInformation.FileSizeLow", Field, 0}, + {"ByHandleFileInformation.LastAccessTime", Field, 0}, + {"ByHandleFileInformation.LastWriteTime", Field, 0}, + {"ByHandleFileInformation.NumberOfLinks", Field, 0}, + {"ByHandleFileInformation.VolumeSerialNumber", Field, 0}, + {"BytePtrFromString", Func, 1}, + {"ByteSliceFromString", Func, 1}, + {"CCR0_FLUSH", Const, 1}, + {"CERT_CHAIN_POLICY_AUTHENTICODE", Const, 0}, + {"CERT_CHAIN_POLICY_AUTHENTICODE_TS", Const, 0}, + {"CERT_CHAIN_POLICY_BASE", Const, 0}, + {"CERT_CHAIN_POLICY_BASIC_CONSTRAINTS", Const, 0}, + {"CERT_CHAIN_POLICY_EV", Const, 0}, + {"CERT_CHAIN_POLICY_MICROSOFT_ROOT", Const, 0}, + {"CERT_CHAIN_POLICY_NT_AUTH", Const, 0}, + {"CERT_CHAIN_POLICY_SSL", Const, 0}, + {"CERT_E_CN_NO_MATCH", Const, 0}, + {"CERT_E_EXPIRED", Const, 0}, + {"CERT_E_PURPOSE", Const, 0}, + {"CERT_E_ROLE", Const, 0}, + {"CERT_E_UNTRUSTEDROOT", Const, 0}, + {"CERT_STORE_ADD_ALWAYS", Const, 0}, + {"CERT_STORE_DEFER_CLOSE_UNTIL_LAST_FREE_FLAG", Const, 0}, + {"CERT_STORE_PROV_MEMORY", Const, 0}, + {"CERT_TRUST_HAS_EXCLUDED_NAME_CONSTRAINT", Const, 0}, + {"CERT_TRUST_HAS_NOT_DEFINED_NAME_CONSTRAINT", Const, 0}, + {"CERT_TRUST_HAS_NOT_PERMITTED_NAME_CONSTRAINT", Const, 0}, + {"CERT_TRUST_HAS_NOT_SUPPORTED_CRITICAL_EXT", Const, 0}, + {"CERT_TRUST_HAS_NOT_SUPPORTED_NAME_CONSTRAINT", Const, 0}, + {"CERT_TRUST_INVALID_BASIC_CONSTRAINTS", Const, 0}, + {"CERT_TRUST_INVALID_EXTENSION", Const, 0}, + {"CERT_TRUST_INVALID_NAME_CONSTRAINTS", Const, 0}, + {"CERT_TRUST_INVALID_POLICY_CONSTRAINTS", Const, 0}, + {"CERT_TRUST_IS_CYCLIC", Const, 0}, + {"CERT_TRUST_IS_EXPLICIT_DISTRUST", Const, 0}, + {"CERT_TRUST_IS_NOT_SIGNATURE_VALID", Const, 0}, + {"CERT_TRUST_IS_NOT_TIME_VALID", Const, 0}, + {"CERT_TRUST_IS_NOT_VALID_FOR_USAGE", Const, 0}, + {"CERT_TRUST_IS_OFFLINE_REVOCATION", Const, 0}, + {"CERT_TRUST_IS_REVOKED", Const, 0}, + {"CERT_TRUST_IS_UNTRUSTED_ROOT", Const, 0}, + {"CERT_TRUST_NO_ERROR", Const, 0}, + {"CERT_TRUST_NO_ISSUANCE_CHAIN_POLICY", Const, 0}, + {"CERT_TRUST_REVOCATION_STATUS_UNKNOWN", Const, 0}, + {"CFLUSH", Const, 1}, + {"CLOCAL", Const, 0}, + {"CLONE_CHILD_CLEARTID", Const, 2}, + {"CLONE_CHILD_SETTID", Const, 2}, + {"CLONE_CLEAR_SIGHAND", Const, 20}, + {"CLONE_CSIGNAL", Const, 3}, + {"CLONE_DETACHED", Const, 2}, + {"CLONE_FILES", Const, 2}, + {"CLONE_FS", Const, 2}, + {"CLONE_INTO_CGROUP", Const, 20}, + {"CLONE_IO", Const, 2}, + {"CLONE_NEWCGROUP", Const, 20}, + {"CLONE_NEWIPC", Const, 2}, + {"CLONE_NEWNET", Const, 2}, + {"CLONE_NEWNS", Const, 2}, + {"CLONE_NEWPID", Const, 2}, + {"CLONE_NEWTIME", Const, 20}, + {"CLONE_NEWUSER", Const, 2}, + {"CLONE_NEWUTS", Const, 2}, + {"CLONE_PARENT", Const, 2}, + {"CLONE_PARENT_SETTID", Const, 2}, + {"CLONE_PID", Const, 3}, + {"CLONE_PIDFD", Const, 20}, + {"CLONE_PTRACE", Const, 2}, + {"CLONE_SETTLS", Const, 2}, + {"CLONE_SIGHAND", Const, 2}, + {"CLONE_SYSVSEM", Const, 2}, + {"CLONE_THREAD", Const, 2}, + {"CLONE_UNTRACED", Const, 2}, + {"CLONE_VFORK", Const, 2}, + {"CLONE_VM", Const, 2}, + {"CPUID_CFLUSH", Const, 1}, + {"CREAD", Const, 0}, + {"CREATE_ALWAYS", Const, 0}, + {"CREATE_NEW", Const, 0}, + {"CREATE_NEW_PROCESS_GROUP", Const, 1}, + {"CREATE_UNICODE_ENVIRONMENT", Const, 0}, + {"CRYPT_DEFAULT_CONTAINER_OPTIONAL", Const, 0}, + {"CRYPT_DELETEKEYSET", Const, 0}, + {"CRYPT_MACHINE_KEYSET", Const, 0}, + {"CRYPT_NEWKEYSET", Const, 0}, + {"CRYPT_SILENT", Const, 0}, + {"CRYPT_VERIFYCONTEXT", Const, 0}, + {"CS5", Const, 0}, + {"CS6", Const, 0}, + {"CS7", Const, 0}, + {"CS8", Const, 0}, + {"CSIZE", Const, 0}, + {"CSTART", Const, 1}, + {"CSTATUS", Const, 1}, + {"CSTOP", Const, 1}, + {"CSTOPB", Const, 0}, + {"CSUSP", Const, 1}, + {"CTL_MAXNAME", Const, 0}, + {"CTL_NET", Const, 0}, + {"CTL_QUERY", Const, 1}, + {"CTRL_BREAK_EVENT", Const, 1}, + {"CTRL_CLOSE_EVENT", Const, 14}, + {"CTRL_C_EVENT", Const, 1}, + {"CTRL_LOGOFF_EVENT", Const, 14}, + {"CTRL_SHUTDOWN_EVENT", Const, 14}, + {"CancelIo", Func, 0}, + {"CancelIoEx", Func, 1}, + {"CertAddCertificateContextToStore", Func, 0}, + {"CertChainContext", Type, 0}, + {"CertChainContext.ChainCount", Field, 0}, + {"CertChainContext.Chains", Field, 0}, + {"CertChainContext.HasRevocationFreshnessTime", Field, 0}, + {"CertChainContext.LowerQualityChainCount", Field, 0}, + {"CertChainContext.LowerQualityChains", Field, 0}, + {"CertChainContext.RevocationFreshnessTime", Field, 0}, + {"CertChainContext.Size", Field, 0}, + {"CertChainContext.TrustStatus", Field, 0}, + {"CertChainElement", Type, 0}, + {"CertChainElement.ApplicationUsage", Field, 0}, + {"CertChainElement.CertContext", Field, 0}, + {"CertChainElement.ExtendedErrorInfo", Field, 0}, + {"CertChainElement.IssuanceUsage", Field, 0}, + {"CertChainElement.RevocationInfo", Field, 0}, + {"CertChainElement.Size", Field, 0}, + {"CertChainElement.TrustStatus", Field, 0}, + {"CertChainPara", Type, 0}, + {"CertChainPara.CacheResync", Field, 0}, + {"CertChainPara.CheckRevocationFreshnessTime", Field, 0}, + {"CertChainPara.RequestedUsage", Field, 0}, + {"CertChainPara.RequstedIssuancePolicy", Field, 0}, + {"CertChainPara.RevocationFreshnessTime", Field, 0}, + {"CertChainPara.Size", Field, 0}, + {"CertChainPara.URLRetrievalTimeout", Field, 0}, + {"CertChainPolicyPara", Type, 0}, + {"CertChainPolicyPara.ExtraPolicyPara", Field, 0}, + {"CertChainPolicyPara.Flags", Field, 0}, + {"CertChainPolicyPara.Size", Field, 0}, + {"CertChainPolicyStatus", Type, 0}, + {"CertChainPolicyStatus.ChainIndex", Field, 0}, + {"CertChainPolicyStatus.ElementIndex", Field, 0}, + {"CertChainPolicyStatus.Error", Field, 0}, + {"CertChainPolicyStatus.ExtraPolicyStatus", Field, 0}, + {"CertChainPolicyStatus.Size", Field, 0}, + {"CertCloseStore", Func, 0}, + {"CertContext", Type, 0}, + {"CertContext.CertInfo", Field, 0}, + {"CertContext.EncodedCert", Field, 0}, + {"CertContext.EncodingType", Field, 0}, + {"CertContext.Length", Field, 0}, + {"CertContext.Store", Field, 0}, + {"CertCreateCertificateContext", Func, 0}, + {"CertEnhKeyUsage", Type, 0}, + {"CertEnhKeyUsage.Length", Field, 0}, + {"CertEnhKeyUsage.UsageIdentifiers", Field, 0}, + {"CertEnumCertificatesInStore", Func, 0}, + {"CertFreeCertificateChain", Func, 0}, + {"CertFreeCertificateContext", Func, 0}, + {"CertGetCertificateChain", Func, 0}, + {"CertInfo", Type, 11}, + {"CertOpenStore", Func, 0}, + {"CertOpenSystemStore", Func, 0}, + {"CertRevocationCrlInfo", Type, 11}, + {"CertRevocationInfo", Type, 0}, + {"CertRevocationInfo.CrlInfo", Field, 0}, + {"CertRevocationInfo.FreshnessTime", Field, 0}, + {"CertRevocationInfo.HasFreshnessTime", Field, 0}, + {"CertRevocationInfo.OidSpecificInfo", Field, 0}, + {"CertRevocationInfo.RevocationOid", Field, 0}, + {"CertRevocationInfo.RevocationResult", Field, 0}, + {"CertRevocationInfo.Size", Field, 0}, + {"CertSimpleChain", Type, 0}, + {"CertSimpleChain.Elements", Field, 0}, + {"CertSimpleChain.HasRevocationFreshnessTime", Field, 0}, + {"CertSimpleChain.NumElements", Field, 0}, + {"CertSimpleChain.RevocationFreshnessTime", Field, 0}, + {"CertSimpleChain.Size", Field, 0}, + {"CertSimpleChain.TrustListInfo", Field, 0}, + {"CertSimpleChain.TrustStatus", Field, 0}, + {"CertTrustListInfo", Type, 11}, + {"CertTrustStatus", Type, 0}, + {"CertTrustStatus.ErrorStatus", Field, 0}, + {"CertTrustStatus.InfoStatus", Field, 0}, + {"CertUsageMatch", Type, 0}, + {"CertUsageMatch.Type", Field, 0}, + {"CertUsageMatch.Usage", Field, 0}, + {"CertVerifyCertificateChainPolicy", Func, 0}, + {"Chdir", Func, 0}, + {"CheckBpfVersion", Func, 0}, + {"Chflags", Func, 0}, + {"Chmod", Func, 0}, + {"Chown", Func, 0}, + {"Chroot", Func, 0}, + {"Clearenv", Func, 0}, + {"Close", Func, 0}, + {"CloseHandle", Func, 0}, + {"CloseOnExec", Func, 0}, + {"Closesocket", Func, 0}, + {"CmsgLen", Func, 0}, + {"CmsgSpace", Func, 0}, + {"Cmsghdr", Type, 0}, + {"Cmsghdr.Len", Field, 0}, + {"Cmsghdr.Level", Field, 0}, + {"Cmsghdr.Type", Field, 0}, + {"Cmsghdr.X__cmsg_data", Field, 0}, + {"CommandLineToArgv", Func, 0}, + {"ComputerName", Func, 0}, + {"Conn", Type, 9}, + {"Connect", Func, 0}, + {"ConnectEx", Func, 1}, + {"ConvertSidToStringSid", Func, 0}, + {"ConvertStringSidToSid", Func, 0}, + {"CopySid", Func, 0}, + {"Creat", Func, 0}, + {"CreateDirectory", Func, 0}, + {"CreateFile", Func, 0}, + {"CreateFileMapping", Func, 0}, + {"CreateHardLink", Func, 4}, + {"CreateIoCompletionPort", Func, 0}, + {"CreatePipe", Func, 0}, + {"CreateProcess", Func, 0}, + {"CreateProcessAsUser", Func, 10}, + {"CreateSymbolicLink", Func, 4}, + {"CreateToolhelp32Snapshot", Func, 4}, + {"Credential", Type, 0}, + {"Credential.Gid", Field, 0}, + {"Credential.Groups", Field, 0}, + {"Credential.NoSetGroups", Field, 9}, + {"Credential.Uid", Field, 0}, + {"CryptAcquireContext", Func, 0}, + {"CryptGenRandom", Func, 0}, + {"CryptReleaseContext", Func, 0}, + {"DIOCBSFLUSH", Const, 1}, + {"DIOCOSFPFLUSH", Const, 1}, + {"DLL", Type, 0}, + {"DLL.Handle", Field, 0}, + {"DLL.Name", Field, 0}, + {"DLLError", Type, 0}, + {"DLLError.Err", Field, 0}, + {"DLLError.Msg", Field, 0}, + {"DLLError.ObjName", Field, 0}, + {"DLT_A429", Const, 0}, + {"DLT_A653_ICM", Const, 0}, + {"DLT_AIRONET_HEADER", Const, 0}, + {"DLT_AOS", Const, 1}, + {"DLT_APPLE_IP_OVER_IEEE1394", Const, 0}, + {"DLT_ARCNET", Const, 0}, + {"DLT_ARCNET_LINUX", Const, 0}, + {"DLT_ATM_CLIP", Const, 0}, + {"DLT_ATM_RFC1483", Const, 0}, + {"DLT_AURORA", Const, 0}, + {"DLT_AX25", Const, 0}, + {"DLT_AX25_KISS", Const, 0}, + {"DLT_BACNET_MS_TP", Const, 0}, + {"DLT_BLUETOOTH_HCI_H4", Const, 0}, + {"DLT_BLUETOOTH_HCI_H4_WITH_PHDR", Const, 0}, + {"DLT_CAN20B", Const, 0}, + {"DLT_CAN_SOCKETCAN", Const, 1}, + {"DLT_CHAOS", Const, 0}, + {"DLT_CHDLC", Const, 0}, + {"DLT_CISCO_IOS", Const, 0}, + {"DLT_C_HDLC", Const, 0}, + {"DLT_C_HDLC_WITH_DIR", Const, 0}, + {"DLT_DBUS", Const, 1}, + {"DLT_DECT", Const, 1}, + {"DLT_DOCSIS", Const, 0}, + {"DLT_DVB_CI", Const, 1}, + {"DLT_ECONET", Const, 0}, + {"DLT_EN10MB", Const, 0}, + {"DLT_EN3MB", Const, 0}, + {"DLT_ENC", Const, 0}, + {"DLT_ERF", Const, 0}, + {"DLT_ERF_ETH", Const, 0}, + {"DLT_ERF_POS", Const, 0}, + {"DLT_FC_2", Const, 1}, + {"DLT_FC_2_WITH_FRAME_DELIMS", Const, 1}, + {"DLT_FDDI", Const, 0}, + {"DLT_FLEXRAY", Const, 0}, + {"DLT_FRELAY", Const, 0}, + {"DLT_FRELAY_WITH_DIR", Const, 0}, + {"DLT_GCOM_SERIAL", Const, 0}, + {"DLT_GCOM_T1E1", Const, 0}, + {"DLT_GPF_F", Const, 0}, + {"DLT_GPF_T", Const, 0}, + {"DLT_GPRS_LLC", Const, 0}, + {"DLT_GSMTAP_ABIS", Const, 1}, + {"DLT_GSMTAP_UM", Const, 1}, + {"DLT_HDLC", Const, 1}, + {"DLT_HHDLC", Const, 0}, + {"DLT_HIPPI", Const, 1}, + {"DLT_IBM_SN", Const, 0}, + {"DLT_IBM_SP", Const, 0}, + {"DLT_IEEE802", Const, 0}, + {"DLT_IEEE802_11", Const, 0}, + {"DLT_IEEE802_11_RADIO", Const, 0}, + {"DLT_IEEE802_11_RADIO_AVS", Const, 0}, + {"DLT_IEEE802_15_4", Const, 0}, + {"DLT_IEEE802_15_4_LINUX", Const, 0}, + {"DLT_IEEE802_15_4_NOFCS", Const, 1}, + {"DLT_IEEE802_15_4_NONASK_PHY", Const, 0}, + {"DLT_IEEE802_16_MAC_CPS", Const, 0}, + {"DLT_IEEE802_16_MAC_CPS_RADIO", Const, 0}, + {"DLT_IPFILTER", Const, 0}, + {"DLT_IPMB", Const, 0}, + {"DLT_IPMB_LINUX", Const, 0}, + {"DLT_IPNET", Const, 1}, + {"DLT_IPOIB", Const, 1}, + {"DLT_IPV4", Const, 1}, + {"DLT_IPV6", Const, 1}, + {"DLT_IP_OVER_FC", Const, 0}, + {"DLT_JUNIPER_ATM1", Const, 0}, + {"DLT_JUNIPER_ATM2", Const, 0}, + {"DLT_JUNIPER_ATM_CEMIC", Const, 1}, + {"DLT_JUNIPER_CHDLC", Const, 0}, + {"DLT_JUNIPER_ES", Const, 0}, + {"DLT_JUNIPER_ETHER", Const, 0}, + {"DLT_JUNIPER_FIBRECHANNEL", Const, 1}, + {"DLT_JUNIPER_FRELAY", Const, 0}, + {"DLT_JUNIPER_GGSN", Const, 0}, + {"DLT_JUNIPER_ISM", Const, 0}, + {"DLT_JUNIPER_MFR", Const, 0}, + {"DLT_JUNIPER_MLFR", Const, 0}, + {"DLT_JUNIPER_MLPPP", Const, 0}, + {"DLT_JUNIPER_MONITOR", Const, 0}, + {"DLT_JUNIPER_PIC_PEER", Const, 0}, + {"DLT_JUNIPER_PPP", Const, 0}, + {"DLT_JUNIPER_PPPOE", Const, 0}, + {"DLT_JUNIPER_PPPOE_ATM", Const, 0}, + {"DLT_JUNIPER_SERVICES", Const, 0}, + {"DLT_JUNIPER_SRX_E2E", Const, 1}, + {"DLT_JUNIPER_ST", Const, 0}, + {"DLT_JUNIPER_VP", Const, 0}, + {"DLT_JUNIPER_VS", Const, 1}, + {"DLT_LAPB_WITH_DIR", Const, 0}, + {"DLT_LAPD", Const, 0}, + {"DLT_LIN", Const, 0}, + {"DLT_LINUX_EVDEV", Const, 1}, + {"DLT_LINUX_IRDA", Const, 0}, + {"DLT_LINUX_LAPD", Const, 0}, + {"DLT_LINUX_PPP_WITHDIRECTION", Const, 0}, + {"DLT_LINUX_SLL", Const, 0}, + {"DLT_LOOP", Const, 0}, + {"DLT_LTALK", Const, 0}, + {"DLT_MATCHING_MAX", Const, 1}, + {"DLT_MATCHING_MIN", Const, 1}, + {"DLT_MFR", Const, 0}, + {"DLT_MOST", Const, 0}, + {"DLT_MPEG_2_TS", Const, 1}, + {"DLT_MPLS", Const, 1}, + {"DLT_MTP2", Const, 0}, + {"DLT_MTP2_WITH_PHDR", Const, 0}, + {"DLT_MTP3", Const, 0}, + {"DLT_MUX27010", Const, 1}, + {"DLT_NETANALYZER", Const, 1}, + {"DLT_NETANALYZER_TRANSPARENT", Const, 1}, + {"DLT_NFC_LLCP", Const, 1}, + {"DLT_NFLOG", Const, 1}, + {"DLT_NG40", Const, 1}, + {"DLT_NULL", Const, 0}, + {"DLT_PCI_EXP", Const, 0}, + {"DLT_PFLOG", Const, 0}, + {"DLT_PFSYNC", Const, 0}, + {"DLT_PPI", Const, 0}, + {"DLT_PPP", Const, 0}, + {"DLT_PPP_BSDOS", Const, 0}, + {"DLT_PPP_ETHER", Const, 0}, + {"DLT_PPP_PPPD", Const, 0}, + {"DLT_PPP_SERIAL", Const, 0}, + {"DLT_PPP_WITH_DIR", Const, 0}, + {"DLT_PPP_WITH_DIRECTION", Const, 0}, + {"DLT_PRISM_HEADER", Const, 0}, + {"DLT_PRONET", Const, 0}, + {"DLT_RAIF1", Const, 0}, + {"DLT_RAW", Const, 0}, + {"DLT_RAWAF_MASK", Const, 1}, + {"DLT_RIO", Const, 0}, + {"DLT_SCCP", Const, 0}, + {"DLT_SITA", Const, 0}, + {"DLT_SLIP", Const, 0}, + {"DLT_SLIP_BSDOS", Const, 0}, + {"DLT_STANAG_5066_D_PDU", Const, 1}, + {"DLT_SUNATM", Const, 0}, + {"DLT_SYMANTEC_FIREWALL", Const, 0}, + {"DLT_TZSP", Const, 0}, + {"DLT_USB", Const, 0}, + {"DLT_USB_LINUX", Const, 0}, + {"DLT_USB_LINUX_MMAPPED", Const, 1}, + {"DLT_USER0", Const, 0}, + {"DLT_USER1", Const, 0}, + {"DLT_USER10", Const, 0}, + {"DLT_USER11", Const, 0}, + {"DLT_USER12", Const, 0}, + {"DLT_USER13", Const, 0}, + {"DLT_USER14", Const, 0}, + {"DLT_USER15", Const, 0}, + {"DLT_USER2", Const, 0}, + {"DLT_USER3", Const, 0}, + {"DLT_USER4", Const, 0}, + {"DLT_USER5", Const, 0}, + {"DLT_USER6", Const, 0}, + {"DLT_USER7", Const, 0}, + {"DLT_USER8", Const, 0}, + {"DLT_USER9", Const, 0}, + {"DLT_WIHART", Const, 1}, + {"DLT_X2E_SERIAL", Const, 0}, + {"DLT_X2E_XORAYA", Const, 0}, + {"DNSMXData", Type, 0}, + {"DNSMXData.NameExchange", Field, 0}, + {"DNSMXData.Pad", Field, 0}, + {"DNSMXData.Preference", Field, 0}, + {"DNSPTRData", Type, 0}, + {"DNSPTRData.Host", Field, 0}, + {"DNSRecord", Type, 0}, + {"DNSRecord.Data", Field, 0}, + {"DNSRecord.Dw", Field, 0}, + {"DNSRecord.Length", Field, 0}, + {"DNSRecord.Name", Field, 0}, + {"DNSRecord.Next", Field, 0}, + {"DNSRecord.Reserved", Field, 0}, + {"DNSRecord.Ttl", Field, 0}, + {"DNSRecord.Type", Field, 0}, + {"DNSSRVData", Type, 0}, + {"DNSSRVData.Pad", Field, 0}, + {"DNSSRVData.Port", Field, 0}, + {"DNSSRVData.Priority", Field, 0}, + {"DNSSRVData.Target", Field, 0}, + {"DNSSRVData.Weight", Field, 0}, + {"DNSTXTData", Type, 0}, + {"DNSTXTData.StringArray", Field, 0}, + {"DNSTXTData.StringCount", Field, 0}, + {"DNS_INFO_NO_RECORDS", Const, 4}, + {"DNS_TYPE_A", Const, 0}, + {"DNS_TYPE_A6", Const, 0}, + {"DNS_TYPE_AAAA", Const, 0}, + {"DNS_TYPE_ADDRS", Const, 0}, + {"DNS_TYPE_AFSDB", Const, 0}, + {"DNS_TYPE_ALL", Const, 0}, + {"DNS_TYPE_ANY", Const, 0}, + {"DNS_TYPE_ATMA", Const, 0}, + {"DNS_TYPE_AXFR", Const, 0}, + {"DNS_TYPE_CERT", Const, 0}, + {"DNS_TYPE_CNAME", Const, 0}, + {"DNS_TYPE_DHCID", Const, 0}, + {"DNS_TYPE_DNAME", Const, 0}, + {"DNS_TYPE_DNSKEY", Const, 0}, + {"DNS_TYPE_DS", Const, 0}, + {"DNS_TYPE_EID", Const, 0}, + {"DNS_TYPE_GID", Const, 0}, + {"DNS_TYPE_GPOS", Const, 0}, + {"DNS_TYPE_HINFO", Const, 0}, + {"DNS_TYPE_ISDN", Const, 0}, + {"DNS_TYPE_IXFR", Const, 0}, + {"DNS_TYPE_KEY", Const, 0}, + {"DNS_TYPE_KX", Const, 0}, + {"DNS_TYPE_LOC", Const, 0}, + {"DNS_TYPE_MAILA", Const, 0}, + {"DNS_TYPE_MAILB", Const, 0}, + {"DNS_TYPE_MB", Const, 0}, + {"DNS_TYPE_MD", Const, 0}, + {"DNS_TYPE_MF", Const, 0}, + {"DNS_TYPE_MG", Const, 0}, + {"DNS_TYPE_MINFO", Const, 0}, + {"DNS_TYPE_MR", Const, 0}, + {"DNS_TYPE_MX", Const, 0}, + {"DNS_TYPE_NAPTR", Const, 0}, + {"DNS_TYPE_NBSTAT", Const, 0}, + {"DNS_TYPE_NIMLOC", Const, 0}, + {"DNS_TYPE_NS", Const, 0}, + {"DNS_TYPE_NSAP", Const, 0}, + {"DNS_TYPE_NSAPPTR", Const, 0}, + {"DNS_TYPE_NSEC", Const, 0}, + {"DNS_TYPE_NULL", Const, 0}, + {"DNS_TYPE_NXT", Const, 0}, + {"DNS_TYPE_OPT", Const, 0}, + {"DNS_TYPE_PTR", Const, 0}, + {"DNS_TYPE_PX", Const, 0}, + {"DNS_TYPE_RP", Const, 0}, + {"DNS_TYPE_RRSIG", Const, 0}, + {"DNS_TYPE_RT", Const, 0}, + {"DNS_TYPE_SIG", Const, 0}, + {"DNS_TYPE_SINK", Const, 0}, + {"DNS_TYPE_SOA", Const, 0}, + {"DNS_TYPE_SRV", Const, 0}, + {"DNS_TYPE_TEXT", Const, 0}, + {"DNS_TYPE_TKEY", Const, 0}, + {"DNS_TYPE_TSIG", Const, 0}, + {"DNS_TYPE_UID", Const, 0}, + {"DNS_TYPE_UINFO", Const, 0}, + {"DNS_TYPE_UNSPEC", Const, 0}, + {"DNS_TYPE_WINS", Const, 0}, + {"DNS_TYPE_WINSR", Const, 0}, + {"DNS_TYPE_WKS", Const, 0}, + {"DNS_TYPE_X25", Const, 0}, + {"DT_BLK", Const, 0}, + {"DT_CHR", Const, 0}, + {"DT_DIR", Const, 0}, + {"DT_FIFO", Const, 0}, + {"DT_LNK", Const, 0}, + {"DT_REG", Const, 0}, + {"DT_SOCK", Const, 0}, + {"DT_UNKNOWN", Const, 0}, + {"DT_WHT", Const, 0}, + {"DUPLICATE_CLOSE_SOURCE", Const, 0}, + {"DUPLICATE_SAME_ACCESS", Const, 0}, + {"DeleteFile", Func, 0}, + {"DetachLsf", Func, 0}, + {"DeviceIoControl", Func, 4}, + {"Dirent", Type, 0}, + {"Dirent.Fileno", Field, 0}, + {"Dirent.Ino", Field, 0}, + {"Dirent.Name", Field, 0}, + {"Dirent.Namlen", Field, 0}, + {"Dirent.Off", Field, 0}, + {"Dirent.Pad0", Field, 12}, + {"Dirent.Pad1", Field, 12}, + {"Dirent.Pad_cgo_0", Field, 0}, + {"Dirent.Reclen", Field, 0}, + {"Dirent.Seekoff", Field, 0}, + {"Dirent.Type", Field, 0}, + {"Dirent.X__d_padding", Field, 3}, + {"DnsNameCompare", Func, 4}, + {"DnsQuery", Func, 0}, + {"DnsRecordListFree", Func, 0}, + {"DnsSectionAdditional", Const, 4}, + {"DnsSectionAnswer", Const, 4}, + {"DnsSectionAuthority", Const, 4}, + {"DnsSectionQuestion", Const, 4}, + {"Dup", Func, 0}, + {"Dup2", Func, 0}, + {"Dup3", Func, 2}, + {"DuplicateHandle", Func, 0}, + {"E2BIG", Const, 0}, + {"EACCES", Const, 0}, + {"EADDRINUSE", Const, 0}, + {"EADDRNOTAVAIL", Const, 0}, + {"EADV", Const, 0}, + {"EAFNOSUPPORT", Const, 0}, + {"EAGAIN", Const, 0}, + {"EALREADY", Const, 0}, + {"EAUTH", Const, 0}, + {"EBADARCH", Const, 0}, + {"EBADE", Const, 0}, + {"EBADEXEC", Const, 0}, + {"EBADF", Const, 0}, + {"EBADFD", Const, 0}, + {"EBADMACHO", Const, 0}, + {"EBADMSG", Const, 0}, + {"EBADR", Const, 0}, + {"EBADRPC", Const, 0}, + {"EBADRQC", Const, 0}, + {"EBADSLT", Const, 0}, + {"EBFONT", Const, 0}, + {"EBUSY", Const, 0}, + {"ECANCELED", Const, 0}, + {"ECAPMODE", Const, 1}, + {"ECHILD", Const, 0}, + {"ECHO", Const, 0}, + {"ECHOCTL", Const, 0}, + {"ECHOE", Const, 0}, + {"ECHOK", Const, 0}, + {"ECHOKE", Const, 0}, + {"ECHONL", Const, 0}, + {"ECHOPRT", Const, 0}, + {"ECHRNG", Const, 0}, + {"ECOMM", Const, 0}, + {"ECONNABORTED", Const, 0}, + {"ECONNREFUSED", Const, 0}, + {"ECONNRESET", Const, 0}, + {"EDEADLK", Const, 0}, + {"EDEADLOCK", Const, 0}, + {"EDESTADDRREQ", Const, 0}, + {"EDEVERR", Const, 0}, + {"EDOM", Const, 0}, + {"EDOOFUS", Const, 0}, + {"EDOTDOT", Const, 0}, + {"EDQUOT", Const, 0}, + {"EEXIST", Const, 0}, + {"EFAULT", Const, 0}, + {"EFBIG", Const, 0}, + {"EFER_LMA", Const, 1}, + {"EFER_LME", Const, 1}, + {"EFER_NXE", Const, 1}, + {"EFER_SCE", Const, 1}, + {"EFTYPE", Const, 0}, + {"EHOSTDOWN", Const, 0}, + {"EHOSTUNREACH", Const, 0}, + {"EHWPOISON", Const, 0}, + {"EIDRM", Const, 0}, + {"EILSEQ", Const, 0}, + {"EINPROGRESS", Const, 0}, + {"EINTR", Const, 0}, + {"EINVAL", Const, 0}, + {"EIO", Const, 0}, + {"EIPSEC", Const, 1}, + {"EISCONN", Const, 0}, + {"EISDIR", Const, 0}, + {"EISNAM", Const, 0}, + {"EKEYEXPIRED", Const, 0}, + {"EKEYREJECTED", Const, 0}, + {"EKEYREVOKED", Const, 0}, + {"EL2HLT", Const, 0}, + {"EL2NSYNC", Const, 0}, + {"EL3HLT", Const, 0}, + {"EL3RST", Const, 0}, + {"ELAST", Const, 0}, + {"ELF_NGREG", Const, 0}, + {"ELF_PRARGSZ", Const, 0}, + {"ELIBACC", Const, 0}, + {"ELIBBAD", Const, 0}, + {"ELIBEXEC", Const, 0}, + {"ELIBMAX", Const, 0}, + {"ELIBSCN", Const, 0}, + {"ELNRNG", Const, 0}, + {"ELOOP", Const, 0}, + {"EMEDIUMTYPE", Const, 0}, + {"EMFILE", Const, 0}, + {"EMLINK", Const, 0}, + {"EMSGSIZE", Const, 0}, + {"EMT_TAGOVF", Const, 1}, + {"EMULTIHOP", Const, 0}, + {"EMUL_ENABLED", Const, 1}, + {"EMUL_LINUX", Const, 1}, + {"EMUL_LINUX32", Const, 1}, + {"EMUL_MAXID", Const, 1}, + {"EMUL_NATIVE", Const, 1}, + {"ENAMETOOLONG", Const, 0}, + {"ENAVAIL", Const, 0}, + {"ENDRUNDISC", Const, 1}, + {"ENEEDAUTH", Const, 0}, + {"ENETDOWN", Const, 0}, + {"ENETRESET", Const, 0}, + {"ENETUNREACH", Const, 0}, + {"ENFILE", Const, 0}, + {"ENOANO", Const, 0}, + {"ENOATTR", Const, 0}, + {"ENOBUFS", Const, 0}, + {"ENOCSI", Const, 0}, + {"ENODATA", Const, 0}, + {"ENODEV", Const, 0}, + {"ENOENT", Const, 0}, + {"ENOEXEC", Const, 0}, + {"ENOKEY", Const, 0}, + {"ENOLCK", Const, 0}, + {"ENOLINK", Const, 0}, + {"ENOMEDIUM", Const, 0}, + {"ENOMEM", Const, 0}, + {"ENOMSG", Const, 0}, + {"ENONET", Const, 0}, + {"ENOPKG", Const, 0}, + {"ENOPOLICY", Const, 0}, + {"ENOPROTOOPT", Const, 0}, + {"ENOSPC", Const, 0}, + {"ENOSR", Const, 0}, + {"ENOSTR", Const, 0}, + {"ENOSYS", Const, 0}, + {"ENOTBLK", Const, 0}, + {"ENOTCAPABLE", Const, 0}, + {"ENOTCONN", Const, 0}, + {"ENOTDIR", Const, 0}, + {"ENOTEMPTY", Const, 0}, + {"ENOTNAM", Const, 0}, + {"ENOTRECOVERABLE", Const, 0}, + {"ENOTSOCK", Const, 0}, + {"ENOTSUP", Const, 0}, + {"ENOTTY", Const, 0}, + {"ENOTUNIQ", Const, 0}, + {"ENXIO", Const, 0}, + {"EN_SW_CTL_INF", Const, 1}, + {"EN_SW_CTL_PREC", Const, 1}, + {"EN_SW_CTL_ROUND", Const, 1}, + {"EN_SW_DATACHAIN", Const, 1}, + {"EN_SW_DENORM", Const, 1}, + {"EN_SW_INVOP", Const, 1}, + {"EN_SW_OVERFLOW", Const, 1}, + {"EN_SW_PRECLOSS", Const, 1}, + {"EN_SW_UNDERFLOW", Const, 1}, + {"EN_SW_ZERODIV", Const, 1}, + {"EOPNOTSUPP", Const, 0}, + {"EOVERFLOW", Const, 0}, + {"EOWNERDEAD", Const, 0}, + {"EPERM", Const, 0}, + {"EPFNOSUPPORT", Const, 0}, + {"EPIPE", Const, 0}, + {"EPOLLERR", Const, 0}, + {"EPOLLET", Const, 0}, + {"EPOLLHUP", Const, 0}, + {"EPOLLIN", Const, 0}, + {"EPOLLMSG", Const, 0}, + {"EPOLLONESHOT", Const, 0}, + {"EPOLLOUT", Const, 0}, + {"EPOLLPRI", Const, 0}, + {"EPOLLRDBAND", Const, 0}, + {"EPOLLRDHUP", Const, 0}, + {"EPOLLRDNORM", Const, 0}, + {"EPOLLWRBAND", Const, 0}, + {"EPOLLWRNORM", Const, 0}, + {"EPOLL_CLOEXEC", Const, 0}, + {"EPOLL_CTL_ADD", Const, 0}, + {"EPOLL_CTL_DEL", Const, 0}, + {"EPOLL_CTL_MOD", Const, 0}, + {"EPOLL_NONBLOCK", Const, 0}, + {"EPROCLIM", Const, 0}, + {"EPROCUNAVAIL", Const, 0}, + {"EPROGMISMATCH", Const, 0}, + {"EPROGUNAVAIL", Const, 0}, + {"EPROTO", Const, 0}, + {"EPROTONOSUPPORT", Const, 0}, + {"EPROTOTYPE", Const, 0}, + {"EPWROFF", Const, 0}, + {"EQFULL", Const, 16}, + {"ERANGE", Const, 0}, + {"EREMCHG", Const, 0}, + {"EREMOTE", Const, 0}, + {"EREMOTEIO", Const, 0}, + {"ERESTART", Const, 0}, + {"ERFKILL", Const, 0}, + {"EROFS", Const, 0}, + {"ERPCMISMATCH", Const, 0}, + {"ERROR_ACCESS_DENIED", Const, 0}, + {"ERROR_ALREADY_EXISTS", Const, 0}, + {"ERROR_BROKEN_PIPE", Const, 0}, + {"ERROR_BUFFER_OVERFLOW", Const, 0}, + {"ERROR_DIR_NOT_EMPTY", Const, 8}, + {"ERROR_ENVVAR_NOT_FOUND", Const, 0}, + {"ERROR_FILE_EXISTS", Const, 0}, + {"ERROR_FILE_NOT_FOUND", Const, 0}, + {"ERROR_HANDLE_EOF", Const, 2}, + {"ERROR_INSUFFICIENT_BUFFER", Const, 0}, + {"ERROR_IO_PENDING", Const, 0}, + {"ERROR_MOD_NOT_FOUND", Const, 0}, + {"ERROR_MORE_DATA", Const, 3}, + {"ERROR_NETNAME_DELETED", Const, 3}, + {"ERROR_NOT_FOUND", Const, 1}, + {"ERROR_NO_MORE_FILES", Const, 0}, + {"ERROR_OPERATION_ABORTED", Const, 0}, + {"ERROR_PATH_NOT_FOUND", Const, 0}, + {"ERROR_PRIVILEGE_NOT_HELD", Const, 4}, + {"ERROR_PROC_NOT_FOUND", Const, 0}, + {"ESHLIBVERS", Const, 0}, + {"ESHUTDOWN", Const, 0}, + {"ESOCKTNOSUPPORT", Const, 0}, + {"ESPIPE", Const, 0}, + {"ESRCH", Const, 0}, + {"ESRMNT", Const, 0}, + {"ESTALE", Const, 0}, + {"ESTRPIPE", Const, 0}, + {"ETHERCAP_JUMBO_MTU", Const, 1}, + {"ETHERCAP_VLAN_HWTAGGING", Const, 1}, + {"ETHERCAP_VLAN_MTU", Const, 1}, + {"ETHERMIN", Const, 1}, + {"ETHERMTU", Const, 1}, + {"ETHERMTU_JUMBO", Const, 1}, + {"ETHERTYPE_8023", Const, 1}, + {"ETHERTYPE_AARP", Const, 1}, + {"ETHERTYPE_ACCTON", Const, 1}, + {"ETHERTYPE_AEONIC", Const, 1}, + {"ETHERTYPE_ALPHA", Const, 1}, + {"ETHERTYPE_AMBER", Const, 1}, + {"ETHERTYPE_AMOEBA", Const, 1}, + {"ETHERTYPE_AOE", Const, 1}, + {"ETHERTYPE_APOLLO", Const, 1}, + {"ETHERTYPE_APOLLODOMAIN", Const, 1}, + {"ETHERTYPE_APPLETALK", Const, 1}, + {"ETHERTYPE_APPLITEK", Const, 1}, + {"ETHERTYPE_ARGONAUT", Const, 1}, + {"ETHERTYPE_ARP", Const, 1}, + {"ETHERTYPE_AT", Const, 1}, + {"ETHERTYPE_ATALK", Const, 1}, + {"ETHERTYPE_ATOMIC", Const, 1}, + {"ETHERTYPE_ATT", Const, 1}, + {"ETHERTYPE_ATTSTANFORD", Const, 1}, + {"ETHERTYPE_AUTOPHON", Const, 1}, + {"ETHERTYPE_AXIS", Const, 1}, + {"ETHERTYPE_BCLOOP", Const, 1}, + {"ETHERTYPE_BOFL", Const, 1}, + {"ETHERTYPE_CABLETRON", Const, 1}, + {"ETHERTYPE_CHAOS", Const, 1}, + {"ETHERTYPE_COMDESIGN", Const, 1}, + {"ETHERTYPE_COMPUGRAPHIC", Const, 1}, + {"ETHERTYPE_COUNTERPOINT", Const, 1}, + {"ETHERTYPE_CRONUS", Const, 1}, + {"ETHERTYPE_CRONUSVLN", Const, 1}, + {"ETHERTYPE_DCA", Const, 1}, + {"ETHERTYPE_DDE", Const, 1}, + {"ETHERTYPE_DEBNI", Const, 1}, + {"ETHERTYPE_DECAM", Const, 1}, + {"ETHERTYPE_DECCUST", Const, 1}, + {"ETHERTYPE_DECDIAG", Const, 1}, + {"ETHERTYPE_DECDNS", Const, 1}, + {"ETHERTYPE_DECDTS", Const, 1}, + {"ETHERTYPE_DECEXPER", Const, 1}, + {"ETHERTYPE_DECLAST", Const, 1}, + {"ETHERTYPE_DECLTM", Const, 1}, + {"ETHERTYPE_DECMUMPS", Const, 1}, + {"ETHERTYPE_DECNETBIOS", Const, 1}, + {"ETHERTYPE_DELTACON", Const, 1}, + {"ETHERTYPE_DIDDLE", Const, 1}, + {"ETHERTYPE_DLOG1", Const, 1}, + {"ETHERTYPE_DLOG2", Const, 1}, + {"ETHERTYPE_DN", Const, 1}, + {"ETHERTYPE_DOGFIGHT", Const, 1}, + {"ETHERTYPE_DSMD", Const, 1}, + {"ETHERTYPE_ECMA", Const, 1}, + {"ETHERTYPE_ENCRYPT", Const, 1}, + {"ETHERTYPE_ES", Const, 1}, + {"ETHERTYPE_EXCELAN", Const, 1}, + {"ETHERTYPE_EXPERDATA", Const, 1}, + {"ETHERTYPE_FLIP", Const, 1}, + {"ETHERTYPE_FLOWCONTROL", Const, 1}, + {"ETHERTYPE_FRARP", Const, 1}, + {"ETHERTYPE_GENDYN", Const, 1}, + {"ETHERTYPE_HAYES", Const, 1}, + {"ETHERTYPE_HIPPI_FP", Const, 1}, + {"ETHERTYPE_HITACHI", Const, 1}, + {"ETHERTYPE_HP", Const, 1}, + {"ETHERTYPE_IEEEPUP", Const, 1}, + {"ETHERTYPE_IEEEPUPAT", Const, 1}, + {"ETHERTYPE_IMLBL", Const, 1}, + {"ETHERTYPE_IMLBLDIAG", Const, 1}, + {"ETHERTYPE_IP", Const, 1}, + {"ETHERTYPE_IPAS", Const, 1}, + {"ETHERTYPE_IPV6", Const, 1}, + {"ETHERTYPE_IPX", Const, 1}, + {"ETHERTYPE_IPXNEW", Const, 1}, + {"ETHERTYPE_KALPANA", Const, 1}, + {"ETHERTYPE_LANBRIDGE", Const, 1}, + {"ETHERTYPE_LANPROBE", Const, 1}, + {"ETHERTYPE_LAT", Const, 1}, + {"ETHERTYPE_LBACK", Const, 1}, + {"ETHERTYPE_LITTLE", Const, 1}, + {"ETHERTYPE_LLDP", Const, 1}, + {"ETHERTYPE_LOGICRAFT", Const, 1}, + {"ETHERTYPE_LOOPBACK", Const, 1}, + {"ETHERTYPE_MATRA", Const, 1}, + {"ETHERTYPE_MAX", Const, 1}, + {"ETHERTYPE_MERIT", Const, 1}, + {"ETHERTYPE_MICP", Const, 1}, + {"ETHERTYPE_MOPDL", Const, 1}, + {"ETHERTYPE_MOPRC", Const, 1}, + {"ETHERTYPE_MOTOROLA", Const, 1}, + {"ETHERTYPE_MPLS", Const, 1}, + {"ETHERTYPE_MPLS_MCAST", Const, 1}, + {"ETHERTYPE_MUMPS", Const, 1}, + {"ETHERTYPE_NBPCC", Const, 1}, + {"ETHERTYPE_NBPCLAIM", Const, 1}, + {"ETHERTYPE_NBPCLREQ", Const, 1}, + {"ETHERTYPE_NBPCLRSP", Const, 1}, + {"ETHERTYPE_NBPCREQ", Const, 1}, + {"ETHERTYPE_NBPCRSP", Const, 1}, + {"ETHERTYPE_NBPDG", Const, 1}, + {"ETHERTYPE_NBPDGB", Const, 1}, + {"ETHERTYPE_NBPDLTE", Const, 1}, + {"ETHERTYPE_NBPRAR", Const, 1}, + {"ETHERTYPE_NBPRAS", Const, 1}, + {"ETHERTYPE_NBPRST", Const, 1}, + {"ETHERTYPE_NBPSCD", Const, 1}, + {"ETHERTYPE_NBPVCD", Const, 1}, + {"ETHERTYPE_NBS", Const, 1}, + {"ETHERTYPE_NCD", Const, 1}, + {"ETHERTYPE_NESTAR", Const, 1}, + {"ETHERTYPE_NETBEUI", Const, 1}, + {"ETHERTYPE_NOVELL", Const, 1}, + {"ETHERTYPE_NS", Const, 1}, + {"ETHERTYPE_NSAT", Const, 1}, + {"ETHERTYPE_NSCOMPAT", Const, 1}, + {"ETHERTYPE_NTRAILER", Const, 1}, + {"ETHERTYPE_OS9", Const, 1}, + {"ETHERTYPE_OS9NET", Const, 1}, + {"ETHERTYPE_PACER", Const, 1}, + {"ETHERTYPE_PAE", Const, 1}, + {"ETHERTYPE_PCS", Const, 1}, + {"ETHERTYPE_PLANNING", Const, 1}, + {"ETHERTYPE_PPP", Const, 1}, + {"ETHERTYPE_PPPOE", Const, 1}, + {"ETHERTYPE_PPPOEDISC", Const, 1}, + {"ETHERTYPE_PRIMENTS", Const, 1}, + {"ETHERTYPE_PUP", Const, 1}, + {"ETHERTYPE_PUPAT", Const, 1}, + {"ETHERTYPE_QINQ", Const, 1}, + {"ETHERTYPE_RACAL", Const, 1}, + {"ETHERTYPE_RATIONAL", Const, 1}, + {"ETHERTYPE_RAWFR", Const, 1}, + {"ETHERTYPE_RCL", Const, 1}, + {"ETHERTYPE_RDP", Const, 1}, + {"ETHERTYPE_RETIX", Const, 1}, + {"ETHERTYPE_REVARP", Const, 1}, + {"ETHERTYPE_SCA", Const, 1}, + {"ETHERTYPE_SECTRA", Const, 1}, + {"ETHERTYPE_SECUREDATA", Const, 1}, + {"ETHERTYPE_SGITW", Const, 1}, + {"ETHERTYPE_SG_BOUNCE", Const, 1}, + {"ETHERTYPE_SG_DIAG", Const, 1}, + {"ETHERTYPE_SG_NETGAMES", Const, 1}, + {"ETHERTYPE_SG_RESV", Const, 1}, + {"ETHERTYPE_SIMNET", Const, 1}, + {"ETHERTYPE_SLOW", Const, 1}, + {"ETHERTYPE_SLOWPROTOCOLS", Const, 1}, + {"ETHERTYPE_SNA", Const, 1}, + {"ETHERTYPE_SNMP", Const, 1}, + {"ETHERTYPE_SONIX", Const, 1}, + {"ETHERTYPE_SPIDER", Const, 1}, + {"ETHERTYPE_SPRITE", Const, 1}, + {"ETHERTYPE_STP", Const, 1}, + {"ETHERTYPE_TALARIS", Const, 1}, + {"ETHERTYPE_TALARISMC", Const, 1}, + {"ETHERTYPE_TCPCOMP", Const, 1}, + {"ETHERTYPE_TCPSM", Const, 1}, + {"ETHERTYPE_TEC", Const, 1}, + {"ETHERTYPE_TIGAN", Const, 1}, + {"ETHERTYPE_TRAIL", Const, 1}, + {"ETHERTYPE_TRANSETHER", Const, 1}, + {"ETHERTYPE_TYMSHARE", Const, 1}, + {"ETHERTYPE_UBBST", Const, 1}, + {"ETHERTYPE_UBDEBUG", Const, 1}, + {"ETHERTYPE_UBDIAGLOOP", Const, 1}, + {"ETHERTYPE_UBDL", Const, 1}, + {"ETHERTYPE_UBNIU", Const, 1}, + {"ETHERTYPE_UBNMC", Const, 1}, + {"ETHERTYPE_VALID", Const, 1}, + {"ETHERTYPE_VARIAN", Const, 1}, + {"ETHERTYPE_VAXELN", Const, 1}, + {"ETHERTYPE_VEECO", Const, 1}, + {"ETHERTYPE_VEXP", Const, 1}, + {"ETHERTYPE_VGLAB", Const, 1}, + {"ETHERTYPE_VINES", Const, 1}, + {"ETHERTYPE_VINESECHO", Const, 1}, + {"ETHERTYPE_VINESLOOP", Const, 1}, + {"ETHERTYPE_VITAL", Const, 1}, + {"ETHERTYPE_VLAN", Const, 1}, + {"ETHERTYPE_VLTLMAN", Const, 1}, + {"ETHERTYPE_VPROD", Const, 1}, + {"ETHERTYPE_VURESERVED", Const, 1}, + {"ETHERTYPE_WATERLOO", Const, 1}, + {"ETHERTYPE_WELLFLEET", Const, 1}, + {"ETHERTYPE_X25", Const, 1}, + {"ETHERTYPE_X75", Const, 1}, + {"ETHERTYPE_XNSSM", Const, 1}, + {"ETHERTYPE_XTP", Const, 1}, + {"ETHER_ADDR_LEN", Const, 1}, + {"ETHER_ALIGN", Const, 1}, + {"ETHER_CRC_LEN", Const, 1}, + {"ETHER_CRC_POLY_BE", Const, 1}, + {"ETHER_CRC_POLY_LE", Const, 1}, + {"ETHER_HDR_LEN", Const, 1}, + {"ETHER_MAX_DIX_LEN", Const, 1}, + {"ETHER_MAX_LEN", Const, 1}, + {"ETHER_MAX_LEN_JUMBO", Const, 1}, + {"ETHER_MIN_LEN", Const, 1}, + {"ETHER_PPPOE_ENCAP_LEN", Const, 1}, + {"ETHER_TYPE_LEN", Const, 1}, + {"ETHER_VLAN_ENCAP_LEN", Const, 1}, + {"ETH_P_1588", Const, 0}, + {"ETH_P_8021Q", Const, 0}, + {"ETH_P_802_2", Const, 0}, + {"ETH_P_802_3", Const, 0}, + {"ETH_P_AARP", Const, 0}, + {"ETH_P_ALL", Const, 0}, + {"ETH_P_AOE", Const, 0}, + {"ETH_P_ARCNET", Const, 0}, + {"ETH_P_ARP", Const, 0}, + {"ETH_P_ATALK", Const, 0}, + {"ETH_P_ATMFATE", Const, 0}, + {"ETH_P_ATMMPOA", Const, 0}, + {"ETH_P_AX25", Const, 0}, + {"ETH_P_BPQ", Const, 0}, + {"ETH_P_CAIF", Const, 0}, + {"ETH_P_CAN", Const, 0}, + {"ETH_P_CONTROL", Const, 0}, + {"ETH_P_CUST", Const, 0}, + {"ETH_P_DDCMP", Const, 0}, + {"ETH_P_DEC", Const, 0}, + {"ETH_P_DIAG", Const, 0}, + {"ETH_P_DNA_DL", Const, 0}, + {"ETH_P_DNA_RC", Const, 0}, + {"ETH_P_DNA_RT", Const, 0}, + {"ETH_P_DSA", Const, 0}, + {"ETH_P_ECONET", Const, 0}, + {"ETH_P_EDSA", Const, 0}, + {"ETH_P_FCOE", Const, 0}, + {"ETH_P_FIP", Const, 0}, + {"ETH_P_HDLC", Const, 0}, + {"ETH_P_IEEE802154", Const, 0}, + {"ETH_P_IEEEPUP", Const, 0}, + {"ETH_P_IEEEPUPAT", Const, 0}, + {"ETH_P_IP", Const, 0}, + {"ETH_P_IPV6", Const, 0}, + {"ETH_P_IPX", Const, 0}, + {"ETH_P_IRDA", Const, 0}, + {"ETH_P_LAT", Const, 0}, + {"ETH_P_LINK_CTL", Const, 0}, + {"ETH_P_LOCALTALK", Const, 0}, + {"ETH_P_LOOP", Const, 0}, + {"ETH_P_MOBITEX", Const, 0}, + {"ETH_P_MPLS_MC", Const, 0}, + {"ETH_P_MPLS_UC", Const, 0}, + {"ETH_P_PAE", Const, 0}, + {"ETH_P_PAUSE", Const, 0}, + {"ETH_P_PHONET", Const, 0}, + {"ETH_P_PPPTALK", Const, 0}, + {"ETH_P_PPP_DISC", Const, 0}, + {"ETH_P_PPP_MP", Const, 0}, + {"ETH_P_PPP_SES", Const, 0}, + {"ETH_P_PUP", Const, 0}, + {"ETH_P_PUPAT", Const, 0}, + {"ETH_P_RARP", Const, 0}, + {"ETH_P_SCA", Const, 0}, + {"ETH_P_SLOW", Const, 0}, + {"ETH_P_SNAP", Const, 0}, + {"ETH_P_TEB", Const, 0}, + {"ETH_P_TIPC", Const, 0}, + {"ETH_P_TRAILER", Const, 0}, + {"ETH_P_TR_802_2", Const, 0}, + {"ETH_P_WAN_PPP", Const, 0}, + {"ETH_P_WCCP", Const, 0}, + {"ETH_P_X25", Const, 0}, + {"ETIME", Const, 0}, + {"ETIMEDOUT", Const, 0}, + {"ETOOMANYREFS", Const, 0}, + {"ETXTBSY", Const, 0}, + {"EUCLEAN", Const, 0}, + {"EUNATCH", Const, 0}, + {"EUSERS", Const, 0}, + {"EVFILT_AIO", Const, 0}, + {"EVFILT_FS", Const, 0}, + {"EVFILT_LIO", Const, 0}, + {"EVFILT_MACHPORT", Const, 0}, + {"EVFILT_PROC", Const, 0}, + {"EVFILT_READ", Const, 0}, + {"EVFILT_SIGNAL", Const, 0}, + {"EVFILT_SYSCOUNT", Const, 0}, + {"EVFILT_THREADMARKER", Const, 0}, + {"EVFILT_TIMER", Const, 0}, + {"EVFILT_USER", Const, 0}, + {"EVFILT_VM", Const, 0}, + {"EVFILT_VNODE", Const, 0}, + {"EVFILT_WRITE", Const, 0}, + {"EV_ADD", Const, 0}, + {"EV_CLEAR", Const, 0}, + {"EV_DELETE", Const, 0}, + {"EV_DISABLE", Const, 0}, + {"EV_DISPATCH", Const, 0}, + {"EV_DROP", Const, 3}, + {"EV_ENABLE", Const, 0}, + {"EV_EOF", Const, 0}, + {"EV_ERROR", Const, 0}, + {"EV_FLAG0", Const, 0}, + {"EV_FLAG1", Const, 0}, + {"EV_ONESHOT", Const, 0}, + {"EV_OOBAND", Const, 0}, + {"EV_POLL", Const, 0}, + {"EV_RECEIPT", Const, 0}, + {"EV_SYSFLAGS", Const, 0}, + {"EWINDOWS", Const, 0}, + {"EWOULDBLOCK", Const, 0}, + {"EXDEV", Const, 0}, + {"EXFULL", Const, 0}, + {"EXTA", Const, 0}, + {"EXTB", Const, 0}, + {"EXTPROC", Const, 0}, + {"Environ", Func, 0}, + {"EpollCreate", Func, 0}, + {"EpollCreate1", Func, 0}, + {"EpollCtl", Func, 0}, + {"EpollEvent", Type, 0}, + {"EpollEvent.Events", Field, 0}, + {"EpollEvent.Fd", Field, 0}, + {"EpollEvent.Pad", Field, 0}, + {"EpollEvent.PadFd", Field, 0}, + {"EpollWait", Func, 0}, + {"Errno", Type, 0}, + {"EscapeArg", Func, 0}, + {"Exchangedata", Func, 0}, + {"Exec", Func, 0}, + {"Exit", Func, 0}, + {"ExitProcess", Func, 0}, + {"FD_CLOEXEC", Const, 0}, + {"FD_SETSIZE", Const, 0}, + {"FILE_ACTION_ADDED", Const, 0}, + {"FILE_ACTION_MODIFIED", Const, 0}, + {"FILE_ACTION_REMOVED", Const, 0}, + {"FILE_ACTION_RENAMED_NEW_NAME", Const, 0}, + {"FILE_ACTION_RENAMED_OLD_NAME", Const, 0}, + {"FILE_APPEND_DATA", Const, 0}, + {"FILE_ATTRIBUTE_ARCHIVE", Const, 0}, + {"FILE_ATTRIBUTE_DIRECTORY", Const, 0}, + {"FILE_ATTRIBUTE_HIDDEN", Const, 0}, + {"FILE_ATTRIBUTE_NORMAL", Const, 0}, + {"FILE_ATTRIBUTE_READONLY", Const, 0}, + {"FILE_ATTRIBUTE_REPARSE_POINT", Const, 4}, + {"FILE_ATTRIBUTE_SYSTEM", Const, 0}, + {"FILE_BEGIN", Const, 0}, + {"FILE_CURRENT", Const, 0}, + {"FILE_END", Const, 0}, + {"FILE_FLAG_BACKUP_SEMANTICS", Const, 0}, + {"FILE_FLAG_OPEN_REPARSE_POINT", Const, 4}, + {"FILE_FLAG_OVERLAPPED", Const, 0}, + {"FILE_LIST_DIRECTORY", Const, 0}, + {"FILE_MAP_COPY", Const, 0}, + {"FILE_MAP_EXECUTE", Const, 0}, + {"FILE_MAP_READ", Const, 0}, + {"FILE_MAP_WRITE", Const, 0}, + {"FILE_NOTIFY_CHANGE_ATTRIBUTES", Const, 0}, + {"FILE_NOTIFY_CHANGE_CREATION", Const, 0}, + {"FILE_NOTIFY_CHANGE_DIR_NAME", Const, 0}, + {"FILE_NOTIFY_CHANGE_FILE_NAME", Const, 0}, + {"FILE_NOTIFY_CHANGE_LAST_ACCESS", Const, 0}, + {"FILE_NOTIFY_CHANGE_LAST_WRITE", Const, 0}, + {"FILE_NOTIFY_CHANGE_SIZE", Const, 0}, + {"FILE_SHARE_DELETE", Const, 0}, + {"FILE_SHARE_READ", Const, 0}, + {"FILE_SHARE_WRITE", Const, 0}, + {"FILE_SKIP_COMPLETION_PORT_ON_SUCCESS", Const, 2}, + {"FILE_SKIP_SET_EVENT_ON_HANDLE", Const, 2}, + {"FILE_TYPE_CHAR", Const, 0}, + {"FILE_TYPE_DISK", Const, 0}, + {"FILE_TYPE_PIPE", Const, 0}, + {"FILE_TYPE_REMOTE", Const, 0}, + {"FILE_TYPE_UNKNOWN", Const, 0}, + {"FILE_WRITE_ATTRIBUTES", Const, 0}, + {"FLUSHO", Const, 0}, + {"FORMAT_MESSAGE_ALLOCATE_BUFFER", Const, 0}, + {"FORMAT_MESSAGE_ARGUMENT_ARRAY", Const, 0}, + {"FORMAT_MESSAGE_FROM_HMODULE", Const, 0}, + {"FORMAT_MESSAGE_FROM_STRING", Const, 0}, + {"FORMAT_MESSAGE_FROM_SYSTEM", Const, 0}, + {"FORMAT_MESSAGE_IGNORE_INSERTS", Const, 0}, + {"FORMAT_MESSAGE_MAX_WIDTH_MASK", Const, 0}, + {"FSCTL_GET_REPARSE_POINT", Const, 4}, + {"F_ADDFILESIGS", Const, 0}, + {"F_ADDSIGS", Const, 0}, + {"F_ALLOCATEALL", Const, 0}, + {"F_ALLOCATECONTIG", Const, 0}, + {"F_CANCEL", Const, 0}, + {"F_CHKCLEAN", Const, 0}, + {"F_CLOSEM", Const, 1}, + {"F_DUP2FD", Const, 0}, + {"F_DUP2FD_CLOEXEC", Const, 1}, + {"F_DUPFD", Const, 0}, + {"F_DUPFD_CLOEXEC", Const, 0}, + {"F_EXLCK", Const, 0}, + {"F_FINDSIGS", Const, 16}, + {"F_FLUSH_DATA", Const, 0}, + {"F_FREEZE_FS", Const, 0}, + {"F_FSCTL", Const, 1}, + {"F_FSDIRMASK", Const, 1}, + {"F_FSIN", Const, 1}, + {"F_FSINOUT", Const, 1}, + {"F_FSOUT", Const, 1}, + {"F_FSPRIV", Const, 1}, + {"F_FSVOID", Const, 1}, + {"F_FULLFSYNC", Const, 0}, + {"F_GETCODEDIR", Const, 16}, + {"F_GETFD", Const, 0}, + {"F_GETFL", Const, 0}, + {"F_GETLEASE", Const, 0}, + {"F_GETLK", Const, 0}, + {"F_GETLK64", Const, 0}, + {"F_GETLKPID", Const, 0}, + {"F_GETNOSIGPIPE", Const, 0}, + {"F_GETOWN", Const, 0}, + {"F_GETOWN_EX", Const, 0}, + {"F_GETPATH", Const, 0}, + {"F_GETPATH_MTMINFO", Const, 0}, + {"F_GETPIPE_SZ", Const, 0}, + {"F_GETPROTECTIONCLASS", Const, 0}, + {"F_GETPROTECTIONLEVEL", Const, 16}, + {"F_GETSIG", Const, 0}, + {"F_GLOBAL_NOCACHE", Const, 0}, + {"F_LOCK", Const, 0}, + {"F_LOG2PHYS", Const, 0}, + {"F_LOG2PHYS_EXT", Const, 0}, + {"F_MARKDEPENDENCY", Const, 0}, + {"F_MAXFD", Const, 1}, + {"F_NOCACHE", Const, 0}, + {"F_NODIRECT", Const, 0}, + {"F_NOTIFY", Const, 0}, + {"F_OGETLK", Const, 0}, + {"F_OK", Const, 0}, + {"F_OSETLK", Const, 0}, + {"F_OSETLKW", Const, 0}, + {"F_PARAM_MASK", Const, 1}, + {"F_PARAM_MAX", Const, 1}, + {"F_PATHPKG_CHECK", Const, 0}, + {"F_PEOFPOSMODE", Const, 0}, + {"F_PREALLOCATE", Const, 0}, + {"F_RDADVISE", Const, 0}, + {"F_RDAHEAD", Const, 0}, + {"F_RDLCK", Const, 0}, + {"F_READAHEAD", Const, 0}, + {"F_READBOOTSTRAP", Const, 0}, + {"F_SETBACKINGSTORE", Const, 0}, + {"F_SETFD", Const, 0}, + {"F_SETFL", Const, 0}, + {"F_SETLEASE", Const, 0}, + {"F_SETLK", Const, 0}, + {"F_SETLK64", Const, 0}, + {"F_SETLKW", Const, 0}, + {"F_SETLKW64", Const, 0}, + {"F_SETLKWTIMEOUT", Const, 16}, + {"F_SETLK_REMOTE", Const, 0}, + {"F_SETNOSIGPIPE", Const, 0}, + {"F_SETOWN", Const, 0}, + {"F_SETOWN_EX", Const, 0}, + {"F_SETPIPE_SZ", Const, 0}, + {"F_SETPROTECTIONCLASS", Const, 0}, + {"F_SETSIG", Const, 0}, + {"F_SETSIZE", Const, 0}, + {"F_SHLCK", Const, 0}, + {"F_SINGLE_WRITER", Const, 16}, + {"F_TEST", Const, 0}, + {"F_THAW_FS", Const, 0}, + {"F_TLOCK", Const, 0}, + {"F_TRANSCODEKEY", Const, 16}, + {"F_ULOCK", Const, 0}, + {"F_UNLCK", Const, 0}, + {"F_UNLCKSYS", Const, 0}, + {"F_VOLPOSMODE", Const, 0}, + {"F_WRITEBOOTSTRAP", Const, 0}, + {"F_WRLCK", Const, 0}, + {"Faccessat", Func, 0}, + {"Fallocate", Func, 0}, + {"Fbootstraptransfer_t", Type, 0}, + {"Fbootstraptransfer_t.Buffer", Field, 0}, + {"Fbootstraptransfer_t.Length", Field, 0}, + {"Fbootstraptransfer_t.Offset", Field, 0}, + {"Fchdir", Func, 0}, + {"Fchflags", Func, 0}, + {"Fchmod", Func, 0}, + {"Fchmodat", Func, 0}, + {"Fchown", Func, 0}, + {"Fchownat", Func, 0}, + {"FcntlFlock", Func, 3}, + {"FdSet", Type, 0}, + {"FdSet.Bits", Field, 0}, + {"FdSet.X__fds_bits", Field, 0}, + {"Fdatasync", Func, 0}, + {"FileNotifyInformation", Type, 0}, + {"FileNotifyInformation.Action", Field, 0}, + {"FileNotifyInformation.FileName", Field, 0}, + {"FileNotifyInformation.FileNameLength", Field, 0}, + {"FileNotifyInformation.NextEntryOffset", Field, 0}, + {"Filetime", Type, 0}, + {"Filetime.HighDateTime", Field, 0}, + {"Filetime.LowDateTime", Field, 0}, + {"FindClose", Func, 0}, + {"FindFirstFile", Func, 0}, + {"FindNextFile", Func, 0}, + {"Flock", Func, 0}, + {"Flock_t", Type, 0}, + {"Flock_t.Len", Field, 0}, + {"Flock_t.Pad_cgo_0", Field, 0}, + {"Flock_t.Pad_cgo_1", Field, 3}, + {"Flock_t.Pid", Field, 0}, + {"Flock_t.Start", Field, 0}, + {"Flock_t.Sysid", Field, 0}, + {"Flock_t.Type", Field, 0}, + {"Flock_t.Whence", Field, 0}, + {"FlushBpf", Func, 0}, + {"FlushFileBuffers", Func, 0}, + {"FlushViewOfFile", Func, 0}, + {"ForkExec", Func, 0}, + {"ForkLock", Var, 0}, + {"FormatMessage", Func, 0}, + {"Fpathconf", Func, 0}, + {"FreeAddrInfoW", Func, 1}, + {"FreeEnvironmentStrings", Func, 0}, + {"FreeLibrary", Func, 0}, + {"Fsid", Type, 0}, + {"Fsid.Val", Field, 0}, + {"Fsid.X__fsid_val", Field, 2}, + {"Fsid.X__val", Field, 0}, + {"Fstat", Func, 0}, + {"Fstatat", Func, 12}, + {"Fstatfs", Func, 0}, + {"Fstore_t", Type, 0}, + {"Fstore_t.Bytesalloc", Field, 0}, + {"Fstore_t.Flags", Field, 0}, + {"Fstore_t.Length", Field, 0}, + {"Fstore_t.Offset", Field, 0}, + {"Fstore_t.Posmode", Field, 0}, + {"Fsync", Func, 0}, + {"Ftruncate", Func, 0}, + {"FullPath", Func, 4}, + {"Futimes", Func, 0}, + {"Futimesat", Func, 0}, + {"GENERIC_ALL", Const, 0}, + {"GENERIC_EXECUTE", Const, 0}, + {"GENERIC_READ", Const, 0}, + {"GENERIC_WRITE", Const, 0}, + {"GUID", Type, 1}, + {"GUID.Data1", Field, 1}, + {"GUID.Data2", Field, 1}, + {"GUID.Data3", Field, 1}, + {"GUID.Data4", Field, 1}, + {"GetAcceptExSockaddrs", Func, 0}, + {"GetAdaptersInfo", Func, 0}, + {"GetAddrInfoW", Func, 1}, + {"GetCommandLine", Func, 0}, + {"GetComputerName", Func, 0}, + {"GetConsoleMode", Func, 1}, + {"GetCurrentDirectory", Func, 0}, + {"GetCurrentProcess", Func, 0}, + {"GetEnvironmentStrings", Func, 0}, + {"GetEnvironmentVariable", Func, 0}, + {"GetExitCodeProcess", Func, 0}, + {"GetFileAttributes", Func, 0}, + {"GetFileAttributesEx", Func, 0}, + {"GetFileExInfoStandard", Const, 0}, + {"GetFileExMaxInfoLevel", Const, 0}, + {"GetFileInformationByHandle", Func, 0}, + {"GetFileType", Func, 0}, + {"GetFullPathName", Func, 0}, + {"GetHostByName", Func, 0}, + {"GetIfEntry", Func, 0}, + {"GetLastError", Func, 0}, + {"GetLengthSid", Func, 0}, + {"GetLongPathName", Func, 0}, + {"GetProcAddress", Func, 0}, + {"GetProcessTimes", Func, 0}, + {"GetProtoByName", Func, 0}, + {"GetQueuedCompletionStatus", Func, 0}, + {"GetServByName", Func, 0}, + {"GetShortPathName", Func, 0}, + {"GetStartupInfo", Func, 0}, + {"GetStdHandle", Func, 0}, + {"GetSystemTimeAsFileTime", Func, 0}, + {"GetTempPath", Func, 0}, + {"GetTimeZoneInformation", Func, 0}, + {"GetTokenInformation", Func, 0}, + {"GetUserNameEx", Func, 0}, + {"GetUserProfileDirectory", Func, 0}, + {"GetVersion", Func, 0}, + {"Getcwd", Func, 0}, + {"Getdents", Func, 0}, + {"Getdirentries", Func, 0}, + {"Getdtablesize", Func, 0}, + {"Getegid", Func, 0}, + {"Getenv", Func, 0}, + {"Geteuid", Func, 0}, + {"Getfsstat", Func, 0}, + {"Getgid", Func, 0}, + {"Getgroups", Func, 0}, + {"Getpagesize", Func, 0}, + {"Getpeername", Func, 0}, + {"Getpgid", Func, 0}, + {"Getpgrp", Func, 0}, + {"Getpid", Func, 0}, + {"Getppid", Func, 0}, + {"Getpriority", Func, 0}, + {"Getrlimit", Func, 0}, + {"Getrusage", Func, 0}, + {"Getsid", Func, 0}, + {"Getsockname", Func, 0}, + {"Getsockopt", Func, 1}, + {"GetsockoptByte", Func, 0}, + {"GetsockoptICMPv6Filter", Func, 2}, + {"GetsockoptIPMreq", Func, 0}, + {"GetsockoptIPMreqn", Func, 0}, + {"GetsockoptIPv6MTUInfo", Func, 2}, + {"GetsockoptIPv6Mreq", Func, 0}, + {"GetsockoptInet4Addr", Func, 0}, + {"GetsockoptInt", Func, 0}, + {"GetsockoptUcred", Func, 1}, + {"Gettid", Func, 0}, + {"Gettimeofday", Func, 0}, + {"Getuid", Func, 0}, + {"Getwd", Func, 0}, + {"Getxattr", Func, 1}, + {"HANDLE_FLAG_INHERIT", Const, 0}, + {"HKEY_CLASSES_ROOT", Const, 0}, + {"HKEY_CURRENT_CONFIG", Const, 0}, + {"HKEY_CURRENT_USER", Const, 0}, + {"HKEY_DYN_DATA", Const, 0}, + {"HKEY_LOCAL_MACHINE", Const, 0}, + {"HKEY_PERFORMANCE_DATA", Const, 0}, + {"HKEY_USERS", Const, 0}, + {"HUPCL", Const, 0}, + {"Handle", Type, 0}, + {"Hostent", Type, 0}, + {"Hostent.AddrList", Field, 0}, + {"Hostent.AddrType", Field, 0}, + {"Hostent.Aliases", Field, 0}, + {"Hostent.Length", Field, 0}, + {"Hostent.Name", Field, 0}, + {"ICANON", Const, 0}, + {"ICMP6_FILTER", Const, 2}, + {"ICMPV6_FILTER", Const, 2}, + {"ICMPv6Filter", Type, 2}, + {"ICMPv6Filter.Data", Field, 2}, + {"ICMPv6Filter.Filt", Field, 2}, + {"ICRNL", Const, 0}, + {"IEXTEN", Const, 0}, + {"IFAN_ARRIVAL", Const, 1}, + {"IFAN_DEPARTURE", Const, 1}, + {"IFA_ADDRESS", Const, 0}, + {"IFA_ANYCAST", Const, 0}, + {"IFA_BROADCAST", Const, 0}, + {"IFA_CACHEINFO", Const, 0}, + {"IFA_F_DADFAILED", Const, 0}, + {"IFA_F_DEPRECATED", Const, 0}, + {"IFA_F_HOMEADDRESS", Const, 0}, + {"IFA_F_NODAD", Const, 0}, + {"IFA_F_OPTIMISTIC", Const, 0}, + {"IFA_F_PERMANENT", Const, 0}, + {"IFA_F_SECONDARY", Const, 0}, + {"IFA_F_TEMPORARY", Const, 0}, + {"IFA_F_TENTATIVE", Const, 0}, + {"IFA_LABEL", Const, 0}, + {"IFA_LOCAL", Const, 0}, + {"IFA_MAX", Const, 0}, + {"IFA_MULTICAST", Const, 0}, + {"IFA_ROUTE", Const, 1}, + {"IFA_UNSPEC", Const, 0}, + {"IFF_ALLMULTI", Const, 0}, + {"IFF_ALTPHYS", Const, 0}, + {"IFF_AUTOMEDIA", Const, 0}, + {"IFF_BROADCAST", Const, 0}, + {"IFF_CANTCHANGE", Const, 0}, + {"IFF_CANTCONFIG", Const, 1}, + {"IFF_DEBUG", Const, 0}, + {"IFF_DRV_OACTIVE", Const, 0}, + {"IFF_DRV_RUNNING", Const, 0}, + {"IFF_DYING", Const, 0}, + {"IFF_DYNAMIC", Const, 0}, + {"IFF_LINK0", Const, 0}, + {"IFF_LINK1", Const, 0}, + {"IFF_LINK2", Const, 0}, + {"IFF_LOOPBACK", Const, 0}, + {"IFF_MASTER", Const, 0}, + {"IFF_MONITOR", Const, 0}, + {"IFF_MULTICAST", Const, 0}, + {"IFF_NOARP", Const, 0}, + {"IFF_NOTRAILERS", Const, 0}, + {"IFF_NO_PI", Const, 0}, + {"IFF_OACTIVE", Const, 0}, + {"IFF_ONE_QUEUE", Const, 0}, + {"IFF_POINTOPOINT", Const, 0}, + {"IFF_POINTTOPOINT", Const, 0}, + {"IFF_PORTSEL", Const, 0}, + {"IFF_PPROMISC", Const, 0}, + {"IFF_PROMISC", Const, 0}, + {"IFF_RENAMING", Const, 0}, + {"IFF_RUNNING", Const, 0}, + {"IFF_SIMPLEX", Const, 0}, + {"IFF_SLAVE", Const, 0}, + {"IFF_SMART", Const, 0}, + {"IFF_STATICARP", Const, 0}, + {"IFF_TAP", Const, 0}, + {"IFF_TUN", Const, 0}, + {"IFF_TUN_EXCL", Const, 0}, + {"IFF_UP", Const, 0}, + {"IFF_VNET_HDR", Const, 0}, + {"IFLA_ADDRESS", Const, 0}, + {"IFLA_BROADCAST", Const, 0}, + {"IFLA_COST", Const, 0}, + {"IFLA_IFALIAS", Const, 0}, + {"IFLA_IFNAME", Const, 0}, + {"IFLA_LINK", Const, 0}, + {"IFLA_LINKINFO", Const, 0}, + {"IFLA_LINKMODE", Const, 0}, + {"IFLA_MAP", Const, 0}, + {"IFLA_MASTER", Const, 0}, + {"IFLA_MAX", Const, 0}, + {"IFLA_MTU", Const, 0}, + {"IFLA_NET_NS_PID", Const, 0}, + {"IFLA_OPERSTATE", Const, 0}, + {"IFLA_PRIORITY", Const, 0}, + {"IFLA_PROTINFO", Const, 0}, + {"IFLA_QDISC", Const, 0}, + {"IFLA_STATS", Const, 0}, + {"IFLA_TXQLEN", Const, 0}, + {"IFLA_UNSPEC", Const, 0}, + {"IFLA_WEIGHT", Const, 0}, + {"IFLA_WIRELESS", Const, 0}, + {"IFNAMSIZ", Const, 0}, + {"IFT_1822", Const, 0}, + {"IFT_A12MPPSWITCH", Const, 0}, + {"IFT_AAL2", Const, 0}, + {"IFT_AAL5", Const, 0}, + {"IFT_ADSL", Const, 0}, + {"IFT_AFLANE8023", Const, 0}, + {"IFT_AFLANE8025", Const, 0}, + {"IFT_ARAP", Const, 0}, + {"IFT_ARCNET", Const, 0}, + {"IFT_ARCNETPLUS", Const, 0}, + {"IFT_ASYNC", Const, 0}, + {"IFT_ATM", Const, 0}, + {"IFT_ATMDXI", Const, 0}, + {"IFT_ATMFUNI", Const, 0}, + {"IFT_ATMIMA", Const, 0}, + {"IFT_ATMLOGICAL", Const, 0}, + {"IFT_ATMRADIO", Const, 0}, + {"IFT_ATMSUBINTERFACE", Const, 0}, + {"IFT_ATMVCIENDPT", Const, 0}, + {"IFT_ATMVIRTUAL", Const, 0}, + {"IFT_BGPPOLICYACCOUNTING", Const, 0}, + {"IFT_BLUETOOTH", Const, 1}, + {"IFT_BRIDGE", Const, 0}, + {"IFT_BSC", Const, 0}, + {"IFT_CARP", Const, 0}, + {"IFT_CCTEMUL", Const, 0}, + {"IFT_CELLULAR", Const, 0}, + {"IFT_CEPT", Const, 0}, + {"IFT_CES", Const, 0}, + {"IFT_CHANNEL", Const, 0}, + {"IFT_CNR", Const, 0}, + {"IFT_COFFEE", Const, 0}, + {"IFT_COMPOSITELINK", Const, 0}, + {"IFT_DCN", Const, 0}, + {"IFT_DIGITALPOWERLINE", Const, 0}, + {"IFT_DIGITALWRAPPEROVERHEADCHANNEL", Const, 0}, + {"IFT_DLSW", Const, 0}, + {"IFT_DOCSCABLEDOWNSTREAM", Const, 0}, + {"IFT_DOCSCABLEMACLAYER", Const, 0}, + {"IFT_DOCSCABLEUPSTREAM", Const, 0}, + {"IFT_DOCSCABLEUPSTREAMCHANNEL", Const, 1}, + {"IFT_DS0", Const, 0}, + {"IFT_DS0BUNDLE", Const, 0}, + {"IFT_DS1FDL", Const, 0}, + {"IFT_DS3", Const, 0}, + {"IFT_DTM", Const, 0}, + {"IFT_DUMMY", Const, 1}, + {"IFT_DVBASILN", Const, 0}, + {"IFT_DVBASIOUT", Const, 0}, + {"IFT_DVBRCCDOWNSTREAM", Const, 0}, + {"IFT_DVBRCCMACLAYER", Const, 0}, + {"IFT_DVBRCCUPSTREAM", Const, 0}, + {"IFT_ECONET", Const, 1}, + {"IFT_ENC", Const, 0}, + {"IFT_EON", Const, 0}, + {"IFT_EPLRS", Const, 0}, + {"IFT_ESCON", Const, 0}, + {"IFT_ETHER", Const, 0}, + {"IFT_FAITH", Const, 0}, + {"IFT_FAST", Const, 0}, + {"IFT_FASTETHER", Const, 0}, + {"IFT_FASTETHERFX", Const, 0}, + {"IFT_FDDI", Const, 0}, + {"IFT_FIBRECHANNEL", Const, 0}, + {"IFT_FRAMERELAYINTERCONNECT", Const, 0}, + {"IFT_FRAMERELAYMPI", Const, 0}, + {"IFT_FRDLCIENDPT", Const, 0}, + {"IFT_FRELAY", Const, 0}, + {"IFT_FRELAYDCE", Const, 0}, + {"IFT_FRF16MFRBUNDLE", Const, 0}, + {"IFT_FRFORWARD", Const, 0}, + {"IFT_G703AT2MB", Const, 0}, + {"IFT_G703AT64K", Const, 0}, + {"IFT_GIF", Const, 0}, + {"IFT_GIGABITETHERNET", Const, 0}, + {"IFT_GR303IDT", Const, 0}, + {"IFT_GR303RDT", Const, 0}, + {"IFT_H323GATEKEEPER", Const, 0}, + {"IFT_H323PROXY", Const, 0}, + {"IFT_HDH1822", Const, 0}, + {"IFT_HDLC", Const, 0}, + {"IFT_HDSL2", Const, 0}, + {"IFT_HIPERLAN2", Const, 0}, + {"IFT_HIPPI", Const, 0}, + {"IFT_HIPPIINTERFACE", Const, 0}, + {"IFT_HOSTPAD", Const, 0}, + {"IFT_HSSI", Const, 0}, + {"IFT_HY", Const, 0}, + {"IFT_IBM370PARCHAN", Const, 0}, + {"IFT_IDSL", Const, 0}, + {"IFT_IEEE1394", Const, 0}, + {"IFT_IEEE80211", Const, 0}, + {"IFT_IEEE80212", Const, 0}, + {"IFT_IEEE8023ADLAG", Const, 0}, + {"IFT_IFGSN", Const, 0}, + {"IFT_IMT", Const, 0}, + {"IFT_INFINIBAND", Const, 1}, + {"IFT_INTERLEAVE", Const, 0}, + {"IFT_IP", Const, 0}, + {"IFT_IPFORWARD", Const, 0}, + {"IFT_IPOVERATM", Const, 0}, + {"IFT_IPOVERCDLC", Const, 0}, + {"IFT_IPOVERCLAW", Const, 0}, + {"IFT_IPSWITCH", Const, 0}, + {"IFT_IPXIP", Const, 0}, + {"IFT_ISDN", Const, 0}, + {"IFT_ISDNBASIC", Const, 0}, + {"IFT_ISDNPRIMARY", Const, 0}, + {"IFT_ISDNS", Const, 0}, + {"IFT_ISDNU", Const, 0}, + {"IFT_ISO88022LLC", Const, 0}, + {"IFT_ISO88023", Const, 0}, + {"IFT_ISO88024", Const, 0}, + {"IFT_ISO88025", Const, 0}, + {"IFT_ISO88025CRFPINT", Const, 0}, + {"IFT_ISO88025DTR", Const, 0}, + {"IFT_ISO88025FIBER", Const, 0}, + {"IFT_ISO88026", Const, 0}, + {"IFT_ISUP", Const, 0}, + {"IFT_L2VLAN", Const, 0}, + {"IFT_L3IPVLAN", Const, 0}, + {"IFT_L3IPXVLAN", Const, 0}, + {"IFT_LAPB", Const, 0}, + {"IFT_LAPD", Const, 0}, + {"IFT_LAPF", Const, 0}, + {"IFT_LINEGROUP", Const, 1}, + {"IFT_LOCALTALK", Const, 0}, + {"IFT_LOOP", Const, 0}, + {"IFT_MEDIAMAILOVERIP", Const, 0}, + {"IFT_MFSIGLINK", Const, 0}, + {"IFT_MIOX25", Const, 0}, + {"IFT_MODEM", Const, 0}, + {"IFT_MPC", Const, 0}, + {"IFT_MPLS", Const, 0}, + {"IFT_MPLSTUNNEL", Const, 0}, + {"IFT_MSDSL", Const, 0}, + {"IFT_MVL", Const, 0}, + {"IFT_MYRINET", Const, 0}, + {"IFT_NFAS", Const, 0}, + {"IFT_NSIP", Const, 0}, + {"IFT_OPTICALCHANNEL", Const, 0}, + {"IFT_OPTICALTRANSPORT", Const, 0}, + {"IFT_OTHER", Const, 0}, + {"IFT_P10", Const, 0}, + {"IFT_P80", Const, 0}, + {"IFT_PARA", Const, 0}, + {"IFT_PDP", Const, 0}, + {"IFT_PFLOG", Const, 0}, + {"IFT_PFLOW", Const, 1}, + {"IFT_PFSYNC", Const, 0}, + {"IFT_PLC", Const, 0}, + {"IFT_PON155", Const, 1}, + {"IFT_PON622", Const, 1}, + {"IFT_POS", Const, 0}, + {"IFT_PPP", Const, 0}, + {"IFT_PPPMULTILINKBUNDLE", Const, 0}, + {"IFT_PROPATM", Const, 1}, + {"IFT_PROPBWAP2MP", Const, 0}, + {"IFT_PROPCNLS", Const, 0}, + {"IFT_PROPDOCSWIRELESSDOWNSTREAM", Const, 0}, + {"IFT_PROPDOCSWIRELESSMACLAYER", Const, 0}, + {"IFT_PROPDOCSWIRELESSUPSTREAM", Const, 0}, + {"IFT_PROPMUX", Const, 0}, + {"IFT_PROPVIRTUAL", Const, 0}, + {"IFT_PROPWIRELESSP2P", Const, 0}, + {"IFT_PTPSERIAL", Const, 0}, + {"IFT_PVC", Const, 0}, + {"IFT_Q2931", Const, 1}, + {"IFT_QLLC", Const, 0}, + {"IFT_RADIOMAC", Const, 0}, + {"IFT_RADSL", Const, 0}, + {"IFT_REACHDSL", Const, 0}, + {"IFT_RFC1483", Const, 0}, + {"IFT_RS232", Const, 0}, + {"IFT_RSRB", Const, 0}, + {"IFT_SDLC", Const, 0}, + {"IFT_SDSL", Const, 0}, + {"IFT_SHDSL", Const, 0}, + {"IFT_SIP", Const, 0}, + {"IFT_SIPSIG", Const, 1}, + {"IFT_SIPTG", Const, 1}, + {"IFT_SLIP", Const, 0}, + {"IFT_SMDSDXI", Const, 0}, + {"IFT_SMDSICIP", Const, 0}, + {"IFT_SONET", Const, 0}, + {"IFT_SONETOVERHEADCHANNEL", Const, 0}, + {"IFT_SONETPATH", Const, 0}, + {"IFT_SONETVT", Const, 0}, + {"IFT_SRP", Const, 0}, + {"IFT_SS7SIGLINK", Const, 0}, + {"IFT_STACKTOSTACK", Const, 0}, + {"IFT_STARLAN", Const, 0}, + {"IFT_STF", Const, 0}, + {"IFT_T1", Const, 0}, + {"IFT_TDLC", Const, 0}, + {"IFT_TELINK", Const, 1}, + {"IFT_TERMPAD", Const, 0}, + {"IFT_TR008", Const, 0}, + {"IFT_TRANSPHDLC", Const, 0}, + {"IFT_TUNNEL", Const, 0}, + {"IFT_ULTRA", Const, 0}, + {"IFT_USB", Const, 0}, + {"IFT_V11", Const, 0}, + {"IFT_V35", Const, 0}, + {"IFT_V36", Const, 0}, + {"IFT_V37", Const, 0}, + {"IFT_VDSL", Const, 0}, + {"IFT_VIRTUALIPADDRESS", Const, 0}, + {"IFT_VIRTUALTG", Const, 1}, + {"IFT_VOICEDID", Const, 1}, + {"IFT_VOICEEM", Const, 0}, + {"IFT_VOICEEMFGD", Const, 1}, + {"IFT_VOICEENCAP", Const, 0}, + {"IFT_VOICEFGDEANA", Const, 1}, + {"IFT_VOICEFXO", Const, 0}, + {"IFT_VOICEFXS", Const, 0}, + {"IFT_VOICEOVERATM", Const, 0}, + {"IFT_VOICEOVERCABLE", Const, 1}, + {"IFT_VOICEOVERFRAMERELAY", Const, 0}, + {"IFT_VOICEOVERIP", Const, 0}, + {"IFT_X213", Const, 0}, + {"IFT_X25", Const, 0}, + {"IFT_X25DDN", Const, 0}, + {"IFT_X25HUNTGROUP", Const, 0}, + {"IFT_X25MLP", Const, 0}, + {"IFT_X25PLE", Const, 0}, + {"IFT_XETHER", Const, 0}, + {"IGNBRK", Const, 0}, + {"IGNCR", Const, 0}, + {"IGNORE", Const, 0}, + {"IGNPAR", Const, 0}, + {"IMAXBEL", Const, 0}, + {"INFINITE", Const, 0}, + {"INLCR", Const, 0}, + {"INPCK", Const, 0}, + {"INVALID_FILE_ATTRIBUTES", Const, 0}, + {"IN_ACCESS", Const, 0}, + {"IN_ALL_EVENTS", Const, 0}, + {"IN_ATTRIB", Const, 0}, + {"IN_CLASSA_HOST", Const, 0}, + {"IN_CLASSA_MAX", Const, 0}, + {"IN_CLASSA_NET", Const, 0}, + {"IN_CLASSA_NSHIFT", Const, 0}, + {"IN_CLASSB_HOST", Const, 0}, + {"IN_CLASSB_MAX", Const, 0}, + {"IN_CLASSB_NET", Const, 0}, + {"IN_CLASSB_NSHIFT", Const, 0}, + {"IN_CLASSC_HOST", Const, 0}, + {"IN_CLASSC_NET", Const, 0}, + {"IN_CLASSC_NSHIFT", Const, 0}, + {"IN_CLASSD_HOST", Const, 0}, + {"IN_CLASSD_NET", Const, 0}, + {"IN_CLASSD_NSHIFT", Const, 0}, + {"IN_CLOEXEC", Const, 0}, + {"IN_CLOSE", Const, 0}, + {"IN_CLOSE_NOWRITE", Const, 0}, + {"IN_CLOSE_WRITE", Const, 0}, + {"IN_CREATE", Const, 0}, + {"IN_DELETE", Const, 0}, + {"IN_DELETE_SELF", Const, 0}, + {"IN_DONT_FOLLOW", Const, 0}, + {"IN_EXCL_UNLINK", Const, 0}, + {"IN_IGNORED", Const, 0}, + {"IN_ISDIR", Const, 0}, + {"IN_LINKLOCALNETNUM", Const, 0}, + {"IN_LOOPBACKNET", Const, 0}, + {"IN_MASK_ADD", Const, 0}, + {"IN_MODIFY", Const, 0}, + {"IN_MOVE", Const, 0}, + {"IN_MOVED_FROM", Const, 0}, + {"IN_MOVED_TO", Const, 0}, + {"IN_MOVE_SELF", Const, 0}, + {"IN_NONBLOCK", Const, 0}, + {"IN_ONESHOT", Const, 0}, + {"IN_ONLYDIR", Const, 0}, + {"IN_OPEN", Const, 0}, + {"IN_Q_OVERFLOW", Const, 0}, + {"IN_RFC3021_HOST", Const, 1}, + {"IN_RFC3021_MASK", Const, 1}, + {"IN_RFC3021_NET", Const, 1}, + {"IN_RFC3021_NSHIFT", Const, 1}, + {"IN_UNMOUNT", Const, 0}, + {"IOC_IN", Const, 1}, + {"IOC_INOUT", Const, 1}, + {"IOC_OUT", Const, 1}, + {"IOC_VENDOR", Const, 3}, + {"IOC_WS2", Const, 1}, + {"IO_REPARSE_TAG_SYMLINK", Const, 4}, + {"IPMreq", Type, 0}, + {"IPMreq.Interface", Field, 0}, + {"IPMreq.Multiaddr", Field, 0}, + {"IPMreqn", Type, 0}, + {"IPMreqn.Address", Field, 0}, + {"IPMreqn.Ifindex", Field, 0}, + {"IPMreqn.Multiaddr", Field, 0}, + {"IPPROTO_3PC", Const, 0}, + {"IPPROTO_ADFS", Const, 0}, + {"IPPROTO_AH", Const, 0}, + {"IPPROTO_AHIP", Const, 0}, + {"IPPROTO_APES", Const, 0}, + {"IPPROTO_ARGUS", Const, 0}, + {"IPPROTO_AX25", Const, 0}, + {"IPPROTO_BHA", Const, 0}, + {"IPPROTO_BLT", Const, 0}, + {"IPPROTO_BRSATMON", Const, 0}, + {"IPPROTO_CARP", Const, 0}, + {"IPPROTO_CFTP", Const, 0}, + {"IPPROTO_CHAOS", Const, 0}, + {"IPPROTO_CMTP", Const, 0}, + {"IPPROTO_COMP", Const, 0}, + {"IPPROTO_CPHB", Const, 0}, + {"IPPROTO_CPNX", Const, 0}, + {"IPPROTO_DCCP", Const, 0}, + {"IPPROTO_DDP", Const, 0}, + {"IPPROTO_DGP", Const, 0}, + {"IPPROTO_DIVERT", Const, 0}, + {"IPPROTO_DIVERT_INIT", Const, 3}, + {"IPPROTO_DIVERT_RESP", Const, 3}, + {"IPPROTO_DONE", Const, 0}, + {"IPPROTO_DSTOPTS", Const, 0}, + {"IPPROTO_EGP", Const, 0}, + {"IPPROTO_EMCON", Const, 0}, + {"IPPROTO_ENCAP", Const, 0}, + {"IPPROTO_EON", Const, 0}, + {"IPPROTO_ESP", Const, 0}, + {"IPPROTO_ETHERIP", Const, 0}, + {"IPPROTO_FRAGMENT", Const, 0}, + {"IPPROTO_GGP", Const, 0}, + {"IPPROTO_GMTP", Const, 0}, + {"IPPROTO_GRE", Const, 0}, + {"IPPROTO_HELLO", Const, 0}, + {"IPPROTO_HMP", Const, 0}, + {"IPPROTO_HOPOPTS", Const, 0}, + {"IPPROTO_ICMP", Const, 0}, + {"IPPROTO_ICMPV6", Const, 0}, + {"IPPROTO_IDP", Const, 0}, + {"IPPROTO_IDPR", Const, 0}, + {"IPPROTO_IDRP", Const, 0}, + {"IPPROTO_IGMP", Const, 0}, + {"IPPROTO_IGP", Const, 0}, + {"IPPROTO_IGRP", Const, 0}, + {"IPPROTO_IL", Const, 0}, + {"IPPROTO_INLSP", Const, 0}, + {"IPPROTO_INP", Const, 0}, + {"IPPROTO_IP", Const, 0}, + {"IPPROTO_IPCOMP", Const, 0}, + {"IPPROTO_IPCV", Const, 0}, + {"IPPROTO_IPEIP", Const, 0}, + {"IPPROTO_IPIP", Const, 0}, + {"IPPROTO_IPPC", Const, 0}, + {"IPPROTO_IPV4", Const, 0}, + {"IPPROTO_IPV6", Const, 0}, + {"IPPROTO_IPV6_ICMP", Const, 1}, + {"IPPROTO_IRTP", Const, 0}, + {"IPPROTO_KRYPTOLAN", Const, 0}, + {"IPPROTO_LARP", Const, 0}, + {"IPPROTO_LEAF1", Const, 0}, + {"IPPROTO_LEAF2", Const, 0}, + {"IPPROTO_MAX", Const, 0}, + {"IPPROTO_MAXID", Const, 0}, + {"IPPROTO_MEAS", Const, 0}, + {"IPPROTO_MH", Const, 1}, + {"IPPROTO_MHRP", Const, 0}, + {"IPPROTO_MICP", Const, 0}, + {"IPPROTO_MOBILE", Const, 0}, + {"IPPROTO_MPLS", Const, 1}, + {"IPPROTO_MTP", Const, 0}, + {"IPPROTO_MUX", Const, 0}, + {"IPPROTO_ND", Const, 0}, + {"IPPROTO_NHRP", Const, 0}, + {"IPPROTO_NONE", Const, 0}, + {"IPPROTO_NSP", Const, 0}, + {"IPPROTO_NVPII", Const, 0}, + {"IPPROTO_OLD_DIVERT", Const, 0}, + {"IPPROTO_OSPFIGP", Const, 0}, + {"IPPROTO_PFSYNC", Const, 0}, + {"IPPROTO_PGM", Const, 0}, + {"IPPROTO_PIGP", Const, 0}, + {"IPPROTO_PIM", Const, 0}, + {"IPPROTO_PRM", Const, 0}, + {"IPPROTO_PUP", Const, 0}, + {"IPPROTO_PVP", Const, 0}, + {"IPPROTO_RAW", Const, 0}, + {"IPPROTO_RCCMON", Const, 0}, + {"IPPROTO_RDP", Const, 0}, + {"IPPROTO_ROUTING", Const, 0}, + {"IPPROTO_RSVP", Const, 0}, + {"IPPROTO_RVD", Const, 0}, + {"IPPROTO_SATEXPAK", Const, 0}, + {"IPPROTO_SATMON", Const, 0}, + {"IPPROTO_SCCSP", Const, 0}, + {"IPPROTO_SCTP", Const, 0}, + {"IPPROTO_SDRP", Const, 0}, + {"IPPROTO_SEND", Const, 1}, + {"IPPROTO_SEP", Const, 0}, + {"IPPROTO_SKIP", Const, 0}, + {"IPPROTO_SPACER", Const, 0}, + {"IPPROTO_SRPC", Const, 0}, + {"IPPROTO_ST", Const, 0}, + {"IPPROTO_SVMTP", Const, 0}, + {"IPPROTO_SWIPE", Const, 0}, + {"IPPROTO_TCF", Const, 0}, + {"IPPROTO_TCP", Const, 0}, + {"IPPROTO_TLSP", Const, 0}, + {"IPPROTO_TP", Const, 0}, + {"IPPROTO_TPXX", Const, 0}, + {"IPPROTO_TRUNK1", Const, 0}, + {"IPPROTO_TRUNK2", Const, 0}, + {"IPPROTO_TTP", Const, 0}, + {"IPPROTO_UDP", Const, 0}, + {"IPPROTO_UDPLITE", Const, 0}, + {"IPPROTO_VINES", Const, 0}, + {"IPPROTO_VISA", Const, 0}, + {"IPPROTO_VMTP", Const, 0}, + {"IPPROTO_VRRP", Const, 1}, + {"IPPROTO_WBEXPAK", Const, 0}, + {"IPPROTO_WBMON", Const, 0}, + {"IPPROTO_WSN", Const, 0}, + {"IPPROTO_XNET", Const, 0}, + {"IPPROTO_XTP", Const, 0}, + {"IPV6_2292DSTOPTS", Const, 0}, + {"IPV6_2292HOPLIMIT", Const, 0}, + {"IPV6_2292HOPOPTS", Const, 0}, + {"IPV6_2292NEXTHOP", Const, 0}, + {"IPV6_2292PKTINFO", Const, 0}, + {"IPV6_2292PKTOPTIONS", Const, 0}, + {"IPV6_2292RTHDR", Const, 0}, + {"IPV6_ADDRFORM", Const, 0}, + {"IPV6_ADD_MEMBERSHIP", Const, 0}, + {"IPV6_AUTHHDR", Const, 0}, + {"IPV6_AUTH_LEVEL", Const, 1}, + {"IPV6_AUTOFLOWLABEL", Const, 0}, + {"IPV6_BINDANY", Const, 0}, + {"IPV6_BINDV6ONLY", Const, 0}, + {"IPV6_BOUND_IF", Const, 0}, + {"IPV6_CHECKSUM", Const, 0}, + {"IPV6_DEFAULT_MULTICAST_HOPS", Const, 0}, + {"IPV6_DEFAULT_MULTICAST_LOOP", Const, 0}, + {"IPV6_DEFHLIM", Const, 0}, + {"IPV6_DONTFRAG", Const, 0}, + {"IPV6_DROP_MEMBERSHIP", Const, 0}, + {"IPV6_DSTOPTS", Const, 0}, + {"IPV6_ESP_NETWORK_LEVEL", Const, 1}, + {"IPV6_ESP_TRANS_LEVEL", Const, 1}, + {"IPV6_FAITH", Const, 0}, + {"IPV6_FLOWINFO_MASK", Const, 0}, + {"IPV6_FLOWLABEL_MASK", Const, 0}, + {"IPV6_FRAGTTL", Const, 0}, + {"IPV6_FW_ADD", Const, 0}, + {"IPV6_FW_DEL", Const, 0}, + {"IPV6_FW_FLUSH", Const, 0}, + {"IPV6_FW_GET", Const, 0}, + {"IPV6_FW_ZERO", Const, 0}, + {"IPV6_HLIMDEC", Const, 0}, + {"IPV6_HOPLIMIT", Const, 0}, + {"IPV6_HOPOPTS", Const, 0}, + {"IPV6_IPCOMP_LEVEL", Const, 1}, + {"IPV6_IPSEC_POLICY", Const, 0}, + {"IPV6_JOIN_ANYCAST", Const, 0}, + {"IPV6_JOIN_GROUP", Const, 0}, + {"IPV6_LEAVE_ANYCAST", Const, 0}, + {"IPV6_LEAVE_GROUP", Const, 0}, + {"IPV6_MAXHLIM", Const, 0}, + {"IPV6_MAXOPTHDR", Const, 0}, + {"IPV6_MAXPACKET", Const, 0}, + {"IPV6_MAX_GROUP_SRC_FILTER", Const, 0}, + {"IPV6_MAX_MEMBERSHIPS", Const, 0}, + {"IPV6_MAX_SOCK_SRC_FILTER", Const, 0}, + {"IPV6_MIN_MEMBERSHIPS", Const, 0}, + {"IPV6_MMTU", Const, 0}, + {"IPV6_MSFILTER", Const, 0}, + {"IPV6_MTU", Const, 0}, + {"IPV6_MTU_DISCOVER", Const, 0}, + {"IPV6_MULTICAST_HOPS", Const, 0}, + {"IPV6_MULTICAST_IF", Const, 0}, + {"IPV6_MULTICAST_LOOP", Const, 0}, + {"IPV6_NEXTHOP", Const, 0}, + {"IPV6_OPTIONS", Const, 1}, + {"IPV6_PATHMTU", Const, 0}, + {"IPV6_PIPEX", Const, 1}, + {"IPV6_PKTINFO", Const, 0}, + {"IPV6_PMTUDISC_DO", Const, 0}, + {"IPV6_PMTUDISC_DONT", Const, 0}, + {"IPV6_PMTUDISC_PROBE", Const, 0}, + {"IPV6_PMTUDISC_WANT", Const, 0}, + {"IPV6_PORTRANGE", Const, 0}, + {"IPV6_PORTRANGE_DEFAULT", Const, 0}, + {"IPV6_PORTRANGE_HIGH", Const, 0}, + {"IPV6_PORTRANGE_LOW", Const, 0}, + {"IPV6_PREFER_TEMPADDR", Const, 0}, + {"IPV6_RECVDSTOPTS", Const, 0}, + {"IPV6_RECVDSTPORT", Const, 3}, + {"IPV6_RECVERR", Const, 0}, + {"IPV6_RECVHOPLIMIT", Const, 0}, + {"IPV6_RECVHOPOPTS", Const, 0}, + {"IPV6_RECVPATHMTU", Const, 0}, + {"IPV6_RECVPKTINFO", Const, 0}, + {"IPV6_RECVRTHDR", Const, 0}, + {"IPV6_RECVTCLASS", Const, 0}, + {"IPV6_ROUTER_ALERT", Const, 0}, + {"IPV6_RTABLE", Const, 1}, + {"IPV6_RTHDR", Const, 0}, + {"IPV6_RTHDRDSTOPTS", Const, 0}, + {"IPV6_RTHDR_LOOSE", Const, 0}, + {"IPV6_RTHDR_STRICT", Const, 0}, + {"IPV6_RTHDR_TYPE_0", Const, 0}, + {"IPV6_RXDSTOPTS", Const, 0}, + {"IPV6_RXHOPOPTS", Const, 0}, + {"IPV6_SOCKOPT_RESERVED1", Const, 0}, + {"IPV6_TCLASS", Const, 0}, + {"IPV6_UNICAST_HOPS", Const, 0}, + {"IPV6_USE_MIN_MTU", Const, 0}, + {"IPV6_V6ONLY", Const, 0}, + {"IPV6_VERSION", Const, 0}, + {"IPV6_VERSION_MASK", Const, 0}, + {"IPV6_XFRM_POLICY", Const, 0}, + {"IP_ADD_MEMBERSHIP", Const, 0}, + {"IP_ADD_SOURCE_MEMBERSHIP", Const, 0}, + {"IP_AUTH_LEVEL", Const, 1}, + {"IP_BINDANY", Const, 0}, + {"IP_BLOCK_SOURCE", Const, 0}, + {"IP_BOUND_IF", Const, 0}, + {"IP_DEFAULT_MULTICAST_LOOP", Const, 0}, + {"IP_DEFAULT_MULTICAST_TTL", Const, 0}, + {"IP_DF", Const, 0}, + {"IP_DIVERTFL", Const, 3}, + {"IP_DONTFRAG", Const, 0}, + {"IP_DROP_MEMBERSHIP", Const, 0}, + {"IP_DROP_SOURCE_MEMBERSHIP", Const, 0}, + {"IP_DUMMYNET3", Const, 0}, + {"IP_DUMMYNET_CONFIGURE", Const, 0}, + {"IP_DUMMYNET_DEL", Const, 0}, + {"IP_DUMMYNET_FLUSH", Const, 0}, + {"IP_DUMMYNET_GET", Const, 0}, + {"IP_EF", Const, 1}, + {"IP_ERRORMTU", Const, 1}, + {"IP_ESP_NETWORK_LEVEL", Const, 1}, + {"IP_ESP_TRANS_LEVEL", Const, 1}, + {"IP_FAITH", Const, 0}, + {"IP_FREEBIND", Const, 0}, + {"IP_FW3", Const, 0}, + {"IP_FW_ADD", Const, 0}, + {"IP_FW_DEL", Const, 0}, + {"IP_FW_FLUSH", Const, 0}, + {"IP_FW_GET", Const, 0}, + {"IP_FW_NAT_CFG", Const, 0}, + {"IP_FW_NAT_DEL", Const, 0}, + {"IP_FW_NAT_GET_CONFIG", Const, 0}, + {"IP_FW_NAT_GET_LOG", Const, 0}, + {"IP_FW_RESETLOG", Const, 0}, + {"IP_FW_TABLE_ADD", Const, 0}, + {"IP_FW_TABLE_DEL", Const, 0}, + {"IP_FW_TABLE_FLUSH", Const, 0}, + {"IP_FW_TABLE_GETSIZE", Const, 0}, + {"IP_FW_TABLE_LIST", Const, 0}, + {"IP_FW_ZERO", Const, 0}, + {"IP_HDRINCL", Const, 0}, + {"IP_IPCOMP_LEVEL", Const, 1}, + {"IP_IPSECFLOWINFO", Const, 1}, + {"IP_IPSEC_LOCAL_AUTH", Const, 1}, + {"IP_IPSEC_LOCAL_CRED", Const, 1}, + {"IP_IPSEC_LOCAL_ID", Const, 1}, + {"IP_IPSEC_POLICY", Const, 0}, + {"IP_IPSEC_REMOTE_AUTH", Const, 1}, + {"IP_IPSEC_REMOTE_CRED", Const, 1}, + {"IP_IPSEC_REMOTE_ID", Const, 1}, + {"IP_MAXPACKET", Const, 0}, + {"IP_MAX_GROUP_SRC_FILTER", Const, 0}, + {"IP_MAX_MEMBERSHIPS", Const, 0}, + {"IP_MAX_SOCK_MUTE_FILTER", Const, 0}, + {"IP_MAX_SOCK_SRC_FILTER", Const, 0}, + {"IP_MAX_SOURCE_FILTER", Const, 0}, + {"IP_MF", Const, 0}, + {"IP_MINFRAGSIZE", Const, 1}, + {"IP_MINTTL", Const, 0}, + {"IP_MIN_MEMBERSHIPS", Const, 0}, + {"IP_MSFILTER", Const, 0}, + {"IP_MSS", Const, 0}, + {"IP_MTU", Const, 0}, + {"IP_MTU_DISCOVER", Const, 0}, + {"IP_MULTICAST_IF", Const, 0}, + {"IP_MULTICAST_IFINDEX", Const, 0}, + {"IP_MULTICAST_LOOP", Const, 0}, + {"IP_MULTICAST_TTL", Const, 0}, + {"IP_MULTICAST_VIF", Const, 0}, + {"IP_NAT__XXX", Const, 0}, + {"IP_OFFMASK", Const, 0}, + {"IP_OLD_FW_ADD", Const, 0}, + {"IP_OLD_FW_DEL", Const, 0}, + {"IP_OLD_FW_FLUSH", Const, 0}, + {"IP_OLD_FW_GET", Const, 0}, + {"IP_OLD_FW_RESETLOG", Const, 0}, + {"IP_OLD_FW_ZERO", Const, 0}, + {"IP_ONESBCAST", Const, 0}, + {"IP_OPTIONS", Const, 0}, + {"IP_ORIGDSTADDR", Const, 0}, + {"IP_PASSSEC", Const, 0}, + {"IP_PIPEX", Const, 1}, + {"IP_PKTINFO", Const, 0}, + {"IP_PKTOPTIONS", Const, 0}, + {"IP_PMTUDISC", Const, 0}, + {"IP_PMTUDISC_DO", Const, 0}, + {"IP_PMTUDISC_DONT", Const, 0}, + {"IP_PMTUDISC_PROBE", Const, 0}, + {"IP_PMTUDISC_WANT", Const, 0}, + {"IP_PORTRANGE", Const, 0}, + {"IP_PORTRANGE_DEFAULT", Const, 0}, + {"IP_PORTRANGE_HIGH", Const, 0}, + {"IP_PORTRANGE_LOW", Const, 0}, + {"IP_RECVDSTADDR", Const, 0}, + {"IP_RECVDSTPORT", Const, 1}, + {"IP_RECVERR", Const, 0}, + {"IP_RECVIF", Const, 0}, + {"IP_RECVOPTS", Const, 0}, + {"IP_RECVORIGDSTADDR", Const, 0}, + {"IP_RECVPKTINFO", Const, 0}, + {"IP_RECVRETOPTS", Const, 0}, + {"IP_RECVRTABLE", Const, 1}, + {"IP_RECVTOS", Const, 0}, + {"IP_RECVTTL", Const, 0}, + {"IP_RETOPTS", Const, 0}, + {"IP_RF", Const, 0}, + {"IP_ROUTER_ALERT", Const, 0}, + {"IP_RSVP_OFF", Const, 0}, + {"IP_RSVP_ON", Const, 0}, + {"IP_RSVP_VIF_OFF", Const, 0}, + {"IP_RSVP_VIF_ON", Const, 0}, + {"IP_RTABLE", Const, 1}, + {"IP_SENDSRCADDR", Const, 0}, + {"IP_STRIPHDR", Const, 0}, + {"IP_TOS", Const, 0}, + {"IP_TRAFFIC_MGT_BACKGROUND", Const, 0}, + {"IP_TRANSPARENT", Const, 0}, + {"IP_TTL", Const, 0}, + {"IP_UNBLOCK_SOURCE", Const, 0}, + {"IP_XFRM_POLICY", Const, 0}, + {"IPv6MTUInfo", Type, 2}, + {"IPv6MTUInfo.Addr", Field, 2}, + {"IPv6MTUInfo.Mtu", Field, 2}, + {"IPv6Mreq", Type, 0}, + {"IPv6Mreq.Interface", Field, 0}, + {"IPv6Mreq.Multiaddr", Field, 0}, + {"ISIG", Const, 0}, + {"ISTRIP", Const, 0}, + {"IUCLC", Const, 0}, + {"IUTF8", Const, 0}, + {"IXANY", Const, 0}, + {"IXOFF", Const, 0}, + {"IXON", Const, 0}, + {"IfAddrmsg", Type, 0}, + {"IfAddrmsg.Family", Field, 0}, + {"IfAddrmsg.Flags", Field, 0}, + {"IfAddrmsg.Index", Field, 0}, + {"IfAddrmsg.Prefixlen", Field, 0}, + {"IfAddrmsg.Scope", Field, 0}, + {"IfAnnounceMsghdr", Type, 1}, + {"IfAnnounceMsghdr.Hdrlen", Field, 2}, + {"IfAnnounceMsghdr.Index", Field, 1}, + {"IfAnnounceMsghdr.Msglen", Field, 1}, + {"IfAnnounceMsghdr.Name", Field, 1}, + {"IfAnnounceMsghdr.Type", Field, 1}, + {"IfAnnounceMsghdr.Version", Field, 1}, + {"IfAnnounceMsghdr.What", Field, 1}, + {"IfData", Type, 0}, + {"IfData.Addrlen", Field, 0}, + {"IfData.Baudrate", Field, 0}, + {"IfData.Capabilities", Field, 2}, + {"IfData.Collisions", Field, 0}, + {"IfData.Datalen", Field, 0}, + {"IfData.Epoch", Field, 0}, + {"IfData.Hdrlen", Field, 0}, + {"IfData.Hwassist", Field, 0}, + {"IfData.Ibytes", Field, 0}, + {"IfData.Ierrors", Field, 0}, + {"IfData.Imcasts", Field, 0}, + {"IfData.Ipackets", Field, 0}, + {"IfData.Iqdrops", Field, 0}, + {"IfData.Lastchange", Field, 0}, + {"IfData.Link_state", Field, 0}, + {"IfData.Mclpool", Field, 2}, + {"IfData.Metric", Field, 0}, + {"IfData.Mtu", Field, 0}, + {"IfData.Noproto", Field, 0}, + {"IfData.Obytes", Field, 0}, + {"IfData.Oerrors", Field, 0}, + {"IfData.Omcasts", Field, 0}, + {"IfData.Opackets", Field, 0}, + {"IfData.Pad", Field, 2}, + {"IfData.Pad_cgo_0", Field, 2}, + {"IfData.Pad_cgo_1", Field, 2}, + {"IfData.Physical", Field, 0}, + {"IfData.Recvquota", Field, 0}, + {"IfData.Recvtiming", Field, 0}, + {"IfData.Reserved1", Field, 0}, + {"IfData.Reserved2", Field, 0}, + {"IfData.Spare_char1", Field, 0}, + {"IfData.Spare_char2", Field, 0}, + {"IfData.Type", Field, 0}, + {"IfData.Typelen", Field, 0}, + {"IfData.Unused1", Field, 0}, + {"IfData.Unused2", Field, 0}, + {"IfData.Xmitquota", Field, 0}, + {"IfData.Xmittiming", Field, 0}, + {"IfInfomsg", Type, 0}, + {"IfInfomsg.Change", Field, 0}, + {"IfInfomsg.Family", Field, 0}, + {"IfInfomsg.Flags", Field, 0}, + {"IfInfomsg.Index", Field, 0}, + {"IfInfomsg.Type", Field, 0}, + {"IfInfomsg.X__ifi_pad", Field, 0}, + {"IfMsghdr", Type, 0}, + {"IfMsghdr.Addrs", Field, 0}, + {"IfMsghdr.Data", Field, 0}, + {"IfMsghdr.Flags", Field, 0}, + {"IfMsghdr.Hdrlen", Field, 2}, + {"IfMsghdr.Index", Field, 0}, + {"IfMsghdr.Msglen", Field, 0}, + {"IfMsghdr.Pad1", Field, 2}, + {"IfMsghdr.Pad2", Field, 2}, + {"IfMsghdr.Pad_cgo_0", Field, 0}, + {"IfMsghdr.Pad_cgo_1", Field, 2}, + {"IfMsghdr.Tableid", Field, 2}, + {"IfMsghdr.Type", Field, 0}, + {"IfMsghdr.Version", Field, 0}, + {"IfMsghdr.Xflags", Field, 2}, + {"IfaMsghdr", Type, 0}, + {"IfaMsghdr.Addrs", Field, 0}, + {"IfaMsghdr.Flags", Field, 0}, + {"IfaMsghdr.Hdrlen", Field, 2}, + {"IfaMsghdr.Index", Field, 0}, + {"IfaMsghdr.Metric", Field, 0}, + {"IfaMsghdr.Msglen", Field, 0}, + {"IfaMsghdr.Pad1", Field, 2}, + {"IfaMsghdr.Pad2", Field, 2}, + {"IfaMsghdr.Pad_cgo_0", Field, 0}, + {"IfaMsghdr.Tableid", Field, 2}, + {"IfaMsghdr.Type", Field, 0}, + {"IfaMsghdr.Version", Field, 0}, + {"IfmaMsghdr", Type, 0}, + {"IfmaMsghdr.Addrs", Field, 0}, + {"IfmaMsghdr.Flags", Field, 0}, + {"IfmaMsghdr.Index", Field, 0}, + {"IfmaMsghdr.Msglen", Field, 0}, + {"IfmaMsghdr.Pad_cgo_0", Field, 0}, + {"IfmaMsghdr.Type", Field, 0}, + {"IfmaMsghdr.Version", Field, 0}, + {"IfmaMsghdr2", Type, 0}, + {"IfmaMsghdr2.Addrs", Field, 0}, + {"IfmaMsghdr2.Flags", Field, 0}, + {"IfmaMsghdr2.Index", Field, 0}, + {"IfmaMsghdr2.Msglen", Field, 0}, + {"IfmaMsghdr2.Pad_cgo_0", Field, 0}, + {"IfmaMsghdr2.Refcount", Field, 0}, + {"IfmaMsghdr2.Type", Field, 0}, + {"IfmaMsghdr2.Version", Field, 0}, + {"ImplementsGetwd", Const, 0}, + {"Inet4Pktinfo", Type, 0}, + {"Inet4Pktinfo.Addr", Field, 0}, + {"Inet4Pktinfo.Ifindex", Field, 0}, + {"Inet4Pktinfo.Spec_dst", Field, 0}, + {"Inet6Pktinfo", Type, 0}, + {"Inet6Pktinfo.Addr", Field, 0}, + {"Inet6Pktinfo.Ifindex", Field, 0}, + {"InotifyAddWatch", Func, 0}, + {"InotifyEvent", Type, 0}, + {"InotifyEvent.Cookie", Field, 0}, + {"InotifyEvent.Len", Field, 0}, + {"InotifyEvent.Mask", Field, 0}, + {"InotifyEvent.Name", Field, 0}, + {"InotifyEvent.Wd", Field, 0}, + {"InotifyInit", Func, 0}, + {"InotifyInit1", Func, 0}, + {"InotifyRmWatch", Func, 0}, + {"InterfaceAddrMessage", Type, 0}, + {"InterfaceAddrMessage.Data", Field, 0}, + {"InterfaceAddrMessage.Header", Field, 0}, + {"InterfaceAnnounceMessage", Type, 1}, + {"InterfaceAnnounceMessage.Header", Field, 1}, + {"InterfaceInfo", Type, 0}, + {"InterfaceInfo.Address", Field, 0}, + {"InterfaceInfo.BroadcastAddress", Field, 0}, + {"InterfaceInfo.Flags", Field, 0}, + {"InterfaceInfo.Netmask", Field, 0}, + {"InterfaceMessage", Type, 0}, + {"InterfaceMessage.Data", Field, 0}, + {"InterfaceMessage.Header", Field, 0}, + {"InterfaceMulticastAddrMessage", Type, 0}, + {"InterfaceMulticastAddrMessage.Data", Field, 0}, + {"InterfaceMulticastAddrMessage.Header", Field, 0}, + {"InvalidHandle", Const, 0}, + {"Ioperm", Func, 0}, + {"Iopl", Func, 0}, + {"Iovec", Type, 0}, + {"Iovec.Base", Field, 0}, + {"Iovec.Len", Field, 0}, + {"IpAdapterInfo", Type, 0}, + {"IpAdapterInfo.AdapterName", Field, 0}, + {"IpAdapterInfo.Address", Field, 0}, + {"IpAdapterInfo.AddressLength", Field, 0}, + {"IpAdapterInfo.ComboIndex", Field, 0}, + {"IpAdapterInfo.CurrentIpAddress", Field, 0}, + {"IpAdapterInfo.Description", Field, 0}, + {"IpAdapterInfo.DhcpEnabled", Field, 0}, + {"IpAdapterInfo.DhcpServer", Field, 0}, + {"IpAdapterInfo.GatewayList", Field, 0}, + {"IpAdapterInfo.HaveWins", Field, 0}, + {"IpAdapterInfo.Index", Field, 0}, + {"IpAdapterInfo.IpAddressList", Field, 0}, + {"IpAdapterInfo.LeaseExpires", Field, 0}, + {"IpAdapterInfo.LeaseObtained", Field, 0}, + {"IpAdapterInfo.Next", Field, 0}, + {"IpAdapterInfo.PrimaryWinsServer", Field, 0}, + {"IpAdapterInfo.SecondaryWinsServer", Field, 0}, + {"IpAdapterInfo.Type", Field, 0}, + {"IpAddrString", Type, 0}, + {"IpAddrString.Context", Field, 0}, + {"IpAddrString.IpAddress", Field, 0}, + {"IpAddrString.IpMask", Field, 0}, + {"IpAddrString.Next", Field, 0}, + {"IpAddressString", Type, 0}, + {"IpAddressString.String", Field, 0}, + {"IpMaskString", Type, 0}, + {"IpMaskString.String", Field, 2}, + {"Issetugid", Func, 0}, + {"KEY_ALL_ACCESS", Const, 0}, + {"KEY_CREATE_LINK", Const, 0}, + {"KEY_CREATE_SUB_KEY", Const, 0}, + {"KEY_ENUMERATE_SUB_KEYS", Const, 0}, + {"KEY_EXECUTE", Const, 0}, + {"KEY_NOTIFY", Const, 0}, + {"KEY_QUERY_VALUE", Const, 0}, + {"KEY_READ", Const, 0}, + {"KEY_SET_VALUE", Const, 0}, + {"KEY_WOW64_32KEY", Const, 0}, + {"KEY_WOW64_64KEY", Const, 0}, + {"KEY_WRITE", Const, 0}, + {"Kevent", Func, 0}, + {"Kevent_t", Type, 0}, + {"Kevent_t.Data", Field, 0}, + {"Kevent_t.Fflags", Field, 0}, + {"Kevent_t.Filter", Field, 0}, + {"Kevent_t.Flags", Field, 0}, + {"Kevent_t.Ident", Field, 0}, + {"Kevent_t.Pad_cgo_0", Field, 2}, + {"Kevent_t.Udata", Field, 0}, + {"Kill", Func, 0}, + {"Klogctl", Func, 0}, + {"Kqueue", Func, 0}, + {"LANG_ENGLISH", Const, 0}, + {"LAYERED_PROTOCOL", Const, 2}, + {"LCNT_OVERLOAD_FLUSH", Const, 1}, + {"LINUX_REBOOT_CMD_CAD_OFF", Const, 0}, + {"LINUX_REBOOT_CMD_CAD_ON", Const, 0}, + {"LINUX_REBOOT_CMD_HALT", Const, 0}, + {"LINUX_REBOOT_CMD_KEXEC", Const, 0}, + {"LINUX_REBOOT_CMD_POWER_OFF", Const, 0}, + {"LINUX_REBOOT_CMD_RESTART", Const, 0}, + {"LINUX_REBOOT_CMD_RESTART2", Const, 0}, + {"LINUX_REBOOT_CMD_SW_SUSPEND", Const, 0}, + {"LINUX_REBOOT_MAGIC1", Const, 0}, + {"LINUX_REBOOT_MAGIC2", Const, 0}, + {"LOCK_EX", Const, 0}, + {"LOCK_NB", Const, 0}, + {"LOCK_SH", Const, 0}, + {"LOCK_UN", Const, 0}, + {"LazyDLL", Type, 0}, + {"LazyDLL.Name", Field, 0}, + {"LazyProc", Type, 0}, + {"LazyProc.Name", Field, 0}, + {"Lchown", Func, 0}, + {"Linger", Type, 0}, + {"Linger.Linger", Field, 0}, + {"Linger.Onoff", Field, 0}, + {"Link", Func, 0}, + {"Listen", Func, 0}, + {"Listxattr", Func, 1}, + {"LoadCancelIoEx", Func, 1}, + {"LoadConnectEx", Func, 1}, + {"LoadCreateSymbolicLink", Func, 4}, + {"LoadDLL", Func, 0}, + {"LoadGetAddrInfo", Func, 1}, + {"LoadLibrary", Func, 0}, + {"LoadSetFileCompletionNotificationModes", Func, 2}, + {"LocalFree", Func, 0}, + {"Log2phys_t", Type, 0}, + {"Log2phys_t.Contigbytes", Field, 0}, + {"Log2phys_t.Devoffset", Field, 0}, + {"Log2phys_t.Flags", Field, 0}, + {"LookupAccountName", Func, 0}, + {"LookupAccountSid", Func, 0}, + {"LookupSID", Func, 0}, + {"LsfJump", Func, 0}, + {"LsfSocket", Func, 0}, + {"LsfStmt", Func, 0}, + {"Lstat", Func, 0}, + {"MADV_AUTOSYNC", Const, 1}, + {"MADV_CAN_REUSE", Const, 0}, + {"MADV_CORE", Const, 1}, + {"MADV_DOFORK", Const, 0}, + {"MADV_DONTFORK", Const, 0}, + {"MADV_DONTNEED", Const, 0}, + {"MADV_FREE", Const, 0}, + {"MADV_FREE_REUSABLE", Const, 0}, + {"MADV_FREE_REUSE", Const, 0}, + {"MADV_HUGEPAGE", Const, 0}, + {"MADV_HWPOISON", Const, 0}, + {"MADV_MERGEABLE", Const, 0}, + {"MADV_NOCORE", Const, 1}, + {"MADV_NOHUGEPAGE", Const, 0}, + {"MADV_NORMAL", Const, 0}, + {"MADV_NOSYNC", Const, 1}, + {"MADV_PROTECT", Const, 1}, + {"MADV_RANDOM", Const, 0}, + {"MADV_REMOVE", Const, 0}, + {"MADV_SEQUENTIAL", Const, 0}, + {"MADV_SPACEAVAIL", Const, 3}, + {"MADV_UNMERGEABLE", Const, 0}, + {"MADV_WILLNEED", Const, 0}, + {"MADV_ZERO_WIRED_PAGES", Const, 0}, + {"MAP_32BIT", Const, 0}, + {"MAP_ALIGNED_SUPER", Const, 3}, + {"MAP_ALIGNMENT_16MB", Const, 3}, + {"MAP_ALIGNMENT_1TB", Const, 3}, + {"MAP_ALIGNMENT_256TB", Const, 3}, + {"MAP_ALIGNMENT_4GB", Const, 3}, + {"MAP_ALIGNMENT_64KB", Const, 3}, + {"MAP_ALIGNMENT_64PB", Const, 3}, + {"MAP_ALIGNMENT_MASK", Const, 3}, + {"MAP_ALIGNMENT_SHIFT", Const, 3}, + {"MAP_ANON", Const, 0}, + {"MAP_ANONYMOUS", Const, 0}, + {"MAP_COPY", Const, 0}, + {"MAP_DENYWRITE", Const, 0}, + {"MAP_EXECUTABLE", Const, 0}, + {"MAP_FILE", Const, 0}, + {"MAP_FIXED", Const, 0}, + {"MAP_FLAGMASK", Const, 3}, + {"MAP_GROWSDOWN", Const, 0}, + {"MAP_HASSEMAPHORE", Const, 0}, + {"MAP_HUGETLB", Const, 0}, + {"MAP_INHERIT", Const, 3}, + {"MAP_INHERIT_COPY", Const, 3}, + {"MAP_INHERIT_DEFAULT", Const, 3}, + {"MAP_INHERIT_DONATE_COPY", Const, 3}, + {"MAP_INHERIT_NONE", Const, 3}, + {"MAP_INHERIT_SHARE", Const, 3}, + {"MAP_JIT", Const, 0}, + {"MAP_LOCKED", Const, 0}, + {"MAP_NOCACHE", Const, 0}, + {"MAP_NOCORE", Const, 1}, + {"MAP_NOEXTEND", Const, 0}, + {"MAP_NONBLOCK", Const, 0}, + {"MAP_NORESERVE", Const, 0}, + {"MAP_NOSYNC", Const, 1}, + {"MAP_POPULATE", Const, 0}, + {"MAP_PREFAULT_READ", Const, 1}, + {"MAP_PRIVATE", Const, 0}, + {"MAP_RENAME", Const, 0}, + {"MAP_RESERVED0080", Const, 0}, + {"MAP_RESERVED0100", Const, 1}, + {"MAP_SHARED", Const, 0}, + {"MAP_STACK", Const, 0}, + {"MAP_TRYFIXED", Const, 3}, + {"MAP_TYPE", Const, 0}, + {"MAP_WIRED", Const, 3}, + {"MAXIMUM_REPARSE_DATA_BUFFER_SIZE", Const, 4}, + {"MAXLEN_IFDESCR", Const, 0}, + {"MAXLEN_PHYSADDR", Const, 0}, + {"MAX_ADAPTER_ADDRESS_LENGTH", Const, 0}, + {"MAX_ADAPTER_DESCRIPTION_LENGTH", Const, 0}, + {"MAX_ADAPTER_NAME_LENGTH", Const, 0}, + {"MAX_COMPUTERNAME_LENGTH", Const, 0}, + {"MAX_INTERFACE_NAME_LEN", Const, 0}, + {"MAX_LONG_PATH", Const, 0}, + {"MAX_PATH", Const, 0}, + {"MAX_PROTOCOL_CHAIN", Const, 2}, + {"MCL_CURRENT", Const, 0}, + {"MCL_FUTURE", Const, 0}, + {"MNT_DETACH", Const, 0}, + {"MNT_EXPIRE", Const, 0}, + {"MNT_FORCE", Const, 0}, + {"MSG_BCAST", Const, 1}, + {"MSG_CMSG_CLOEXEC", Const, 0}, + {"MSG_COMPAT", Const, 0}, + {"MSG_CONFIRM", Const, 0}, + {"MSG_CONTROLMBUF", Const, 1}, + {"MSG_CTRUNC", Const, 0}, + {"MSG_DONTROUTE", Const, 0}, + {"MSG_DONTWAIT", Const, 0}, + {"MSG_EOF", Const, 0}, + {"MSG_EOR", Const, 0}, + {"MSG_ERRQUEUE", Const, 0}, + {"MSG_FASTOPEN", Const, 1}, + {"MSG_FIN", Const, 0}, + {"MSG_FLUSH", Const, 0}, + {"MSG_HAVEMORE", Const, 0}, + {"MSG_HOLD", Const, 0}, + {"MSG_IOVUSRSPACE", Const, 1}, + {"MSG_LENUSRSPACE", Const, 1}, + {"MSG_MCAST", Const, 1}, + {"MSG_MORE", Const, 0}, + {"MSG_NAMEMBUF", Const, 1}, + {"MSG_NBIO", Const, 0}, + {"MSG_NEEDSA", Const, 0}, + {"MSG_NOSIGNAL", Const, 0}, + {"MSG_NOTIFICATION", Const, 0}, + {"MSG_OOB", Const, 0}, + {"MSG_PEEK", Const, 0}, + {"MSG_PROXY", Const, 0}, + {"MSG_RCVMORE", Const, 0}, + {"MSG_RST", Const, 0}, + {"MSG_SEND", Const, 0}, + {"MSG_SYN", Const, 0}, + {"MSG_TRUNC", Const, 0}, + {"MSG_TRYHARD", Const, 0}, + {"MSG_USERFLAGS", Const, 1}, + {"MSG_WAITALL", Const, 0}, + {"MSG_WAITFORONE", Const, 0}, + {"MSG_WAITSTREAM", Const, 0}, + {"MS_ACTIVE", Const, 0}, + {"MS_ASYNC", Const, 0}, + {"MS_BIND", Const, 0}, + {"MS_DEACTIVATE", Const, 0}, + {"MS_DIRSYNC", Const, 0}, + {"MS_INVALIDATE", Const, 0}, + {"MS_I_VERSION", Const, 0}, + {"MS_KERNMOUNT", Const, 0}, + {"MS_KILLPAGES", Const, 0}, + {"MS_MANDLOCK", Const, 0}, + {"MS_MGC_MSK", Const, 0}, + {"MS_MGC_VAL", Const, 0}, + {"MS_MOVE", Const, 0}, + {"MS_NOATIME", Const, 0}, + {"MS_NODEV", Const, 0}, + {"MS_NODIRATIME", Const, 0}, + {"MS_NOEXEC", Const, 0}, + {"MS_NOSUID", Const, 0}, + {"MS_NOUSER", Const, 0}, + {"MS_POSIXACL", Const, 0}, + {"MS_PRIVATE", Const, 0}, + {"MS_RDONLY", Const, 0}, + {"MS_REC", Const, 0}, + {"MS_RELATIME", Const, 0}, + {"MS_REMOUNT", Const, 0}, + {"MS_RMT_MASK", Const, 0}, + {"MS_SHARED", Const, 0}, + {"MS_SILENT", Const, 0}, + {"MS_SLAVE", Const, 0}, + {"MS_STRICTATIME", Const, 0}, + {"MS_SYNC", Const, 0}, + {"MS_SYNCHRONOUS", Const, 0}, + {"MS_UNBINDABLE", Const, 0}, + {"Madvise", Func, 0}, + {"MapViewOfFile", Func, 0}, + {"MaxTokenInfoClass", Const, 0}, + {"Mclpool", Type, 2}, + {"Mclpool.Alive", Field, 2}, + {"Mclpool.Cwm", Field, 2}, + {"Mclpool.Grown", Field, 2}, + {"Mclpool.Hwm", Field, 2}, + {"Mclpool.Lwm", Field, 2}, + {"MibIfRow", Type, 0}, + {"MibIfRow.AdminStatus", Field, 0}, + {"MibIfRow.Descr", Field, 0}, + {"MibIfRow.DescrLen", Field, 0}, + {"MibIfRow.InDiscards", Field, 0}, + {"MibIfRow.InErrors", Field, 0}, + {"MibIfRow.InNUcastPkts", Field, 0}, + {"MibIfRow.InOctets", Field, 0}, + {"MibIfRow.InUcastPkts", Field, 0}, + {"MibIfRow.InUnknownProtos", Field, 0}, + {"MibIfRow.Index", Field, 0}, + {"MibIfRow.LastChange", Field, 0}, + {"MibIfRow.Mtu", Field, 0}, + {"MibIfRow.Name", Field, 0}, + {"MibIfRow.OperStatus", Field, 0}, + {"MibIfRow.OutDiscards", Field, 0}, + {"MibIfRow.OutErrors", Field, 0}, + {"MibIfRow.OutNUcastPkts", Field, 0}, + {"MibIfRow.OutOctets", Field, 0}, + {"MibIfRow.OutQLen", Field, 0}, + {"MibIfRow.OutUcastPkts", Field, 0}, + {"MibIfRow.PhysAddr", Field, 0}, + {"MibIfRow.PhysAddrLen", Field, 0}, + {"MibIfRow.Speed", Field, 0}, + {"MibIfRow.Type", Field, 0}, + {"Mkdir", Func, 0}, + {"Mkdirat", Func, 0}, + {"Mkfifo", Func, 0}, + {"Mknod", Func, 0}, + {"Mknodat", Func, 0}, + {"Mlock", Func, 0}, + {"Mlockall", Func, 0}, + {"Mmap", Func, 0}, + {"Mount", Func, 0}, + {"MoveFile", Func, 0}, + {"Mprotect", Func, 0}, + {"Msghdr", Type, 0}, + {"Msghdr.Control", Field, 0}, + {"Msghdr.Controllen", Field, 0}, + {"Msghdr.Flags", Field, 0}, + {"Msghdr.Iov", Field, 0}, + {"Msghdr.Iovlen", Field, 0}, + {"Msghdr.Name", Field, 0}, + {"Msghdr.Namelen", Field, 0}, + {"Msghdr.Pad_cgo_0", Field, 0}, + {"Msghdr.Pad_cgo_1", Field, 0}, + {"Munlock", Func, 0}, + {"Munlockall", Func, 0}, + {"Munmap", Func, 0}, + {"MustLoadDLL", Func, 0}, + {"NAME_MAX", Const, 0}, + {"NETLINK_ADD_MEMBERSHIP", Const, 0}, + {"NETLINK_AUDIT", Const, 0}, + {"NETLINK_BROADCAST_ERROR", Const, 0}, + {"NETLINK_CONNECTOR", Const, 0}, + {"NETLINK_DNRTMSG", Const, 0}, + {"NETLINK_DROP_MEMBERSHIP", Const, 0}, + {"NETLINK_ECRYPTFS", Const, 0}, + {"NETLINK_FIB_LOOKUP", Const, 0}, + {"NETLINK_FIREWALL", Const, 0}, + {"NETLINK_GENERIC", Const, 0}, + {"NETLINK_INET_DIAG", Const, 0}, + {"NETLINK_IP6_FW", Const, 0}, + {"NETLINK_ISCSI", Const, 0}, + {"NETLINK_KOBJECT_UEVENT", Const, 0}, + {"NETLINK_NETFILTER", Const, 0}, + {"NETLINK_NFLOG", Const, 0}, + {"NETLINK_NO_ENOBUFS", Const, 0}, + {"NETLINK_PKTINFO", Const, 0}, + {"NETLINK_RDMA", Const, 0}, + {"NETLINK_ROUTE", Const, 0}, + {"NETLINK_SCSITRANSPORT", Const, 0}, + {"NETLINK_SELINUX", Const, 0}, + {"NETLINK_UNUSED", Const, 0}, + {"NETLINK_USERSOCK", Const, 0}, + {"NETLINK_XFRM", Const, 0}, + {"NET_RT_DUMP", Const, 0}, + {"NET_RT_DUMP2", Const, 0}, + {"NET_RT_FLAGS", Const, 0}, + {"NET_RT_IFLIST", Const, 0}, + {"NET_RT_IFLIST2", Const, 0}, + {"NET_RT_IFLISTL", Const, 1}, + {"NET_RT_IFMALIST", Const, 0}, + {"NET_RT_MAXID", Const, 0}, + {"NET_RT_OIFLIST", Const, 1}, + {"NET_RT_OOIFLIST", Const, 1}, + {"NET_RT_STAT", Const, 0}, + {"NET_RT_STATS", Const, 1}, + {"NET_RT_TABLE", Const, 1}, + {"NET_RT_TRASH", Const, 0}, + {"NLA_ALIGNTO", Const, 0}, + {"NLA_F_NESTED", Const, 0}, + {"NLA_F_NET_BYTEORDER", Const, 0}, + {"NLA_HDRLEN", Const, 0}, + {"NLMSG_ALIGNTO", Const, 0}, + {"NLMSG_DONE", Const, 0}, + {"NLMSG_ERROR", Const, 0}, + {"NLMSG_HDRLEN", Const, 0}, + {"NLMSG_MIN_TYPE", Const, 0}, + {"NLMSG_NOOP", Const, 0}, + {"NLMSG_OVERRUN", Const, 0}, + {"NLM_F_ACK", Const, 0}, + {"NLM_F_APPEND", Const, 0}, + {"NLM_F_ATOMIC", Const, 0}, + {"NLM_F_CREATE", Const, 0}, + {"NLM_F_DUMP", Const, 0}, + {"NLM_F_ECHO", Const, 0}, + {"NLM_F_EXCL", Const, 0}, + {"NLM_F_MATCH", Const, 0}, + {"NLM_F_MULTI", Const, 0}, + {"NLM_F_REPLACE", Const, 0}, + {"NLM_F_REQUEST", Const, 0}, + {"NLM_F_ROOT", Const, 0}, + {"NOFLSH", Const, 0}, + {"NOTE_ABSOLUTE", Const, 0}, + {"NOTE_ATTRIB", Const, 0}, + {"NOTE_BACKGROUND", Const, 16}, + {"NOTE_CHILD", Const, 0}, + {"NOTE_CRITICAL", Const, 16}, + {"NOTE_DELETE", Const, 0}, + {"NOTE_EOF", Const, 1}, + {"NOTE_EXEC", Const, 0}, + {"NOTE_EXIT", Const, 0}, + {"NOTE_EXITSTATUS", Const, 0}, + {"NOTE_EXIT_CSERROR", Const, 16}, + {"NOTE_EXIT_DECRYPTFAIL", Const, 16}, + {"NOTE_EXIT_DETAIL", Const, 16}, + {"NOTE_EXIT_DETAIL_MASK", Const, 16}, + {"NOTE_EXIT_MEMORY", Const, 16}, + {"NOTE_EXIT_REPARENTED", Const, 16}, + {"NOTE_EXTEND", Const, 0}, + {"NOTE_FFAND", Const, 0}, + {"NOTE_FFCOPY", Const, 0}, + {"NOTE_FFCTRLMASK", Const, 0}, + {"NOTE_FFLAGSMASK", Const, 0}, + {"NOTE_FFNOP", Const, 0}, + {"NOTE_FFOR", Const, 0}, + {"NOTE_FORK", Const, 0}, + {"NOTE_LEEWAY", Const, 16}, + {"NOTE_LINK", Const, 0}, + {"NOTE_LOWAT", Const, 0}, + {"NOTE_NONE", Const, 0}, + {"NOTE_NSECONDS", Const, 0}, + {"NOTE_PCTRLMASK", Const, 0}, + {"NOTE_PDATAMASK", Const, 0}, + {"NOTE_REAP", Const, 0}, + {"NOTE_RENAME", Const, 0}, + {"NOTE_RESOURCEEND", Const, 0}, + {"NOTE_REVOKE", Const, 0}, + {"NOTE_SECONDS", Const, 0}, + {"NOTE_SIGNAL", Const, 0}, + {"NOTE_TRACK", Const, 0}, + {"NOTE_TRACKERR", Const, 0}, + {"NOTE_TRIGGER", Const, 0}, + {"NOTE_TRUNCATE", Const, 1}, + {"NOTE_USECONDS", Const, 0}, + {"NOTE_VM_ERROR", Const, 0}, + {"NOTE_VM_PRESSURE", Const, 0}, + {"NOTE_VM_PRESSURE_SUDDEN_TERMINATE", Const, 0}, + {"NOTE_VM_PRESSURE_TERMINATE", Const, 0}, + {"NOTE_WRITE", Const, 0}, + {"NameCanonical", Const, 0}, + {"NameCanonicalEx", Const, 0}, + {"NameDisplay", Const, 0}, + {"NameDnsDomain", Const, 0}, + {"NameFullyQualifiedDN", Const, 0}, + {"NameSamCompatible", Const, 0}, + {"NameServicePrincipal", Const, 0}, + {"NameUniqueId", Const, 0}, + {"NameUnknown", Const, 0}, + {"NameUserPrincipal", Const, 0}, + {"Nanosleep", Func, 0}, + {"NetApiBufferFree", Func, 0}, + {"NetGetJoinInformation", Func, 2}, + {"NetSetupDomainName", Const, 2}, + {"NetSetupUnjoined", Const, 2}, + {"NetSetupUnknownStatus", Const, 2}, + {"NetSetupWorkgroupName", Const, 2}, + {"NetUserGetInfo", Func, 0}, + {"NetlinkMessage", Type, 0}, + {"NetlinkMessage.Data", Field, 0}, + {"NetlinkMessage.Header", Field, 0}, + {"NetlinkRIB", Func, 0}, + {"NetlinkRouteAttr", Type, 0}, + {"NetlinkRouteAttr.Attr", Field, 0}, + {"NetlinkRouteAttr.Value", Field, 0}, + {"NetlinkRouteRequest", Type, 0}, + {"NetlinkRouteRequest.Data", Field, 0}, + {"NetlinkRouteRequest.Header", Field, 0}, + {"NewCallback", Func, 0}, + {"NewCallbackCDecl", Func, 3}, + {"NewLazyDLL", Func, 0}, + {"NlAttr", Type, 0}, + {"NlAttr.Len", Field, 0}, + {"NlAttr.Type", Field, 0}, + {"NlMsgerr", Type, 0}, + {"NlMsgerr.Error", Field, 0}, + {"NlMsgerr.Msg", Field, 0}, + {"NlMsghdr", Type, 0}, + {"NlMsghdr.Flags", Field, 0}, + {"NlMsghdr.Len", Field, 0}, + {"NlMsghdr.Pid", Field, 0}, + {"NlMsghdr.Seq", Field, 0}, + {"NlMsghdr.Type", Field, 0}, + {"NsecToFiletime", Func, 0}, + {"NsecToTimespec", Func, 0}, + {"NsecToTimeval", Func, 0}, + {"Ntohs", Func, 0}, + {"OCRNL", Const, 0}, + {"OFDEL", Const, 0}, + {"OFILL", Const, 0}, + {"OFIOGETBMAP", Const, 1}, + {"OID_PKIX_KP_SERVER_AUTH", Var, 0}, + {"OID_SERVER_GATED_CRYPTO", Var, 0}, + {"OID_SGC_NETSCAPE", Var, 0}, + {"OLCUC", Const, 0}, + {"ONLCR", Const, 0}, + {"ONLRET", Const, 0}, + {"ONOCR", Const, 0}, + {"ONOEOT", Const, 1}, + {"OPEN_ALWAYS", Const, 0}, + {"OPEN_EXISTING", Const, 0}, + {"OPOST", Const, 0}, + {"O_ACCMODE", Const, 0}, + {"O_ALERT", Const, 0}, + {"O_ALT_IO", Const, 1}, + {"O_APPEND", Const, 0}, + {"O_ASYNC", Const, 0}, + {"O_CLOEXEC", Const, 0}, + {"O_CREAT", Const, 0}, + {"O_DIRECT", Const, 0}, + {"O_DIRECTORY", Const, 0}, + {"O_DP_GETRAWENCRYPTED", Const, 16}, + {"O_DSYNC", Const, 0}, + {"O_EVTONLY", Const, 0}, + {"O_EXCL", Const, 0}, + {"O_EXEC", Const, 0}, + {"O_EXLOCK", Const, 0}, + {"O_FSYNC", Const, 0}, + {"O_LARGEFILE", Const, 0}, + {"O_NDELAY", Const, 0}, + {"O_NOATIME", Const, 0}, + {"O_NOCTTY", Const, 0}, + {"O_NOFOLLOW", Const, 0}, + {"O_NONBLOCK", Const, 0}, + {"O_NOSIGPIPE", Const, 1}, + {"O_POPUP", Const, 0}, + {"O_RDONLY", Const, 0}, + {"O_RDWR", Const, 0}, + {"O_RSYNC", Const, 0}, + {"O_SHLOCK", Const, 0}, + {"O_SYMLINK", Const, 0}, + {"O_SYNC", Const, 0}, + {"O_TRUNC", Const, 0}, + {"O_TTY_INIT", Const, 0}, + {"O_WRONLY", Const, 0}, + {"Open", Func, 0}, + {"OpenCurrentProcessToken", Func, 0}, + {"OpenProcess", Func, 0}, + {"OpenProcessToken", Func, 0}, + {"Openat", Func, 0}, + {"Overlapped", Type, 0}, + {"Overlapped.HEvent", Field, 0}, + {"Overlapped.Internal", Field, 0}, + {"Overlapped.InternalHigh", Field, 0}, + {"Overlapped.Offset", Field, 0}, + {"Overlapped.OffsetHigh", Field, 0}, + {"PACKET_ADD_MEMBERSHIP", Const, 0}, + {"PACKET_BROADCAST", Const, 0}, + {"PACKET_DROP_MEMBERSHIP", Const, 0}, + {"PACKET_FASTROUTE", Const, 0}, + {"PACKET_HOST", Const, 0}, + {"PACKET_LOOPBACK", Const, 0}, + {"PACKET_MR_ALLMULTI", Const, 0}, + {"PACKET_MR_MULTICAST", Const, 0}, + {"PACKET_MR_PROMISC", Const, 0}, + {"PACKET_MULTICAST", Const, 0}, + {"PACKET_OTHERHOST", Const, 0}, + {"PACKET_OUTGOING", Const, 0}, + {"PACKET_RECV_OUTPUT", Const, 0}, + {"PACKET_RX_RING", Const, 0}, + {"PACKET_STATISTICS", Const, 0}, + {"PAGE_EXECUTE_READ", Const, 0}, + {"PAGE_EXECUTE_READWRITE", Const, 0}, + {"PAGE_EXECUTE_WRITECOPY", Const, 0}, + {"PAGE_READONLY", Const, 0}, + {"PAGE_READWRITE", Const, 0}, + {"PAGE_WRITECOPY", Const, 0}, + {"PARENB", Const, 0}, + {"PARMRK", Const, 0}, + {"PARODD", Const, 0}, + {"PENDIN", Const, 0}, + {"PFL_HIDDEN", Const, 2}, + {"PFL_MATCHES_PROTOCOL_ZERO", Const, 2}, + {"PFL_MULTIPLE_PROTO_ENTRIES", Const, 2}, + {"PFL_NETWORKDIRECT_PROVIDER", Const, 2}, + {"PFL_RECOMMENDED_PROTO_ENTRY", Const, 2}, + {"PF_FLUSH", Const, 1}, + {"PKCS_7_ASN_ENCODING", Const, 0}, + {"PMC5_PIPELINE_FLUSH", Const, 1}, + {"PRIO_PGRP", Const, 2}, + {"PRIO_PROCESS", Const, 2}, + {"PRIO_USER", Const, 2}, + {"PRI_IOFLUSH", Const, 1}, + {"PROCESS_QUERY_INFORMATION", Const, 0}, + {"PROCESS_TERMINATE", Const, 2}, + {"PROT_EXEC", Const, 0}, + {"PROT_GROWSDOWN", Const, 0}, + {"PROT_GROWSUP", Const, 0}, + {"PROT_NONE", Const, 0}, + {"PROT_READ", Const, 0}, + {"PROT_WRITE", Const, 0}, + {"PROV_DH_SCHANNEL", Const, 0}, + {"PROV_DSS", Const, 0}, + {"PROV_DSS_DH", Const, 0}, + {"PROV_EC_ECDSA_FULL", Const, 0}, + {"PROV_EC_ECDSA_SIG", Const, 0}, + {"PROV_EC_ECNRA_FULL", Const, 0}, + {"PROV_EC_ECNRA_SIG", Const, 0}, + {"PROV_FORTEZZA", Const, 0}, + {"PROV_INTEL_SEC", Const, 0}, + {"PROV_MS_EXCHANGE", Const, 0}, + {"PROV_REPLACE_OWF", Const, 0}, + {"PROV_RNG", Const, 0}, + {"PROV_RSA_AES", Const, 0}, + {"PROV_RSA_FULL", Const, 0}, + {"PROV_RSA_SCHANNEL", Const, 0}, + {"PROV_RSA_SIG", Const, 0}, + {"PROV_SPYRUS_LYNKS", Const, 0}, + {"PROV_SSL", Const, 0}, + {"PR_CAPBSET_DROP", Const, 0}, + {"PR_CAPBSET_READ", Const, 0}, + {"PR_CLEAR_SECCOMP_FILTER", Const, 0}, + {"PR_ENDIAN_BIG", Const, 0}, + {"PR_ENDIAN_LITTLE", Const, 0}, + {"PR_ENDIAN_PPC_LITTLE", Const, 0}, + {"PR_FPEMU_NOPRINT", Const, 0}, + {"PR_FPEMU_SIGFPE", Const, 0}, + {"PR_FP_EXC_ASYNC", Const, 0}, + {"PR_FP_EXC_DISABLED", Const, 0}, + {"PR_FP_EXC_DIV", Const, 0}, + {"PR_FP_EXC_INV", Const, 0}, + {"PR_FP_EXC_NONRECOV", Const, 0}, + {"PR_FP_EXC_OVF", Const, 0}, + {"PR_FP_EXC_PRECISE", Const, 0}, + {"PR_FP_EXC_RES", Const, 0}, + {"PR_FP_EXC_SW_ENABLE", Const, 0}, + {"PR_FP_EXC_UND", Const, 0}, + {"PR_GET_DUMPABLE", Const, 0}, + {"PR_GET_ENDIAN", Const, 0}, + {"PR_GET_FPEMU", Const, 0}, + {"PR_GET_FPEXC", Const, 0}, + {"PR_GET_KEEPCAPS", Const, 0}, + {"PR_GET_NAME", Const, 0}, + {"PR_GET_PDEATHSIG", Const, 0}, + {"PR_GET_SECCOMP", Const, 0}, + {"PR_GET_SECCOMP_FILTER", Const, 0}, + {"PR_GET_SECUREBITS", Const, 0}, + {"PR_GET_TIMERSLACK", Const, 0}, + {"PR_GET_TIMING", Const, 0}, + {"PR_GET_TSC", Const, 0}, + {"PR_GET_UNALIGN", Const, 0}, + {"PR_MCE_KILL", Const, 0}, + {"PR_MCE_KILL_CLEAR", Const, 0}, + {"PR_MCE_KILL_DEFAULT", Const, 0}, + {"PR_MCE_KILL_EARLY", Const, 0}, + {"PR_MCE_KILL_GET", Const, 0}, + {"PR_MCE_KILL_LATE", Const, 0}, + {"PR_MCE_KILL_SET", Const, 0}, + {"PR_SECCOMP_FILTER_EVENT", Const, 0}, + {"PR_SECCOMP_FILTER_SYSCALL", Const, 0}, + {"PR_SET_DUMPABLE", Const, 0}, + {"PR_SET_ENDIAN", Const, 0}, + {"PR_SET_FPEMU", Const, 0}, + {"PR_SET_FPEXC", Const, 0}, + {"PR_SET_KEEPCAPS", Const, 0}, + {"PR_SET_NAME", Const, 0}, + {"PR_SET_PDEATHSIG", Const, 0}, + {"PR_SET_PTRACER", Const, 0}, + {"PR_SET_SECCOMP", Const, 0}, + {"PR_SET_SECCOMP_FILTER", Const, 0}, + {"PR_SET_SECUREBITS", Const, 0}, + {"PR_SET_TIMERSLACK", Const, 0}, + {"PR_SET_TIMING", Const, 0}, + {"PR_SET_TSC", Const, 0}, + {"PR_SET_UNALIGN", Const, 0}, + {"PR_TASK_PERF_EVENTS_DISABLE", Const, 0}, + {"PR_TASK_PERF_EVENTS_ENABLE", Const, 0}, + {"PR_TIMING_STATISTICAL", Const, 0}, + {"PR_TIMING_TIMESTAMP", Const, 0}, + {"PR_TSC_ENABLE", Const, 0}, + {"PR_TSC_SIGSEGV", Const, 0}, + {"PR_UNALIGN_NOPRINT", Const, 0}, + {"PR_UNALIGN_SIGBUS", Const, 0}, + {"PTRACE_ARCH_PRCTL", Const, 0}, + {"PTRACE_ATTACH", Const, 0}, + {"PTRACE_CONT", Const, 0}, + {"PTRACE_DETACH", Const, 0}, + {"PTRACE_EVENT_CLONE", Const, 0}, + {"PTRACE_EVENT_EXEC", Const, 0}, + {"PTRACE_EVENT_EXIT", Const, 0}, + {"PTRACE_EVENT_FORK", Const, 0}, + {"PTRACE_EVENT_VFORK", Const, 0}, + {"PTRACE_EVENT_VFORK_DONE", Const, 0}, + {"PTRACE_GETCRUNCHREGS", Const, 0}, + {"PTRACE_GETEVENTMSG", Const, 0}, + {"PTRACE_GETFPREGS", Const, 0}, + {"PTRACE_GETFPXREGS", Const, 0}, + {"PTRACE_GETHBPREGS", Const, 0}, + {"PTRACE_GETREGS", Const, 0}, + {"PTRACE_GETREGSET", Const, 0}, + {"PTRACE_GETSIGINFO", Const, 0}, + {"PTRACE_GETVFPREGS", Const, 0}, + {"PTRACE_GETWMMXREGS", Const, 0}, + {"PTRACE_GET_THREAD_AREA", Const, 0}, + {"PTRACE_KILL", Const, 0}, + {"PTRACE_OLDSETOPTIONS", Const, 0}, + {"PTRACE_O_MASK", Const, 0}, + {"PTRACE_O_TRACECLONE", Const, 0}, + {"PTRACE_O_TRACEEXEC", Const, 0}, + {"PTRACE_O_TRACEEXIT", Const, 0}, + {"PTRACE_O_TRACEFORK", Const, 0}, + {"PTRACE_O_TRACESYSGOOD", Const, 0}, + {"PTRACE_O_TRACEVFORK", Const, 0}, + {"PTRACE_O_TRACEVFORKDONE", Const, 0}, + {"PTRACE_PEEKDATA", Const, 0}, + {"PTRACE_PEEKTEXT", Const, 0}, + {"PTRACE_PEEKUSR", Const, 0}, + {"PTRACE_POKEDATA", Const, 0}, + {"PTRACE_POKETEXT", Const, 0}, + {"PTRACE_POKEUSR", Const, 0}, + {"PTRACE_SETCRUNCHREGS", Const, 0}, + {"PTRACE_SETFPREGS", Const, 0}, + {"PTRACE_SETFPXREGS", Const, 0}, + {"PTRACE_SETHBPREGS", Const, 0}, + {"PTRACE_SETOPTIONS", Const, 0}, + {"PTRACE_SETREGS", Const, 0}, + {"PTRACE_SETREGSET", Const, 0}, + {"PTRACE_SETSIGINFO", Const, 0}, + {"PTRACE_SETVFPREGS", Const, 0}, + {"PTRACE_SETWMMXREGS", Const, 0}, + {"PTRACE_SET_SYSCALL", Const, 0}, + {"PTRACE_SET_THREAD_AREA", Const, 0}, + {"PTRACE_SINGLEBLOCK", Const, 0}, + {"PTRACE_SINGLESTEP", Const, 0}, + {"PTRACE_SYSCALL", Const, 0}, + {"PTRACE_SYSEMU", Const, 0}, + {"PTRACE_SYSEMU_SINGLESTEP", Const, 0}, + {"PTRACE_TRACEME", Const, 0}, + {"PT_ATTACH", Const, 0}, + {"PT_ATTACHEXC", Const, 0}, + {"PT_CONTINUE", Const, 0}, + {"PT_DATA_ADDR", Const, 0}, + {"PT_DENY_ATTACH", Const, 0}, + {"PT_DETACH", Const, 0}, + {"PT_FIRSTMACH", Const, 0}, + {"PT_FORCEQUOTA", Const, 0}, + {"PT_KILL", Const, 0}, + {"PT_MASK", Const, 1}, + {"PT_READ_D", Const, 0}, + {"PT_READ_I", Const, 0}, + {"PT_READ_U", Const, 0}, + {"PT_SIGEXC", Const, 0}, + {"PT_STEP", Const, 0}, + {"PT_TEXT_ADDR", Const, 0}, + {"PT_TEXT_END_ADDR", Const, 0}, + {"PT_THUPDATE", Const, 0}, + {"PT_TRACE_ME", Const, 0}, + {"PT_WRITE_D", Const, 0}, + {"PT_WRITE_I", Const, 0}, + {"PT_WRITE_U", Const, 0}, + {"ParseDirent", Func, 0}, + {"ParseNetlinkMessage", Func, 0}, + {"ParseNetlinkRouteAttr", Func, 0}, + {"ParseRoutingMessage", Func, 0}, + {"ParseRoutingSockaddr", Func, 0}, + {"ParseSocketControlMessage", Func, 0}, + {"ParseUnixCredentials", Func, 0}, + {"ParseUnixRights", Func, 0}, + {"PathMax", Const, 0}, + {"Pathconf", Func, 0}, + {"Pause", Func, 0}, + {"Pipe", Func, 0}, + {"Pipe2", Func, 1}, + {"PivotRoot", Func, 0}, + {"Pointer", Type, 11}, + {"PostQueuedCompletionStatus", Func, 0}, + {"Pread", Func, 0}, + {"Proc", Type, 0}, + {"Proc.Dll", Field, 0}, + {"Proc.Name", Field, 0}, + {"ProcAttr", Type, 0}, + {"ProcAttr.Dir", Field, 0}, + {"ProcAttr.Env", Field, 0}, + {"ProcAttr.Files", Field, 0}, + {"ProcAttr.Sys", Field, 0}, + {"Process32First", Func, 4}, + {"Process32Next", Func, 4}, + {"ProcessEntry32", Type, 4}, + {"ProcessEntry32.DefaultHeapID", Field, 4}, + {"ProcessEntry32.ExeFile", Field, 4}, + {"ProcessEntry32.Flags", Field, 4}, + {"ProcessEntry32.ModuleID", Field, 4}, + {"ProcessEntry32.ParentProcessID", Field, 4}, + {"ProcessEntry32.PriClassBase", Field, 4}, + {"ProcessEntry32.ProcessID", Field, 4}, + {"ProcessEntry32.Size", Field, 4}, + {"ProcessEntry32.Threads", Field, 4}, + {"ProcessEntry32.Usage", Field, 4}, + {"ProcessInformation", Type, 0}, + {"ProcessInformation.Process", Field, 0}, + {"ProcessInformation.ProcessId", Field, 0}, + {"ProcessInformation.Thread", Field, 0}, + {"ProcessInformation.ThreadId", Field, 0}, + {"Protoent", Type, 0}, + {"Protoent.Aliases", Field, 0}, + {"Protoent.Name", Field, 0}, + {"Protoent.Proto", Field, 0}, + {"PtraceAttach", Func, 0}, + {"PtraceCont", Func, 0}, + {"PtraceDetach", Func, 0}, + {"PtraceGetEventMsg", Func, 0}, + {"PtraceGetRegs", Func, 0}, + {"PtracePeekData", Func, 0}, + {"PtracePeekText", Func, 0}, + {"PtracePokeData", Func, 0}, + {"PtracePokeText", Func, 0}, + {"PtraceRegs", Type, 0}, + {"PtraceRegs.Cs", Field, 0}, + {"PtraceRegs.Ds", Field, 0}, + {"PtraceRegs.Eax", Field, 0}, + {"PtraceRegs.Ebp", Field, 0}, + {"PtraceRegs.Ebx", Field, 0}, + {"PtraceRegs.Ecx", Field, 0}, + {"PtraceRegs.Edi", Field, 0}, + {"PtraceRegs.Edx", Field, 0}, + {"PtraceRegs.Eflags", Field, 0}, + {"PtraceRegs.Eip", Field, 0}, + {"PtraceRegs.Es", Field, 0}, + {"PtraceRegs.Esi", Field, 0}, + {"PtraceRegs.Esp", Field, 0}, + {"PtraceRegs.Fs", Field, 0}, + {"PtraceRegs.Fs_base", Field, 0}, + {"PtraceRegs.Gs", Field, 0}, + {"PtraceRegs.Gs_base", Field, 0}, + {"PtraceRegs.Orig_eax", Field, 0}, + {"PtraceRegs.Orig_rax", Field, 0}, + {"PtraceRegs.R10", Field, 0}, + {"PtraceRegs.R11", Field, 0}, + {"PtraceRegs.R12", Field, 0}, + {"PtraceRegs.R13", Field, 0}, + {"PtraceRegs.R14", Field, 0}, + {"PtraceRegs.R15", Field, 0}, + {"PtraceRegs.R8", Field, 0}, + {"PtraceRegs.R9", Field, 0}, + {"PtraceRegs.Rax", Field, 0}, + {"PtraceRegs.Rbp", Field, 0}, + {"PtraceRegs.Rbx", Field, 0}, + {"PtraceRegs.Rcx", Field, 0}, + {"PtraceRegs.Rdi", Field, 0}, + {"PtraceRegs.Rdx", Field, 0}, + {"PtraceRegs.Rip", Field, 0}, + {"PtraceRegs.Rsi", Field, 0}, + {"PtraceRegs.Rsp", Field, 0}, + {"PtraceRegs.Ss", Field, 0}, + {"PtraceRegs.Uregs", Field, 0}, + {"PtraceRegs.Xcs", Field, 0}, + {"PtraceRegs.Xds", Field, 0}, + {"PtraceRegs.Xes", Field, 0}, + {"PtraceRegs.Xfs", Field, 0}, + {"PtraceRegs.Xgs", Field, 0}, + {"PtraceRegs.Xss", Field, 0}, + {"PtraceSetOptions", Func, 0}, + {"PtraceSetRegs", Func, 0}, + {"PtraceSingleStep", Func, 0}, + {"PtraceSyscall", Func, 1}, + {"Pwrite", Func, 0}, + {"REG_BINARY", Const, 0}, + {"REG_DWORD", Const, 0}, + {"REG_DWORD_BIG_ENDIAN", Const, 0}, + {"REG_DWORD_LITTLE_ENDIAN", Const, 0}, + {"REG_EXPAND_SZ", Const, 0}, + {"REG_FULL_RESOURCE_DESCRIPTOR", Const, 0}, + {"REG_LINK", Const, 0}, + {"REG_MULTI_SZ", Const, 0}, + {"REG_NONE", Const, 0}, + {"REG_QWORD", Const, 0}, + {"REG_QWORD_LITTLE_ENDIAN", Const, 0}, + {"REG_RESOURCE_LIST", Const, 0}, + {"REG_RESOURCE_REQUIREMENTS_LIST", Const, 0}, + {"REG_SZ", Const, 0}, + {"RLIMIT_AS", Const, 0}, + {"RLIMIT_CORE", Const, 0}, + {"RLIMIT_CPU", Const, 0}, + {"RLIMIT_CPU_USAGE_MONITOR", Const, 16}, + {"RLIMIT_DATA", Const, 0}, + {"RLIMIT_FSIZE", Const, 0}, + {"RLIMIT_NOFILE", Const, 0}, + {"RLIMIT_STACK", Const, 0}, + {"RLIM_INFINITY", Const, 0}, + {"RTAX_ADVMSS", Const, 0}, + {"RTAX_AUTHOR", Const, 0}, + {"RTAX_BRD", Const, 0}, + {"RTAX_CWND", Const, 0}, + {"RTAX_DST", Const, 0}, + {"RTAX_FEATURES", Const, 0}, + {"RTAX_FEATURE_ALLFRAG", Const, 0}, + {"RTAX_FEATURE_ECN", Const, 0}, + {"RTAX_FEATURE_SACK", Const, 0}, + {"RTAX_FEATURE_TIMESTAMP", Const, 0}, + {"RTAX_GATEWAY", Const, 0}, + {"RTAX_GENMASK", Const, 0}, + {"RTAX_HOPLIMIT", Const, 0}, + {"RTAX_IFA", Const, 0}, + {"RTAX_IFP", Const, 0}, + {"RTAX_INITCWND", Const, 0}, + {"RTAX_INITRWND", Const, 0}, + {"RTAX_LABEL", Const, 1}, + {"RTAX_LOCK", Const, 0}, + {"RTAX_MAX", Const, 0}, + {"RTAX_MTU", Const, 0}, + {"RTAX_NETMASK", Const, 0}, + {"RTAX_REORDERING", Const, 0}, + {"RTAX_RTO_MIN", Const, 0}, + {"RTAX_RTT", Const, 0}, + {"RTAX_RTTVAR", Const, 0}, + {"RTAX_SRC", Const, 1}, + {"RTAX_SRCMASK", Const, 1}, + {"RTAX_SSTHRESH", Const, 0}, + {"RTAX_TAG", Const, 1}, + {"RTAX_UNSPEC", Const, 0}, + {"RTAX_WINDOW", Const, 0}, + {"RTA_ALIGNTO", Const, 0}, + {"RTA_AUTHOR", Const, 0}, + {"RTA_BRD", Const, 0}, + {"RTA_CACHEINFO", Const, 0}, + {"RTA_DST", Const, 0}, + {"RTA_FLOW", Const, 0}, + {"RTA_GATEWAY", Const, 0}, + {"RTA_GENMASK", Const, 0}, + {"RTA_IFA", Const, 0}, + {"RTA_IFP", Const, 0}, + {"RTA_IIF", Const, 0}, + {"RTA_LABEL", Const, 1}, + {"RTA_MAX", Const, 0}, + {"RTA_METRICS", Const, 0}, + {"RTA_MULTIPATH", Const, 0}, + {"RTA_NETMASK", Const, 0}, + {"RTA_OIF", Const, 0}, + {"RTA_PREFSRC", Const, 0}, + {"RTA_PRIORITY", Const, 0}, + {"RTA_SRC", Const, 0}, + {"RTA_SRCMASK", Const, 1}, + {"RTA_TABLE", Const, 0}, + {"RTA_TAG", Const, 1}, + {"RTA_UNSPEC", Const, 0}, + {"RTCF_DIRECTSRC", Const, 0}, + {"RTCF_DOREDIRECT", Const, 0}, + {"RTCF_LOG", Const, 0}, + {"RTCF_MASQ", Const, 0}, + {"RTCF_NAT", Const, 0}, + {"RTCF_VALVE", Const, 0}, + {"RTF_ADDRCLASSMASK", Const, 0}, + {"RTF_ADDRCONF", Const, 0}, + {"RTF_ALLONLINK", Const, 0}, + {"RTF_ANNOUNCE", Const, 1}, + {"RTF_BLACKHOLE", Const, 0}, + {"RTF_BROADCAST", Const, 0}, + {"RTF_CACHE", Const, 0}, + {"RTF_CLONED", Const, 1}, + {"RTF_CLONING", Const, 0}, + {"RTF_CONDEMNED", Const, 0}, + {"RTF_DEFAULT", Const, 0}, + {"RTF_DELCLONE", Const, 0}, + {"RTF_DONE", Const, 0}, + {"RTF_DYNAMIC", Const, 0}, + {"RTF_FLOW", Const, 0}, + {"RTF_FMASK", Const, 0}, + {"RTF_GATEWAY", Const, 0}, + {"RTF_GWFLAG_COMPAT", Const, 3}, + {"RTF_HOST", Const, 0}, + {"RTF_IFREF", Const, 0}, + {"RTF_IFSCOPE", Const, 0}, + {"RTF_INTERFACE", Const, 0}, + {"RTF_IRTT", Const, 0}, + {"RTF_LINKRT", Const, 0}, + {"RTF_LLDATA", Const, 0}, + {"RTF_LLINFO", Const, 0}, + {"RTF_LOCAL", Const, 0}, + {"RTF_MASK", Const, 1}, + {"RTF_MODIFIED", Const, 0}, + {"RTF_MPATH", Const, 1}, + {"RTF_MPLS", Const, 1}, + {"RTF_MSS", Const, 0}, + {"RTF_MTU", Const, 0}, + {"RTF_MULTICAST", Const, 0}, + {"RTF_NAT", Const, 0}, + {"RTF_NOFORWARD", Const, 0}, + {"RTF_NONEXTHOP", Const, 0}, + {"RTF_NOPMTUDISC", Const, 0}, + {"RTF_PERMANENT_ARP", Const, 1}, + {"RTF_PINNED", Const, 0}, + {"RTF_POLICY", Const, 0}, + {"RTF_PRCLONING", Const, 0}, + {"RTF_PROTO1", Const, 0}, + {"RTF_PROTO2", Const, 0}, + {"RTF_PROTO3", Const, 0}, + {"RTF_PROXY", Const, 16}, + {"RTF_REINSTATE", Const, 0}, + {"RTF_REJECT", Const, 0}, + {"RTF_RNH_LOCKED", Const, 0}, + {"RTF_ROUTER", Const, 16}, + {"RTF_SOURCE", Const, 1}, + {"RTF_SRC", Const, 1}, + {"RTF_STATIC", Const, 0}, + {"RTF_STICKY", Const, 0}, + {"RTF_THROW", Const, 0}, + {"RTF_TUNNEL", Const, 1}, + {"RTF_UP", Const, 0}, + {"RTF_USETRAILERS", Const, 1}, + {"RTF_WASCLONED", Const, 0}, + {"RTF_WINDOW", Const, 0}, + {"RTF_XRESOLVE", Const, 0}, + {"RTM_ADD", Const, 0}, + {"RTM_BASE", Const, 0}, + {"RTM_CHANGE", Const, 0}, + {"RTM_CHGADDR", Const, 1}, + {"RTM_DELACTION", Const, 0}, + {"RTM_DELADDR", Const, 0}, + {"RTM_DELADDRLABEL", Const, 0}, + {"RTM_DELETE", Const, 0}, + {"RTM_DELLINK", Const, 0}, + {"RTM_DELMADDR", Const, 0}, + {"RTM_DELNEIGH", Const, 0}, + {"RTM_DELQDISC", Const, 0}, + {"RTM_DELROUTE", Const, 0}, + {"RTM_DELRULE", Const, 0}, + {"RTM_DELTCLASS", Const, 0}, + {"RTM_DELTFILTER", Const, 0}, + {"RTM_DESYNC", Const, 1}, + {"RTM_F_CLONED", Const, 0}, + {"RTM_F_EQUALIZE", Const, 0}, + {"RTM_F_NOTIFY", Const, 0}, + {"RTM_F_PREFIX", Const, 0}, + {"RTM_GET", Const, 0}, + {"RTM_GET2", Const, 0}, + {"RTM_GETACTION", Const, 0}, + {"RTM_GETADDR", Const, 0}, + {"RTM_GETADDRLABEL", Const, 0}, + {"RTM_GETANYCAST", Const, 0}, + {"RTM_GETDCB", Const, 0}, + {"RTM_GETLINK", Const, 0}, + {"RTM_GETMULTICAST", Const, 0}, + {"RTM_GETNEIGH", Const, 0}, + {"RTM_GETNEIGHTBL", Const, 0}, + {"RTM_GETQDISC", Const, 0}, + {"RTM_GETROUTE", Const, 0}, + {"RTM_GETRULE", Const, 0}, + {"RTM_GETTCLASS", Const, 0}, + {"RTM_GETTFILTER", Const, 0}, + {"RTM_IEEE80211", Const, 0}, + {"RTM_IFANNOUNCE", Const, 0}, + {"RTM_IFINFO", Const, 0}, + {"RTM_IFINFO2", Const, 0}, + {"RTM_LLINFO_UPD", Const, 1}, + {"RTM_LOCK", Const, 0}, + {"RTM_LOSING", Const, 0}, + {"RTM_MAX", Const, 0}, + {"RTM_MAXSIZE", Const, 1}, + {"RTM_MISS", Const, 0}, + {"RTM_NEWACTION", Const, 0}, + {"RTM_NEWADDR", Const, 0}, + {"RTM_NEWADDRLABEL", Const, 0}, + {"RTM_NEWLINK", Const, 0}, + {"RTM_NEWMADDR", Const, 0}, + {"RTM_NEWMADDR2", Const, 0}, + {"RTM_NEWNDUSEROPT", Const, 0}, + {"RTM_NEWNEIGH", Const, 0}, + {"RTM_NEWNEIGHTBL", Const, 0}, + {"RTM_NEWPREFIX", Const, 0}, + {"RTM_NEWQDISC", Const, 0}, + {"RTM_NEWROUTE", Const, 0}, + {"RTM_NEWRULE", Const, 0}, + {"RTM_NEWTCLASS", Const, 0}, + {"RTM_NEWTFILTER", Const, 0}, + {"RTM_NR_FAMILIES", Const, 0}, + {"RTM_NR_MSGTYPES", Const, 0}, + {"RTM_OIFINFO", Const, 1}, + {"RTM_OLDADD", Const, 0}, + {"RTM_OLDDEL", Const, 0}, + {"RTM_OOIFINFO", Const, 1}, + {"RTM_REDIRECT", Const, 0}, + {"RTM_RESOLVE", Const, 0}, + {"RTM_RTTUNIT", Const, 0}, + {"RTM_SETDCB", Const, 0}, + {"RTM_SETGATE", Const, 1}, + {"RTM_SETLINK", Const, 0}, + {"RTM_SETNEIGHTBL", Const, 0}, + {"RTM_VERSION", Const, 0}, + {"RTNH_ALIGNTO", Const, 0}, + {"RTNH_F_DEAD", Const, 0}, + {"RTNH_F_ONLINK", Const, 0}, + {"RTNH_F_PERVASIVE", Const, 0}, + {"RTNLGRP_IPV4_IFADDR", Const, 1}, + {"RTNLGRP_IPV4_MROUTE", Const, 1}, + {"RTNLGRP_IPV4_ROUTE", Const, 1}, + {"RTNLGRP_IPV4_RULE", Const, 1}, + {"RTNLGRP_IPV6_IFADDR", Const, 1}, + {"RTNLGRP_IPV6_IFINFO", Const, 1}, + {"RTNLGRP_IPV6_MROUTE", Const, 1}, + {"RTNLGRP_IPV6_PREFIX", Const, 1}, + {"RTNLGRP_IPV6_ROUTE", Const, 1}, + {"RTNLGRP_IPV6_RULE", Const, 1}, + {"RTNLGRP_LINK", Const, 1}, + {"RTNLGRP_ND_USEROPT", Const, 1}, + {"RTNLGRP_NEIGH", Const, 1}, + {"RTNLGRP_NONE", Const, 1}, + {"RTNLGRP_NOTIFY", Const, 1}, + {"RTNLGRP_TC", Const, 1}, + {"RTN_ANYCAST", Const, 0}, + {"RTN_BLACKHOLE", Const, 0}, + {"RTN_BROADCAST", Const, 0}, + {"RTN_LOCAL", Const, 0}, + {"RTN_MAX", Const, 0}, + {"RTN_MULTICAST", Const, 0}, + {"RTN_NAT", Const, 0}, + {"RTN_PROHIBIT", Const, 0}, + {"RTN_THROW", Const, 0}, + {"RTN_UNICAST", Const, 0}, + {"RTN_UNREACHABLE", Const, 0}, + {"RTN_UNSPEC", Const, 0}, + {"RTN_XRESOLVE", Const, 0}, + {"RTPROT_BIRD", Const, 0}, + {"RTPROT_BOOT", Const, 0}, + {"RTPROT_DHCP", Const, 0}, + {"RTPROT_DNROUTED", Const, 0}, + {"RTPROT_GATED", Const, 0}, + {"RTPROT_KERNEL", Const, 0}, + {"RTPROT_MRT", Const, 0}, + {"RTPROT_NTK", Const, 0}, + {"RTPROT_RA", Const, 0}, + {"RTPROT_REDIRECT", Const, 0}, + {"RTPROT_STATIC", Const, 0}, + {"RTPROT_UNSPEC", Const, 0}, + {"RTPROT_XORP", Const, 0}, + {"RTPROT_ZEBRA", Const, 0}, + {"RTV_EXPIRE", Const, 0}, + {"RTV_HOPCOUNT", Const, 0}, + {"RTV_MTU", Const, 0}, + {"RTV_RPIPE", Const, 0}, + {"RTV_RTT", Const, 0}, + {"RTV_RTTVAR", Const, 0}, + {"RTV_SPIPE", Const, 0}, + {"RTV_SSTHRESH", Const, 0}, + {"RTV_WEIGHT", Const, 0}, + {"RT_CACHING_CONTEXT", Const, 1}, + {"RT_CLASS_DEFAULT", Const, 0}, + {"RT_CLASS_LOCAL", Const, 0}, + {"RT_CLASS_MAIN", Const, 0}, + {"RT_CLASS_MAX", Const, 0}, + {"RT_CLASS_UNSPEC", Const, 0}, + {"RT_DEFAULT_FIB", Const, 1}, + {"RT_NORTREF", Const, 1}, + {"RT_SCOPE_HOST", Const, 0}, + {"RT_SCOPE_LINK", Const, 0}, + {"RT_SCOPE_NOWHERE", Const, 0}, + {"RT_SCOPE_SITE", Const, 0}, + {"RT_SCOPE_UNIVERSE", Const, 0}, + {"RT_TABLEID_MAX", Const, 1}, + {"RT_TABLE_COMPAT", Const, 0}, + {"RT_TABLE_DEFAULT", Const, 0}, + {"RT_TABLE_LOCAL", Const, 0}, + {"RT_TABLE_MAIN", Const, 0}, + {"RT_TABLE_MAX", Const, 0}, + {"RT_TABLE_UNSPEC", Const, 0}, + {"RUSAGE_CHILDREN", Const, 0}, + {"RUSAGE_SELF", Const, 0}, + {"RUSAGE_THREAD", Const, 0}, + {"Radvisory_t", Type, 0}, + {"Radvisory_t.Count", Field, 0}, + {"Radvisory_t.Offset", Field, 0}, + {"Radvisory_t.Pad_cgo_0", Field, 0}, + {"RawConn", Type, 9}, + {"RawSockaddr", Type, 0}, + {"RawSockaddr.Data", Field, 0}, + {"RawSockaddr.Family", Field, 0}, + {"RawSockaddr.Len", Field, 0}, + {"RawSockaddrAny", Type, 0}, + {"RawSockaddrAny.Addr", Field, 0}, + {"RawSockaddrAny.Pad", Field, 0}, + {"RawSockaddrDatalink", Type, 0}, + {"RawSockaddrDatalink.Alen", Field, 0}, + {"RawSockaddrDatalink.Data", Field, 0}, + {"RawSockaddrDatalink.Family", Field, 0}, + {"RawSockaddrDatalink.Index", Field, 0}, + {"RawSockaddrDatalink.Len", Field, 0}, + {"RawSockaddrDatalink.Nlen", Field, 0}, + {"RawSockaddrDatalink.Pad_cgo_0", Field, 2}, + {"RawSockaddrDatalink.Slen", Field, 0}, + {"RawSockaddrDatalink.Type", Field, 0}, + {"RawSockaddrInet4", Type, 0}, + {"RawSockaddrInet4.Addr", Field, 0}, + {"RawSockaddrInet4.Family", Field, 0}, + {"RawSockaddrInet4.Len", Field, 0}, + {"RawSockaddrInet4.Port", Field, 0}, + {"RawSockaddrInet4.Zero", Field, 0}, + {"RawSockaddrInet6", Type, 0}, + {"RawSockaddrInet6.Addr", Field, 0}, + {"RawSockaddrInet6.Family", Field, 0}, + {"RawSockaddrInet6.Flowinfo", Field, 0}, + {"RawSockaddrInet6.Len", Field, 0}, + {"RawSockaddrInet6.Port", Field, 0}, + {"RawSockaddrInet6.Scope_id", Field, 0}, + {"RawSockaddrLinklayer", Type, 0}, + {"RawSockaddrLinklayer.Addr", Field, 0}, + {"RawSockaddrLinklayer.Family", Field, 0}, + {"RawSockaddrLinklayer.Halen", Field, 0}, + {"RawSockaddrLinklayer.Hatype", Field, 0}, + {"RawSockaddrLinklayer.Ifindex", Field, 0}, + {"RawSockaddrLinklayer.Pkttype", Field, 0}, + {"RawSockaddrLinklayer.Protocol", Field, 0}, + {"RawSockaddrNetlink", Type, 0}, + {"RawSockaddrNetlink.Family", Field, 0}, + {"RawSockaddrNetlink.Groups", Field, 0}, + {"RawSockaddrNetlink.Pad", Field, 0}, + {"RawSockaddrNetlink.Pid", Field, 0}, + {"RawSockaddrUnix", Type, 0}, + {"RawSockaddrUnix.Family", Field, 0}, + {"RawSockaddrUnix.Len", Field, 0}, + {"RawSockaddrUnix.Pad_cgo_0", Field, 2}, + {"RawSockaddrUnix.Path", Field, 0}, + {"RawSyscall", Func, 0}, + {"RawSyscall6", Func, 0}, + {"Read", Func, 0}, + {"ReadConsole", Func, 1}, + {"ReadDirectoryChanges", Func, 0}, + {"ReadDirent", Func, 0}, + {"ReadFile", Func, 0}, + {"Readlink", Func, 0}, + {"Reboot", Func, 0}, + {"Recvfrom", Func, 0}, + {"Recvmsg", Func, 0}, + {"RegCloseKey", Func, 0}, + {"RegEnumKeyEx", Func, 0}, + {"RegOpenKeyEx", Func, 0}, + {"RegQueryInfoKey", Func, 0}, + {"RegQueryValueEx", Func, 0}, + {"RemoveDirectory", Func, 0}, + {"Removexattr", Func, 1}, + {"Rename", Func, 0}, + {"Renameat", Func, 0}, + {"Revoke", Func, 0}, + {"Rlimit", Type, 0}, + {"Rlimit.Cur", Field, 0}, + {"Rlimit.Max", Field, 0}, + {"Rmdir", Func, 0}, + {"RouteMessage", Type, 0}, + {"RouteMessage.Data", Field, 0}, + {"RouteMessage.Header", Field, 0}, + {"RouteRIB", Func, 0}, + {"RoutingMessage", Type, 0}, + {"RtAttr", Type, 0}, + {"RtAttr.Len", Field, 0}, + {"RtAttr.Type", Field, 0}, + {"RtGenmsg", Type, 0}, + {"RtGenmsg.Family", Field, 0}, + {"RtMetrics", Type, 0}, + {"RtMetrics.Expire", Field, 0}, + {"RtMetrics.Filler", Field, 0}, + {"RtMetrics.Hopcount", Field, 0}, + {"RtMetrics.Locks", Field, 0}, + {"RtMetrics.Mtu", Field, 0}, + {"RtMetrics.Pad", Field, 3}, + {"RtMetrics.Pksent", Field, 0}, + {"RtMetrics.Recvpipe", Field, 0}, + {"RtMetrics.Refcnt", Field, 2}, + {"RtMetrics.Rtt", Field, 0}, + {"RtMetrics.Rttvar", Field, 0}, + {"RtMetrics.Sendpipe", Field, 0}, + {"RtMetrics.Ssthresh", Field, 0}, + {"RtMetrics.Weight", Field, 0}, + {"RtMsg", Type, 0}, + {"RtMsg.Dst_len", Field, 0}, + {"RtMsg.Family", Field, 0}, + {"RtMsg.Flags", Field, 0}, + {"RtMsg.Protocol", Field, 0}, + {"RtMsg.Scope", Field, 0}, + {"RtMsg.Src_len", Field, 0}, + {"RtMsg.Table", Field, 0}, + {"RtMsg.Tos", Field, 0}, + {"RtMsg.Type", Field, 0}, + {"RtMsghdr", Type, 0}, + {"RtMsghdr.Addrs", Field, 0}, + {"RtMsghdr.Errno", Field, 0}, + {"RtMsghdr.Flags", Field, 0}, + {"RtMsghdr.Fmask", Field, 0}, + {"RtMsghdr.Hdrlen", Field, 2}, + {"RtMsghdr.Index", Field, 0}, + {"RtMsghdr.Inits", Field, 0}, + {"RtMsghdr.Mpls", Field, 2}, + {"RtMsghdr.Msglen", Field, 0}, + {"RtMsghdr.Pad_cgo_0", Field, 0}, + {"RtMsghdr.Pad_cgo_1", Field, 2}, + {"RtMsghdr.Pid", Field, 0}, + {"RtMsghdr.Priority", Field, 2}, + {"RtMsghdr.Rmx", Field, 0}, + {"RtMsghdr.Seq", Field, 0}, + {"RtMsghdr.Tableid", Field, 2}, + {"RtMsghdr.Type", Field, 0}, + {"RtMsghdr.Use", Field, 0}, + {"RtMsghdr.Version", Field, 0}, + {"RtNexthop", Type, 0}, + {"RtNexthop.Flags", Field, 0}, + {"RtNexthop.Hops", Field, 0}, + {"RtNexthop.Ifindex", Field, 0}, + {"RtNexthop.Len", Field, 0}, + {"Rusage", Type, 0}, + {"Rusage.CreationTime", Field, 0}, + {"Rusage.ExitTime", Field, 0}, + {"Rusage.Idrss", Field, 0}, + {"Rusage.Inblock", Field, 0}, + {"Rusage.Isrss", Field, 0}, + {"Rusage.Ixrss", Field, 0}, + {"Rusage.KernelTime", Field, 0}, + {"Rusage.Majflt", Field, 0}, + {"Rusage.Maxrss", Field, 0}, + {"Rusage.Minflt", Field, 0}, + {"Rusage.Msgrcv", Field, 0}, + {"Rusage.Msgsnd", Field, 0}, + {"Rusage.Nivcsw", Field, 0}, + {"Rusage.Nsignals", Field, 0}, + {"Rusage.Nswap", Field, 0}, + {"Rusage.Nvcsw", Field, 0}, + {"Rusage.Oublock", Field, 0}, + {"Rusage.Stime", Field, 0}, + {"Rusage.UserTime", Field, 0}, + {"Rusage.Utime", Field, 0}, + {"SCM_BINTIME", Const, 0}, + {"SCM_CREDENTIALS", Const, 0}, + {"SCM_CREDS", Const, 0}, + {"SCM_RIGHTS", Const, 0}, + {"SCM_TIMESTAMP", Const, 0}, + {"SCM_TIMESTAMPING", Const, 0}, + {"SCM_TIMESTAMPNS", Const, 0}, + {"SCM_TIMESTAMP_MONOTONIC", Const, 0}, + {"SHUT_RD", Const, 0}, + {"SHUT_RDWR", Const, 0}, + {"SHUT_WR", Const, 0}, + {"SID", Type, 0}, + {"SIDAndAttributes", Type, 0}, + {"SIDAndAttributes.Attributes", Field, 0}, + {"SIDAndAttributes.Sid", Field, 0}, + {"SIGABRT", Const, 0}, + {"SIGALRM", Const, 0}, + {"SIGBUS", Const, 0}, + {"SIGCHLD", Const, 0}, + {"SIGCLD", Const, 0}, + {"SIGCONT", Const, 0}, + {"SIGEMT", Const, 0}, + {"SIGFPE", Const, 0}, + {"SIGHUP", Const, 0}, + {"SIGILL", Const, 0}, + {"SIGINFO", Const, 0}, + {"SIGINT", Const, 0}, + {"SIGIO", Const, 0}, + {"SIGIOT", Const, 0}, + {"SIGKILL", Const, 0}, + {"SIGLIBRT", Const, 1}, + {"SIGLWP", Const, 0}, + {"SIGPIPE", Const, 0}, + {"SIGPOLL", Const, 0}, + {"SIGPROF", Const, 0}, + {"SIGPWR", Const, 0}, + {"SIGQUIT", Const, 0}, + {"SIGSEGV", Const, 0}, + {"SIGSTKFLT", Const, 0}, + {"SIGSTOP", Const, 0}, + {"SIGSYS", Const, 0}, + {"SIGTERM", Const, 0}, + {"SIGTHR", Const, 0}, + {"SIGTRAP", Const, 0}, + {"SIGTSTP", Const, 0}, + {"SIGTTIN", Const, 0}, + {"SIGTTOU", Const, 0}, + {"SIGUNUSED", Const, 0}, + {"SIGURG", Const, 0}, + {"SIGUSR1", Const, 0}, + {"SIGUSR2", Const, 0}, + {"SIGVTALRM", Const, 0}, + {"SIGWINCH", Const, 0}, + {"SIGXCPU", Const, 0}, + {"SIGXFSZ", Const, 0}, + {"SIOCADDDLCI", Const, 0}, + {"SIOCADDMULTI", Const, 0}, + {"SIOCADDRT", Const, 0}, + {"SIOCAIFADDR", Const, 0}, + {"SIOCAIFGROUP", Const, 0}, + {"SIOCALIFADDR", Const, 0}, + {"SIOCARPIPLL", Const, 0}, + {"SIOCATMARK", Const, 0}, + {"SIOCAUTOADDR", Const, 0}, + {"SIOCAUTONETMASK", Const, 0}, + {"SIOCBRDGADD", Const, 1}, + {"SIOCBRDGADDS", Const, 1}, + {"SIOCBRDGARL", Const, 1}, + {"SIOCBRDGDADDR", Const, 1}, + {"SIOCBRDGDEL", Const, 1}, + {"SIOCBRDGDELS", Const, 1}, + {"SIOCBRDGFLUSH", Const, 1}, + {"SIOCBRDGFRL", Const, 1}, + {"SIOCBRDGGCACHE", Const, 1}, + {"SIOCBRDGGFD", Const, 1}, + {"SIOCBRDGGHT", Const, 1}, + {"SIOCBRDGGIFFLGS", Const, 1}, + {"SIOCBRDGGMA", Const, 1}, + {"SIOCBRDGGPARAM", Const, 1}, + {"SIOCBRDGGPRI", Const, 1}, + {"SIOCBRDGGRL", Const, 1}, + {"SIOCBRDGGSIFS", Const, 1}, + {"SIOCBRDGGTO", Const, 1}, + {"SIOCBRDGIFS", Const, 1}, + {"SIOCBRDGRTS", Const, 1}, + {"SIOCBRDGSADDR", Const, 1}, + {"SIOCBRDGSCACHE", Const, 1}, + {"SIOCBRDGSFD", Const, 1}, + {"SIOCBRDGSHT", Const, 1}, + {"SIOCBRDGSIFCOST", Const, 1}, + {"SIOCBRDGSIFFLGS", Const, 1}, + {"SIOCBRDGSIFPRIO", Const, 1}, + {"SIOCBRDGSMA", Const, 1}, + {"SIOCBRDGSPRI", Const, 1}, + {"SIOCBRDGSPROTO", Const, 1}, + {"SIOCBRDGSTO", Const, 1}, + {"SIOCBRDGSTXHC", Const, 1}, + {"SIOCDARP", Const, 0}, + {"SIOCDELDLCI", Const, 0}, + {"SIOCDELMULTI", Const, 0}, + {"SIOCDELRT", Const, 0}, + {"SIOCDEVPRIVATE", Const, 0}, + {"SIOCDIFADDR", Const, 0}, + {"SIOCDIFGROUP", Const, 0}, + {"SIOCDIFPHYADDR", Const, 0}, + {"SIOCDLIFADDR", Const, 0}, + {"SIOCDRARP", Const, 0}, + {"SIOCGARP", Const, 0}, + {"SIOCGDRVSPEC", Const, 0}, + {"SIOCGETKALIVE", Const, 1}, + {"SIOCGETLABEL", Const, 1}, + {"SIOCGETPFLOW", Const, 1}, + {"SIOCGETPFSYNC", Const, 1}, + {"SIOCGETSGCNT", Const, 0}, + {"SIOCGETVIFCNT", Const, 0}, + {"SIOCGETVLAN", Const, 0}, + {"SIOCGHIWAT", Const, 0}, + {"SIOCGIFADDR", Const, 0}, + {"SIOCGIFADDRPREF", Const, 1}, + {"SIOCGIFALIAS", Const, 1}, + {"SIOCGIFALTMTU", Const, 0}, + {"SIOCGIFASYNCMAP", Const, 0}, + {"SIOCGIFBOND", Const, 0}, + {"SIOCGIFBR", Const, 0}, + {"SIOCGIFBRDADDR", Const, 0}, + {"SIOCGIFCAP", Const, 0}, + {"SIOCGIFCONF", Const, 0}, + {"SIOCGIFCOUNT", Const, 0}, + {"SIOCGIFDATA", Const, 1}, + {"SIOCGIFDESCR", Const, 0}, + {"SIOCGIFDEVMTU", Const, 0}, + {"SIOCGIFDLT", Const, 1}, + {"SIOCGIFDSTADDR", Const, 0}, + {"SIOCGIFENCAP", Const, 0}, + {"SIOCGIFFIB", Const, 1}, + {"SIOCGIFFLAGS", Const, 0}, + {"SIOCGIFGATTR", Const, 1}, + {"SIOCGIFGENERIC", Const, 0}, + {"SIOCGIFGMEMB", Const, 0}, + {"SIOCGIFGROUP", Const, 0}, + {"SIOCGIFHARDMTU", Const, 3}, + {"SIOCGIFHWADDR", Const, 0}, + {"SIOCGIFINDEX", Const, 0}, + {"SIOCGIFKPI", Const, 0}, + {"SIOCGIFMAC", Const, 0}, + {"SIOCGIFMAP", Const, 0}, + {"SIOCGIFMEDIA", Const, 0}, + {"SIOCGIFMEM", Const, 0}, + {"SIOCGIFMETRIC", Const, 0}, + {"SIOCGIFMTU", Const, 0}, + {"SIOCGIFNAME", Const, 0}, + {"SIOCGIFNETMASK", Const, 0}, + {"SIOCGIFPDSTADDR", Const, 0}, + {"SIOCGIFPFLAGS", Const, 0}, + {"SIOCGIFPHYS", Const, 0}, + {"SIOCGIFPRIORITY", Const, 1}, + {"SIOCGIFPSRCADDR", Const, 0}, + {"SIOCGIFRDOMAIN", Const, 1}, + {"SIOCGIFRTLABEL", Const, 1}, + {"SIOCGIFSLAVE", Const, 0}, + {"SIOCGIFSTATUS", Const, 0}, + {"SIOCGIFTIMESLOT", Const, 1}, + {"SIOCGIFTXQLEN", Const, 0}, + {"SIOCGIFVLAN", Const, 0}, + {"SIOCGIFWAKEFLAGS", Const, 0}, + {"SIOCGIFXFLAGS", Const, 1}, + {"SIOCGLIFADDR", Const, 0}, + {"SIOCGLIFPHYADDR", Const, 0}, + {"SIOCGLIFPHYRTABLE", Const, 1}, + {"SIOCGLIFPHYTTL", Const, 3}, + {"SIOCGLINKSTR", Const, 1}, + {"SIOCGLOWAT", Const, 0}, + {"SIOCGPGRP", Const, 0}, + {"SIOCGPRIVATE_0", Const, 0}, + {"SIOCGPRIVATE_1", Const, 0}, + {"SIOCGRARP", Const, 0}, + {"SIOCGSPPPPARAMS", Const, 3}, + {"SIOCGSTAMP", Const, 0}, + {"SIOCGSTAMPNS", Const, 0}, + {"SIOCGVH", Const, 1}, + {"SIOCGVNETID", Const, 3}, + {"SIOCIFCREATE", Const, 0}, + {"SIOCIFCREATE2", Const, 0}, + {"SIOCIFDESTROY", Const, 0}, + {"SIOCIFGCLONERS", Const, 0}, + {"SIOCINITIFADDR", Const, 1}, + {"SIOCPROTOPRIVATE", Const, 0}, + {"SIOCRSLVMULTI", Const, 0}, + {"SIOCRTMSG", Const, 0}, + {"SIOCSARP", Const, 0}, + {"SIOCSDRVSPEC", Const, 0}, + {"SIOCSETKALIVE", Const, 1}, + {"SIOCSETLABEL", Const, 1}, + {"SIOCSETPFLOW", Const, 1}, + {"SIOCSETPFSYNC", Const, 1}, + {"SIOCSETVLAN", Const, 0}, + {"SIOCSHIWAT", Const, 0}, + {"SIOCSIFADDR", Const, 0}, + {"SIOCSIFADDRPREF", Const, 1}, + {"SIOCSIFALTMTU", Const, 0}, + {"SIOCSIFASYNCMAP", Const, 0}, + {"SIOCSIFBOND", Const, 0}, + {"SIOCSIFBR", Const, 0}, + {"SIOCSIFBRDADDR", Const, 0}, + {"SIOCSIFCAP", Const, 0}, + {"SIOCSIFDESCR", Const, 0}, + {"SIOCSIFDSTADDR", Const, 0}, + {"SIOCSIFENCAP", Const, 0}, + {"SIOCSIFFIB", Const, 1}, + {"SIOCSIFFLAGS", Const, 0}, + {"SIOCSIFGATTR", Const, 1}, + {"SIOCSIFGENERIC", Const, 0}, + {"SIOCSIFHWADDR", Const, 0}, + {"SIOCSIFHWBROADCAST", Const, 0}, + {"SIOCSIFKPI", Const, 0}, + {"SIOCSIFLINK", Const, 0}, + {"SIOCSIFLLADDR", Const, 0}, + {"SIOCSIFMAC", Const, 0}, + {"SIOCSIFMAP", Const, 0}, + {"SIOCSIFMEDIA", Const, 0}, + {"SIOCSIFMEM", Const, 0}, + {"SIOCSIFMETRIC", Const, 0}, + {"SIOCSIFMTU", Const, 0}, + {"SIOCSIFNAME", Const, 0}, + {"SIOCSIFNETMASK", Const, 0}, + {"SIOCSIFPFLAGS", Const, 0}, + {"SIOCSIFPHYADDR", Const, 0}, + {"SIOCSIFPHYS", Const, 0}, + {"SIOCSIFPRIORITY", Const, 1}, + {"SIOCSIFRDOMAIN", Const, 1}, + {"SIOCSIFRTLABEL", Const, 1}, + {"SIOCSIFRVNET", Const, 0}, + {"SIOCSIFSLAVE", Const, 0}, + {"SIOCSIFTIMESLOT", Const, 1}, + {"SIOCSIFTXQLEN", Const, 0}, + {"SIOCSIFVLAN", Const, 0}, + {"SIOCSIFVNET", Const, 0}, + {"SIOCSIFXFLAGS", Const, 1}, + {"SIOCSLIFPHYADDR", Const, 0}, + {"SIOCSLIFPHYRTABLE", Const, 1}, + {"SIOCSLIFPHYTTL", Const, 3}, + {"SIOCSLINKSTR", Const, 1}, + {"SIOCSLOWAT", Const, 0}, + {"SIOCSPGRP", Const, 0}, + {"SIOCSRARP", Const, 0}, + {"SIOCSSPPPPARAMS", Const, 3}, + {"SIOCSVH", Const, 1}, + {"SIOCSVNETID", Const, 3}, + {"SIOCZIFDATA", Const, 1}, + {"SIO_GET_EXTENSION_FUNCTION_POINTER", Const, 1}, + {"SIO_GET_INTERFACE_LIST", Const, 0}, + {"SIO_KEEPALIVE_VALS", Const, 3}, + {"SIO_UDP_CONNRESET", Const, 4}, + {"SOCK_CLOEXEC", Const, 0}, + {"SOCK_DCCP", Const, 0}, + {"SOCK_DGRAM", Const, 0}, + {"SOCK_FLAGS_MASK", Const, 1}, + {"SOCK_MAXADDRLEN", Const, 0}, + {"SOCK_NONBLOCK", Const, 0}, + {"SOCK_NOSIGPIPE", Const, 1}, + {"SOCK_PACKET", Const, 0}, + {"SOCK_RAW", Const, 0}, + {"SOCK_RDM", Const, 0}, + {"SOCK_SEQPACKET", Const, 0}, + {"SOCK_STREAM", Const, 0}, + {"SOL_AAL", Const, 0}, + {"SOL_ATM", Const, 0}, + {"SOL_DECNET", Const, 0}, + {"SOL_ICMPV6", Const, 0}, + {"SOL_IP", Const, 0}, + {"SOL_IPV6", Const, 0}, + {"SOL_IRDA", Const, 0}, + {"SOL_PACKET", Const, 0}, + {"SOL_RAW", Const, 0}, + {"SOL_SOCKET", Const, 0}, + {"SOL_TCP", Const, 0}, + {"SOL_X25", Const, 0}, + {"SOMAXCONN", Const, 0}, + {"SO_ACCEPTCONN", Const, 0}, + {"SO_ACCEPTFILTER", Const, 0}, + {"SO_ATTACH_FILTER", Const, 0}, + {"SO_BINDANY", Const, 1}, + {"SO_BINDTODEVICE", Const, 0}, + {"SO_BINTIME", Const, 0}, + {"SO_BROADCAST", Const, 0}, + {"SO_BSDCOMPAT", Const, 0}, + {"SO_DEBUG", Const, 0}, + {"SO_DETACH_FILTER", Const, 0}, + {"SO_DOMAIN", Const, 0}, + {"SO_DONTROUTE", Const, 0}, + {"SO_DONTTRUNC", Const, 0}, + {"SO_ERROR", Const, 0}, + {"SO_KEEPALIVE", Const, 0}, + {"SO_LABEL", Const, 0}, + {"SO_LINGER", Const, 0}, + {"SO_LINGER_SEC", Const, 0}, + {"SO_LISTENINCQLEN", Const, 0}, + {"SO_LISTENQLEN", Const, 0}, + {"SO_LISTENQLIMIT", Const, 0}, + {"SO_MARK", Const, 0}, + {"SO_NETPROC", Const, 1}, + {"SO_NKE", Const, 0}, + {"SO_NOADDRERR", Const, 0}, + {"SO_NOHEADER", Const, 1}, + {"SO_NOSIGPIPE", Const, 0}, + {"SO_NOTIFYCONFLICT", Const, 0}, + {"SO_NO_CHECK", Const, 0}, + {"SO_NO_DDP", Const, 0}, + {"SO_NO_OFFLOAD", Const, 0}, + {"SO_NP_EXTENSIONS", Const, 0}, + {"SO_NREAD", Const, 0}, + {"SO_NUMRCVPKT", Const, 16}, + {"SO_NWRITE", Const, 0}, + {"SO_OOBINLINE", Const, 0}, + {"SO_OVERFLOWED", Const, 1}, + {"SO_PASSCRED", Const, 0}, + {"SO_PASSSEC", Const, 0}, + {"SO_PEERCRED", Const, 0}, + {"SO_PEERLABEL", Const, 0}, + {"SO_PEERNAME", Const, 0}, + {"SO_PEERSEC", Const, 0}, + {"SO_PRIORITY", Const, 0}, + {"SO_PROTOCOL", Const, 0}, + {"SO_PROTOTYPE", Const, 1}, + {"SO_RANDOMPORT", Const, 0}, + {"SO_RCVBUF", Const, 0}, + {"SO_RCVBUFFORCE", Const, 0}, + {"SO_RCVLOWAT", Const, 0}, + {"SO_RCVTIMEO", Const, 0}, + {"SO_RESTRICTIONS", Const, 0}, + {"SO_RESTRICT_DENYIN", Const, 0}, + {"SO_RESTRICT_DENYOUT", Const, 0}, + {"SO_RESTRICT_DENYSET", Const, 0}, + {"SO_REUSEADDR", Const, 0}, + {"SO_REUSEPORT", Const, 0}, + {"SO_REUSESHAREUID", Const, 0}, + {"SO_RTABLE", Const, 1}, + {"SO_RXQ_OVFL", Const, 0}, + {"SO_SECURITY_AUTHENTICATION", Const, 0}, + {"SO_SECURITY_ENCRYPTION_NETWORK", Const, 0}, + {"SO_SECURITY_ENCRYPTION_TRANSPORT", Const, 0}, + {"SO_SETFIB", Const, 0}, + {"SO_SNDBUF", Const, 0}, + {"SO_SNDBUFFORCE", Const, 0}, + {"SO_SNDLOWAT", Const, 0}, + {"SO_SNDTIMEO", Const, 0}, + {"SO_SPLICE", Const, 1}, + {"SO_TIMESTAMP", Const, 0}, + {"SO_TIMESTAMPING", Const, 0}, + {"SO_TIMESTAMPNS", Const, 0}, + {"SO_TIMESTAMP_MONOTONIC", Const, 0}, + {"SO_TYPE", Const, 0}, + {"SO_UPCALLCLOSEWAIT", Const, 0}, + {"SO_UPDATE_ACCEPT_CONTEXT", Const, 0}, + {"SO_UPDATE_CONNECT_CONTEXT", Const, 1}, + {"SO_USELOOPBACK", Const, 0}, + {"SO_USER_COOKIE", Const, 1}, + {"SO_VENDOR", Const, 3}, + {"SO_WANTMORE", Const, 0}, + {"SO_WANTOOBFLAG", Const, 0}, + {"SSLExtraCertChainPolicyPara", Type, 0}, + {"SSLExtraCertChainPolicyPara.AuthType", Field, 0}, + {"SSLExtraCertChainPolicyPara.Checks", Field, 0}, + {"SSLExtraCertChainPolicyPara.ServerName", Field, 0}, + {"SSLExtraCertChainPolicyPara.Size", Field, 0}, + {"STANDARD_RIGHTS_ALL", Const, 0}, + {"STANDARD_RIGHTS_EXECUTE", Const, 0}, + {"STANDARD_RIGHTS_READ", Const, 0}, + {"STANDARD_RIGHTS_REQUIRED", Const, 0}, + {"STANDARD_RIGHTS_WRITE", Const, 0}, + {"STARTF_USESHOWWINDOW", Const, 0}, + {"STARTF_USESTDHANDLES", Const, 0}, + {"STD_ERROR_HANDLE", Const, 0}, + {"STD_INPUT_HANDLE", Const, 0}, + {"STD_OUTPUT_HANDLE", Const, 0}, + {"SUBLANG_ENGLISH_US", Const, 0}, + {"SW_FORCEMINIMIZE", Const, 0}, + {"SW_HIDE", Const, 0}, + {"SW_MAXIMIZE", Const, 0}, + {"SW_MINIMIZE", Const, 0}, + {"SW_NORMAL", Const, 0}, + {"SW_RESTORE", Const, 0}, + {"SW_SHOW", Const, 0}, + {"SW_SHOWDEFAULT", Const, 0}, + {"SW_SHOWMAXIMIZED", Const, 0}, + {"SW_SHOWMINIMIZED", Const, 0}, + {"SW_SHOWMINNOACTIVE", Const, 0}, + {"SW_SHOWNA", Const, 0}, + {"SW_SHOWNOACTIVATE", Const, 0}, + {"SW_SHOWNORMAL", Const, 0}, + {"SYMBOLIC_LINK_FLAG_DIRECTORY", Const, 4}, + {"SYNCHRONIZE", Const, 0}, + {"SYSCTL_VERSION", Const, 1}, + {"SYSCTL_VERS_0", Const, 1}, + {"SYSCTL_VERS_1", Const, 1}, + {"SYSCTL_VERS_MASK", Const, 1}, + {"SYS_ABORT2", Const, 0}, + {"SYS_ACCEPT", Const, 0}, + {"SYS_ACCEPT4", Const, 0}, + {"SYS_ACCEPT_NOCANCEL", Const, 0}, + {"SYS_ACCESS", Const, 0}, + {"SYS_ACCESS_EXTENDED", Const, 0}, + {"SYS_ACCT", Const, 0}, + {"SYS_ADD_KEY", Const, 0}, + {"SYS_ADD_PROFIL", Const, 0}, + {"SYS_ADJFREQ", Const, 1}, + {"SYS_ADJTIME", Const, 0}, + {"SYS_ADJTIMEX", Const, 0}, + {"SYS_AFS_SYSCALL", Const, 0}, + {"SYS_AIO_CANCEL", Const, 0}, + {"SYS_AIO_ERROR", Const, 0}, + {"SYS_AIO_FSYNC", Const, 0}, + {"SYS_AIO_MLOCK", Const, 14}, + {"SYS_AIO_READ", Const, 0}, + {"SYS_AIO_RETURN", Const, 0}, + {"SYS_AIO_SUSPEND", Const, 0}, + {"SYS_AIO_SUSPEND_NOCANCEL", Const, 0}, + {"SYS_AIO_WAITCOMPLETE", Const, 14}, + {"SYS_AIO_WRITE", Const, 0}, + {"SYS_ALARM", Const, 0}, + {"SYS_ARCH_PRCTL", Const, 0}, + {"SYS_ARM_FADVISE64_64", Const, 0}, + {"SYS_ARM_SYNC_FILE_RANGE", Const, 0}, + {"SYS_ATGETMSG", Const, 0}, + {"SYS_ATPGETREQ", Const, 0}, + {"SYS_ATPGETRSP", Const, 0}, + {"SYS_ATPSNDREQ", Const, 0}, + {"SYS_ATPSNDRSP", Const, 0}, + {"SYS_ATPUTMSG", Const, 0}, + {"SYS_ATSOCKET", Const, 0}, + {"SYS_AUDIT", Const, 0}, + {"SYS_AUDITCTL", Const, 0}, + {"SYS_AUDITON", Const, 0}, + {"SYS_AUDIT_SESSION_JOIN", Const, 0}, + {"SYS_AUDIT_SESSION_PORT", Const, 0}, + {"SYS_AUDIT_SESSION_SELF", Const, 0}, + {"SYS_BDFLUSH", Const, 0}, + {"SYS_BIND", Const, 0}, + {"SYS_BINDAT", Const, 3}, + {"SYS_BREAK", Const, 0}, + {"SYS_BRK", Const, 0}, + {"SYS_BSDTHREAD_CREATE", Const, 0}, + {"SYS_BSDTHREAD_REGISTER", Const, 0}, + {"SYS_BSDTHREAD_TERMINATE", Const, 0}, + {"SYS_CAPGET", Const, 0}, + {"SYS_CAPSET", Const, 0}, + {"SYS_CAP_ENTER", Const, 0}, + {"SYS_CAP_FCNTLS_GET", Const, 1}, + {"SYS_CAP_FCNTLS_LIMIT", Const, 1}, + {"SYS_CAP_GETMODE", Const, 0}, + {"SYS_CAP_GETRIGHTS", Const, 0}, + {"SYS_CAP_IOCTLS_GET", Const, 1}, + {"SYS_CAP_IOCTLS_LIMIT", Const, 1}, + {"SYS_CAP_NEW", Const, 0}, + {"SYS_CAP_RIGHTS_GET", Const, 1}, + {"SYS_CAP_RIGHTS_LIMIT", Const, 1}, + {"SYS_CHDIR", Const, 0}, + {"SYS_CHFLAGS", Const, 0}, + {"SYS_CHFLAGSAT", Const, 3}, + {"SYS_CHMOD", Const, 0}, + {"SYS_CHMOD_EXTENDED", Const, 0}, + {"SYS_CHOWN", Const, 0}, + {"SYS_CHOWN32", Const, 0}, + {"SYS_CHROOT", Const, 0}, + {"SYS_CHUD", Const, 0}, + {"SYS_CLOCK_ADJTIME", Const, 0}, + {"SYS_CLOCK_GETCPUCLOCKID2", Const, 1}, + {"SYS_CLOCK_GETRES", Const, 0}, + {"SYS_CLOCK_GETTIME", Const, 0}, + {"SYS_CLOCK_NANOSLEEP", Const, 0}, + {"SYS_CLOCK_SETTIME", Const, 0}, + {"SYS_CLONE", Const, 0}, + {"SYS_CLOSE", Const, 0}, + {"SYS_CLOSEFROM", Const, 0}, + {"SYS_CLOSE_NOCANCEL", Const, 0}, + {"SYS_CONNECT", Const, 0}, + {"SYS_CONNECTAT", Const, 3}, + {"SYS_CONNECT_NOCANCEL", Const, 0}, + {"SYS_COPYFILE", Const, 0}, + {"SYS_CPUSET", Const, 0}, + {"SYS_CPUSET_GETAFFINITY", Const, 0}, + {"SYS_CPUSET_GETID", Const, 0}, + {"SYS_CPUSET_SETAFFINITY", Const, 0}, + {"SYS_CPUSET_SETID", Const, 0}, + {"SYS_CREAT", Const, 0}, + {"SYS_CREATE_MODULE", Const, 0}, + {"SYS_CSOPS", Const, 0}, + {"SYS_CSOPS_AUDITTOKEN", Const, 16}, + {"SYS_DELETE", Const, 0}, + {"SYS_DELETE_MODULE", Const, 0}, + {"SYS_DUP", Const, 0}, + {"SYS_DUP2", Const, 0}, + {"SYS_DUP3", Const, 0}, + {"SYS_EACCESS", Const, 0}, + {"SYS_EPOLL_CREATE", Const, 0}, + {"SYS_EPOLL_CREATE1", Const, 0}, + {"SYS_EPOLL_CTL", Const, 0}, + {"SYS_EPOLL_CTL_OLD", Const, 0}, + {"SYS_EPOLL_PWAIT", Const, 0}, + {"SYS_EPOLL_WAIT", Const, 0}, + {"SYS_EPOLL_WAIT_OLD", Const, 0}, + {"SYS_EVENTFD", Const, 0}, + {"SYS_EVENTFD2", Const, 0}, + {"SYS_EXCHANGEDATA", Const, 0}, + {"SYS_EXECVE", Const, 0}, + {"SYS_EXIT", Const, 0}, + {"SYS_EXIT_GROUP", Const, 0}, + {"SYS_EXTATTRCTL", Const, 0}, + {"SYS_EXTATTR_DELETE_FD", Const, 0}, + {"SYS_EXTATTR_DELETE_FILE", Const, 0}, + {"SYS_EXTATTR_DELETE_LINK", Const, 0}, + {"SYS_EXTATTR_GET_FD", Const, 0}, + {"SYS_EXTATTR_GET_FILE", Const, 0}, + {"SYS_EXTATTR_GET_LINK", Const, 0}, + {"SYS_EXTATTR_LIST_FD", Const, 0}, + {"SYS_EXTATTR_LIST_FILE", Const, 0}, + {"SYS_EXTATTR_LIST_LINK", Const, 0}, + {"SYS_EXTATTR_SET_FD", Const, 0}, + {"SYS_EXTATTR_SET_FILE", Const, 0}, + {"SYS_EXTATTR_SET_LINK", Const, 0}, + {"SYS_FACCESSAT", Const, 0}, + {"SYS_FADVISE64", Const, 0}, + {"SYS_FADVISE64_64", Const, 0}, + {"SYS_FALLOCATE", Const, 0}, + {"SYS_FANOTIFY_INIT", Const, 0}, + {"SYS_FANOTIFY_MARK", Const, 0}, + {"SYS_FCHDIR", Const, 0}, + {"SYS_FCHFLAGS", Const, 0}, + {"SYS_FCHMOD", Const, 0}, + {"SYS_FCHMODAT", Const, 0}, + {"SYS_FCHMOD_EXTENDED", Const, 0}, + {"SYS_FCHOWN", Const, 0}, + {"SYS_FCHOWN32", Const, 0}, + {"SYS_FCHOWNAT", Const, 0}, + {"SYS_FCHROOT", Const, 1}, + {"SYS_FCNTL", Const, 0}, + {"SYS_FCNTL64", Const, 0}, + {"SYS_FCNTL_NOCANCEL", Const, 0}, + {"SYS_FDATASYNC", Const, 0}, + {"SYS_FEXECVE", Const, 0}, + {"SYS_FFCLOCK_GETCOUNTER", Const, 0}, + {"SYS_FFCLOCK_GETESTIMATE", Const, 0}, + {"SYS_FFCLOCK_SETESTIMATE", Const, 0}, + {"SYS_FFSCTL", Const, 0}, + {"SYS_FGETATTRLIST", Const, 0}, + {"SYS_FGETXATTR", Const, 0}, + {"SYS_FHOPEN", Const, 0}, + {"SYS_FHSTAT", Const, 0}, + {"SYS_FHSTATFS", Const, 0}, + {"SYS_FILEPORT_MAKEFD", Const, 0}, + {"SYS_FILEPORT_MAKEPORT", Const, 0}, + {"SYS_FKTRACE", Const, 1}, + {"SYS_FLISTXATTR", Const, 0}, + {"SYS_FLOCK", Const, 0}, + {"SYS_FORK", Const, 0}, + {"SYS_FPATHCONF", Const, 0}, + {"SYS_FREEBSD6_FTRUNCATE", Const, 0}, + {"SYS_FREEBSD6_LSEEK", Const, 0}, + {"SYS_FREEBSD6_MMAP", Const, 0}, + {"SYS_FREEBSD6_PREAD", Const, 0}, + {"SYS_FREEBSD6_PWRITE", Const, 0}, + {"SYS_FREEBSD6_TRUNCATE", Const, 0}, + {"SYS_FREMOVEXATTR", Const, 0}, + {"SYS_FSCTL", Const, 0}, + {"SYS_FSETATTRLIST", Const, 0}, + {"SYS_FSETXATTR", Const, 0}, + {"SYS_FSGETPATH", Const, 0}, + {"SYS_FSTAT", Const, 0}, + {"SYS_FSTAT64", Const, 0}, + {"SYS_FSTAT64_EXTENDED", Const, 0}, + {"SYS_FSTATAT", Const, 0}, + {"SYS_FSTATAT64", Const, 0}, + {"SYS_FSTATFS", Const, 0}, + {"SYS_FSTATFS64", Const, 0}, + {"SYS_FSTATV", Const, 0}, + {"SYS_FSTATVFS1", Const, 1}, + {"SYS_FSTAT_EXTENDED", Const, 0}, + {"SYS_FSYNC", Const, 0}, + {"SYS_FSYNC_NOCANCEL", Const, 0}, + {"SYS_FSYNC_RANGE", Const, 1}, + {"SYS_FTIME", Const, 0}, + {"SYS_FTRUNCATE", Const, 0}, + {"SYS_FTRUNCATE64", Const, 0}, + {"SYS_FUTEX", Const, 0}, + {"SYS_FUTIMENS", Const, 1}, + {"SYS_FUTIMES", Const, 0}, + {"SYS_FUTIMESAT", Const, 0}, + {"SYS_GETATTRLIST", Const, 0}, + {"SYS_GETAUDIT", Const, 0}, + {"SYS_GETAUDIT_ADDR", Const, 0}, + {"SYS_GETAUID", Const, 0}, + {"SYS_GETCONTEXT", Const, 0}, + {"SYS_GETCPU", Const, 0}, + {"SYS_GETCWD", Const, 0}, + {"SYS_GETDENTS", Const, 0}, + {"SYS_GETDENTS64", Const, 0}, + {"SYS_GETDIRENTRIES", Const, 0}, + {"SYS_GETDIRENTRIES64", Const, 0}, + {"SYS_GETDIRENTRIESATTR", Const, 0}, + {"SYS_GETDTABLECOUNT", Const, 1}, + {"SYS_GETDTABLESIZE", Const, 0}, + {"SYS_GETEGID", Const, 0}, + {"SYS_GETEGID32", Const, 0}, + {"SYS_GETEUID", Const, 0}, + {"SYS_GETEUID32", Const, 0}, + {"SYS_GETFH", Const, 0}, + {"SYS_GETFSSTAT", Const, 0}, + {"SYS_GETFSSTAT64", Const, 0}, + {"SYS_GETGID", Const, 0}, + {"SYS_GETGID32", Const, 0}, + {"SYS_GETGROUPS", Const, 0}, + {"SYS_GETGROUPS32", Const, 0}, + {"SYS_GETHOSTUUID", Const, 0}, + {"SYS_GETITIMER", Const, 0}, + {"SYS_GETLCID", Const, 0}, + {"SYS_GETLOGIN", Const, 0}, + {"SYS_GETLOGINCLASS", Const, 0}, + {"SYS_GETPEERNAME", Const, 0}, + {"SYS_GETPGID", Const, 0}, + {"SYS_GETPGRP", Const, 0}, + {"SYS_GETPID", Const, 0}, + {"SYS_GETPMSG", Const, 0}, + {"SYS_GETPPID", Const, 0}, + {"SYS_GETPRIORITY", Const, 0}, + {"SYS_GETRESGID", Const, 0}, + {"SYS_GETRESGID32", Const, 0}, + {"SYS_GETRESUID", Const, 0}, + {"SYS_GETRESUID32", Const, 0}, + {"SYS_GETRLIMIT", Const, 0}, + {"SYS_GETRTABLE", Const, 1}, + {"SYS_GETRUSAGE", Const, 0}, + {"SYS_GETSGROUPS", Const, 0}, + {"SYS_GETSID", Const, 0}, + {"SYS_GETSOCKNAME", Const, 0}, + {"SYS_GETSOCKOPT", Const, 0}, + {"SYS_GETTHRID", Const, 1}, + {"SYS_GETTID", Const, 0}, + {"SYS_GETTIMEOFDAY", Const, 0}, + {"SYS_GETUID", Const, 0}, + {"SYS_GETUID32", Const, 0}, + {"SYS_GETVFSSTAT", Const, 1}, + {"SYS_GETWGROUPS", Const, 0}, + {"SYS_GETXATTR", Const, 0}, + {"SYS_GET_KERNEL_SYMS", Const, 0}, + {"SYS_GET_MEMPOLICY", Const, 0}, + {"SYS_GET_ROBUST_LIST", Const, 0}, + {"SYS_GET_THREAD_AREA", Const, 0}, + {"SYS_GSSD_SYSCALL", Const, 14}, + {"SYS_GTTY", Const, 0}, + {"SYS_IDENTITYSVC", Const, 0}, + {"SYS_IDLE", Const, 0}, + {"SYS_INITGROUPS", Const, 0}, + {"SYS_INIT_MODULE", Const, 0}, + {"SYS_INOTIFY_ADD_WATCH", Const, 0}, + {"SYS_INOTIFY_INIT", Const, 0}, + {"SYS_INOTIFY_INIT1", Const, 0}, + {"SYS_INOTIFY_RM_WATCH", Const, 0}, + {"SYS_IOCTL", Const, 0}, + {"SYS_IOPERM", Const, 0}, + {"SYS_IOPL", Const, 0}, + {"SYS_IOPOLICYSYS", Const, 0}, + {"SYS_IOPRIO_GET", Const, 0}, + {"SYS_IOPRIO_SET", Const, 0}, + {"SYS_IO_CANCEL", Const, 0}, + {"SYS_IO_DESTROY", Const, 0}, + {"SYS_IO_GETEVENTS", Const, 0}, + {"SYS_IO_SETUP", Const, 0}, + {"SYS_IO_SUBMIT", Const, 0}, + {"SYS_IPC", Const, 0}, + {"SYS_ISSETUGID", Const, 0}, + {"SYS_JAIL", Const, 0}, + {"SYS_JAIL_ATTACH", Const, 0}, + {"SYS_JAIL_GET", Const, 0}, + {"SYS_JAIL_REMOVE", Const, 0}, + {"SYS_JAIL_SET", Const, 0}, + {"SYS_KAS_INFO", Const, 16}, + {"SYS_KDEBUG_TRACE", Const, 0}, + {"SYS_KENV", Const, 0}, + {"SYS_KEVENT", Const, 0}, + {"SYS_KEVENT64", Const, 0}, + {"SYS_KEXEC_LOAD", Const, 0}, + {"SYS_KEYCTL", Const, 0}, + {"SYS_KILL", Const, 0}, + {"SYS_KLDFIND", Const, 0}, + {"SYS_KLDFIRSTMOD", Const, 0}, + {"SYS_KLDLOAD", Const, 0}, + {"SYS_KLDNEXT", Const, 0}, + {"SYS_KLDSTAT", Const, 0}, + {"SYS_KLDSYM", Const, 0}, + {"SYS_KLDUNLOAD", Const, 0}, + {"SYS_KLDUNLOADF", Const, 0}, + {"SYS_KMQ_NOTIFY", Const, 14}, + {"SYS_KMQ_OPEN", Const, 14}, + {"SYS_KMQ_SETATTR", Const, 14}, + {"SYS_KMQ_TIMEDRECEIVE", Const, 14}, + {"SYS_KMQ_TIMEDSEND", Const, 14}, + {"SYS_KMQ_UNLINK", Const, 14}, + {"SYS_KQUEUE", Const, 0}, + {"SYS_KQUEUE1", Const, 1}, + {"SYS_KSEM_CLOSE", Const, 14}, + {"SYS_KSEM_DESTROY", Const, 14}, + {"SYS_KSEM_GETVALUE", Const, 14}, + {"SYS_KSEM_INIT", Const, 14}, + {"SYS_KSEM_OPEN", Const, 14}, + {"SYS_KSEM_POST", Const, 14}, + {"SYS_KSEM_TIMEDWAIT", Const, 14}, + {"SYS_KSEM_TRYWAIT", Const, 14}, + {"SYS_KSEM_UNLINK", Const, 14}, + {"SYS_KSEM_WAIT", Const, 14}, + {"SYS_KTIMER_CREATE", Const, 0}, + {"SYS_KTIMER_DELETE", Const, 0}, + {"SYS_KTIMER_GETOVERRUN", Const, 0}, + {"SYS_KTIMER_GETTIME", Const, 0}, + {"SYS_KTIMER_SETTIME", Const, 0}, + {"SYS_KTRACE", Const, 0}, + {"SYS_LCHFLAGS", Const, 0}, + {"SYS_LCHMOD", Const, 0}, + {"SYS_LCHOWN", Const, 0}, + {"SYS_LCHOWN32", Const, 0}, + {"SYS_LEDGER", Const, 16}, + {"SYS_LGETFH", Const, 0}, + {"SYS_LGETXATTR", Const, 0}, + {"SYS_LINK", Const, 0}, + {"SYS_LINKAT", Const, 0}, + {"SYS_LIO_LISTIO", Const, 0}, + {"SYS_LISTEN", Const, 0}, + {"SYS_LISTXATTR", Const, 0}, + {"SYS_LLISTXATTR", Const, 0}, + {"SYS_LOCK", Const, 0}, + {"SYS_LOOKUP_DCOOKIE", Const, 0}, + {"SYS_LPATHCONF", Const, 0}, + {"SYS_LREMOVEXATTR", Const, 0}, + {"SYS_LSEEK", Const, 0}, + {"SYS_LSETXATTR", Const, 0}, + {"SYS_LSTAT", Const, 0}, + {"SYS_LSTAT64", Const, 0}, + {"SYS_LSTAT64_EXTENDED", Const, 0}, + {"SYS_LSTATV", Const, 0}, + {"SYS_LSTAT_EXTENDED", Const, 0}, + {"SYS_LUTIMES", Const, 0}, + {"SYS_MAC_SYSCALL", Const, 0}, + {"SYS_MADVISE", Const, 0}, + {"SYS_MADVISE1", Const, 0}, + {"SYS_MAXSYSCALL", Const, 0}, + {"SYS_MBIND", Const, 0}, + {"SYS_MIGRATE_PAGES", Const, 0}, + {"SYS_MINCORE", Const, 0}, + {"SYS_MINHERIT", Const, 0}, + {"SYS_MKCOMPLEX", Const, 0}, + {"SYS_MKDIR", Const, 0}, + {"SYS_MKDIRAT", Const, 0}, + {"SYS_MKDIR_EXTENDED", Const, 0}, + {"SYS_MKFIFO", Const, 0}, + {"SYS_MKFIFOAT", Const, 0}, + {"SYS_MKFIFO_EXTENDED", Const, 0}, + {"SYS_MKNOD", Const, 0}, + {"SYS_MKNODAT", Const, 0}, + {"SYS_MLOCK", Const, 0}, + {"SYS_MLOCKALL", Const, 0}, + {"SYS_MMAP", Const, 0}, + {"SYS_MMAP2", Const, 0}, + {"SYS_MODCTL", Const, 1}, + {"SYS_MODFIND", Const, 0}, + {"SYS_MODFNEXT", Const, 0}, + {"SYS_MODIFY_LDT", Const, 0}, + {"SYS_MODNEXT", Const, 0}, + {"SYS_MODSTAT", Const, 0}, + {"SYS_MODWATCH", Const, 0}, + {"SYS_MOUNT", Const, 0}, + {"SYS_MOVE_PAGES", Const, 0}, + {"SYS_MPROTECT", Const, 0}, + {"SYS_MPX", Const, 0}, + {"SYS_MQUERY", Const, 1}, + {"SYS_MQ_GETSETATTR", Const, 0}, + {"SYS_MQ_NOTIFY", Const, 0}, + {"SYS_MQ_OPEN", Const, 0}, + {"SYS_MQ_TIMEDRECEIVE", Const, 0}, + {"SYS_MQ_TIMEDSEND", Const, 0}, + {"SYS_MQ_UNLINK", Const, 0}, + {"SYS_MREMAP", Const, 0}, + {"SYS_MSGCTL", Const, 0}, + {"SYS_MSGGET", Const, 0}, + {"SYS_MSGRCV", Const, 0}, + {"SYS_MSGRCV_NOCANCEL", Const, 0}, + {"SYS_MSGSND", Const, 0}, + {"SYS_MSGSND_NOCANCEL", Const, 0}, + {"SYS_MSGSYS", Const, 0}, + {"SYS_MSYNC", Const, 0}, + {"SYS_MSYNC_NOCANCEL", Const, 0}, + {"SYS_MUNLOCK", Const, 0}, + {"SYS_MUNLOCKALL", Const, 0}, + {"SYS_MUNMAP", Const, 0}, + {"SYS_NAME_TO_HANDLE_AT", Const, 0}, + {"SYS_NANOSLEEP", Const, 0}, + {"SYS_NEWFSTATAT", Const, 0}, + {"SYS_NFSCLNT", Const, 0}, + {"SYS_NFSSERVCTL", Const, 0}, + {"SYS_NFSSVC", Const, 0}, + {"SYS_NFSTAT", Const, 0}, + {"SYS_NICE", Const, 0}, + {"SYS_NLM_SYSCALL", Const, 14}, + {"SYS_NLSTAT", Const, 0}, + {"SYS_NMOUNT", Const, 0}, + {"SYS_NSTAT", Const, 0}, + {"SYS_NTP_ADJTIME", Const, 0}, + {"SYS_NTP_GETTIME", Const, 0}, + {"SYS_NUMA_GETAFFINITY", Const, 14}, + {"SYS_NUMA_SETAFFINITY", Const, 14}, + {"SYS_OABI_SYSCALL_BASE", Const, 0}, + {"SYS_OBREAK", Const, 0}, + {"SYS_OLDFSTAT", Const, 0}, + {"SYS_OLDLSTAT", Const, 0}, + {"SYS_OLDOLDUNAME", Const, 0}, + {"SYS_OLDSTAT", Const, 0}, + {"SYS_OLDUNAME", Const, 0}, + {"SYS_OPEN", Const, 0}, + {"SYS_OPENAT", Const, 0}, + {"SYS_OPENBSD_POLL", Const, 0}, + {"SYS_OPEN_BY_HANDLE_AT", Const, 0}, + {"SYS_OPEN_DPROTECTED_NP", Const, 16}, + {"SYS_OPEN_EXTENDED", Const, 0}, + {"SYS_OPEN_NOCANCEL", Const, 0}, + {"SYS_OVADVISE", Const, 0}, + {"SYS_PACCEPT", Const, 1}, + {"SYS_PATHCONF", Const, 0}, + {"SYS_PAUSE", Const, 0}, + {"SYS_PCICONFIG_IOBASE", Const, 0}, + {"SYS_PCICONFIG_READ", Const, 0}, + {"SYS_PCICONFIG_WRITE", Const, 0}, + {"SYS_PDFORK", Const, 0}, + {"SYS_PDGETPID", Const, 0}, + {"SYS_PDKILL", Const, 0}, + {"SYS_PERF_EVENT_OPEN", Const, 0}, + {"SYS_PERSONALITY", Const, 0}, + {"SYS_PID_HIBERNATE", Const, 0}, + {"SYS_PID_RESUME", Const, 0}, + {"SYS_PID_SHUTDOWN_SOCKETS", Const, 0}, + {"SYS_PID_SUSPEND", Const, 0}, + {"SYS_PIPE", Const, 0}, + {"SYS_PIPE2", Const, 0}, + {"SYS_PIVOT_ROOT", Const, 0}, + {"SYS_PMC_CONTROL", Const, 1}, + {"SYS_PMC_GET_INFO", Const, 1}, + {"SYS_POLL", Const, 0}, + {"SYS_POLLTS", Const, 1}, + {"SYS_POLL_NOCANCEL", Const, 0}, + {"SYS_POSIX_FADVISE", Const, 0}, + {"SYS_POSIX_FALLOCATE", Const, 0}, + {"SYS_POSIX_OPENPT", Const, 0}, + {"SYS_POSIX_SPAWN", Const, 0}, + {"SYS_PPOLL", Const, 0}, + {"SYS_PRCTL", Const, 0}, + {"SYS_PREAD", Const, 0}, + {"SYS_PREAD64", Const, 0}, + {"SYS_PREADV", Const, 0}, + {"SYS_PREAD_NOCANCEL", Const, 0}, + {"SYS_PRLIMIT64", Const, 0}, + {"SYS_PROCCTL", Const, 3}, + {"SYS_PROCESS_POLICY", Const, 0}, + {"SYS_PROCESS_VM_READV", Const, 0}, + {"SYS_PROCESS_VM_WRITEV", Const, 0}, + {"SYS_PROC_INFO", Const, 0}, + {"SYS_PROF", Const, 0}, + {"SYS_PROFIL", Const, 0}, + {"SYS_PSELECT", Const, 0}, + {"SYS_PSELECT6", Const, 0}, + {"SYS_PSET_ASSIGN", Const, 1}, + {"SYS_PSET_CREATE", Const, 1}, + {"SYS_PSET_DESTROY", Const, 1}, + {"SYS_PSYNCH_CVBROAD", Const, 0}, + {"SYS_PSYNCH_CVCLRPREPOST", Const, 0}, + {"SYS_PSYNCH_CVSIGNAL", Const, 0}, + {"SYS_PSYNCH_CVWAIT", Const, 0}, + {"SYS_PSYNCH_MUTEXDROP", Const, 0}, + {"SYS_PSYNCH_MUTEXWAIT", Const, 0}, + {"SYS_PSYNCH_RW_DOWNGRADE", Const, 0}, + {"SYS_PSYNCH_RW_LONGRDLOCK", Const, 0}, + {"SYS_PSYNCH_RW_RDLOCK", Const, 0}, + {"SYS_PSYNCH_RW_UNLOCK", Const, 0}, + {"SYS_PSYNCH_RW_UNLOCK2", Const, 0}, + {"SYS_PSYNCH_RW_UPGRADE", Const, 0}, + {"SYS_PSYNCH_RW_WRLOCK", Const, 0}, + {"SYS_PSYNCH_RW_YIELDWRLOCK", Const, 0}, + {"SYS_PTRACE", Const, 0}, + {"SYS_PUTPMSG", Const, 0}, + {"SYS_PWRITE", Const, 0}, + {"SYS_PWRITE64", Const, 0}, + {"SYS_PWRITEV", Const, 0}, + {"SYS_PWRITE_NOCANCEL", Const, 0}, + {"SYS_QUERY_MODULE", Const, 0}, + {"SYS_QUOTACTL", Const, 0}, + {"SYS_RASCTL", Const, 1}, + {"SYS_RCTL_ADD_RULE", Const, 0}, + {"SYS_RCTL_GET_LIMITS", Const, 0}, + {"SYS_RCTL_GET_RACCT", Const, 0}, + {"SYS_RCTL_GET_RULES", Const, 0}, + {"SYS_RCTL_REMOVE_RULE", Const, 0}, + {"SYS_READ", Const, 0}, + {"SYS_READAHEAD", Const, 0}, + {"SYS_READDIR", Const, 0}, + {"SYS_READLINK", Const, 0}, + {"SYS_READLINKAT", Const, 0}, + {"SYS_READV", Const, 0}, + {"SYS_READV_NOCANCEL", Const, 0}, + {"SYS_READ_NOCANCEL", Const, 0}, + {"SYS_REBOOT", Const, 0}, + {"SYS_RECV", Const, 0}, + {"SYS_RECVFROM", Const, 0}, + {"SYS_RECVFROM_NOCANCEL", Const, 0}, + {"SYS_RECVMMSG", Const, 0}, + {"SYS_RECVMSG", Const, 0}, + {"SYS_RECVMSG_NOCANCEL", Const, 0}, + {"SYS_REMAP_FILE_PAGES", Const, 0}, + {"SYS_REMOVEXATTR", Const, 0}, + {"SYS_RENAME", Const, 0}, + {"SYS_RENAMEAT", Const, 0}, + {"SYS_REQUEST_KEY", Const, 0}, + {"SYS_RESTART_SYSCALL", Const, 0}, + {"SYS_REVOKE", Const, 0}, + {"SYS_RFORK", Const, 0}, + {"SYS_RMDIR", Const, 0}, + {"SYS_RTPRIO", Const, 0}, + {"SYS_RTPRIO_THREAD", Const, 0}, + {"SYS_RT_SIGACTION", Const, 0}, + {"SYS_RT_SIGPENDING", Const, 0}, + {"SYS_RT_SIGPROCMASK", Const, 0}, + {"SYS_RT_SIGQUEUEINFO", Const, 0}, + {"SYS_RT_SIGRETURN", Const, 0}, + {"SYS_RT_SIGSUSPEND", Const, 0}, + {"SYS_RT_SIGTIMEDWAIT", Const, 0}, + {"SYS_RT_TGSIGQUEUEINFO", Const, 0}, + {"SYS_SBRK", Const, 0}, + {"SYS_SCHED_GETAFFINITY", Const, 0}, + {"SYS_SCHED_GETPARAM", Const, 0}, + {"SYS_SCHED_GETSCHEDULER", Const, 0}, + {"SYS_SCHED_GET_PRIORITY_MAX", Const, 0}, + {"SYS_SCHED_GET_PRIORITY_MIN", Const, 0}, + {"SYS_SCHED_RR_GET_INTERVAL", Const, 0}, + {"SYS_SCHED_SETAFFINITY", Const, 0}, + {"SYS_SCHED_SETPARAM", Const, 0}, + {"SYS_SCHED_SETSCHEDULER", Const, 0}, + {"SYS_SCHED_YIELD", Const, 0}, + {"SYS_SCTP_GENERIC_RECVMSG", Const, 0}, + {"SYS_SCTP_GENERIC_SENDMSG", Const, 0}, + {"SYS_SCTP_GENERIC_SENDMSG_IOV", Const, 0}, + {"SYS_SCTP_PEELOFF", Const, 0}, + {"SYS_SEARCHFS", Const, 0}, + {"SYS_SECURITY", Const, 0}, + {"SYS_SELECT", Const, 0}, + {"SYS_SELECT_NOCANCEL", Const, 0}, + {"SYS_SEMCONFIG", Const, 1}, + {"SYS_SEMCTL", Const, 0}, + {"SYS_SEMGET", Const, 0}, + {"SYS_SEMOP", Const, 0}, + {"SYS_SEMSYS", Const, 0}, + {"SYS_SEMTIMEDOP", Const, 0}, + {"SYS_SEM_CLOSE", Const, 0}, + {"SYS_SEM_DESTROY", Const, 0}, + {"SYS_SEM_GETVALUE", Const, 0}, + {"SYS_SEM_INIT", Const, 0}, + {"SYS_SEM_OPEN", Const, 0}, + {"SYS_SEM_POST", Const, 0}, + {"SYS_SEM_TRYWAIT", Const, 0}, + {"SYS_SEM_UNLINK", Const, 0}, + {"SYS_SEM_WAIT", Const, 0}, + {"SYS_SEM_WAIT_NOCANCEL", Const, 0}, + {"SYS_SEND", Const, 0}, + {"SYS_SENDFILE", Const, 0}, + {"SYS_SENDFILE64", Const, 0}, + {"SYS_SENDMMSG", Const, 0}, + {"SYS_SENDMSG", Const, 0}, + {"SYS_SENDMSG_NOCANCEL", Const, 0}, + {"SYS_SENDTO", Const, 0}, + {"SYS_SENDTO_NOCANCEL", Const, 0}, + {"SYS_SETATTRLIST", Const, 0}, + {"SYS_SETAUDIT", Const, 0}, + {"SYS_SETAUDIT_ADDR", Const, 0}, + {"SYS_SETAUID", Const, 0}, + {"SYS_SETCONTEXT", Const, 0}, + {"SYS_SETDOMAINNAME", Const, 0}, + {"SYS_SETEGID", Const, 0}, + {"SYS_SETEUID", Const, 0}, + {"SYS_SETFIB", Const, 0}, + {"SYS_SETFSGID", Const, 0}, + {"SYS_SETFSGID32", Const, 0}, + {"SYS_SETFSUID", Const, 0}, + {"SYS_SETFSUID32", Const, 0}, + {"SYS_SETGID", Const, 0}, + {"SYS_SETGID32", Const, 0}, + {"SYS_SETGROUPS", Const, 0}, + {"SYS_SETGROUPS32", Const, 0}, + {"SYS_SETHOSTNAME", Const, 0}, + {"SYS_SETITIMER", Const, 0}, + {"SYS_SETLCID", Const, 0}, + {"SYS_SETLOGIN", Const, 0}, + {"SYS_SETLOGINCLASS", Const, 0}, + {"SYS_SETNS", Const, 0}, + {"SYS_SETPGID", Const, 0}, + {"SYS_SETPRIORITY", Const, 0}, + {"SYS_SETPRIVEXEC", Const, 0}, + {"SYS_SETREGID", Const, 0}, + {"SYS_SETREGID32", Const, 0}, + {"SYS_SETRESGID", Const, 0}, + {"SYS_SETRESGID32", Const, 0}, + {"SYS_SETRESUID", Const, 0}, + {"SYS_SETRESUID32", Const, 0}, + {"SYS_SETREUID", Const, 0}, + {"SYS_SETREUID32", Const, 0}, + {"SYS_SETRLIMIT", Const, 0}, + {"SYS_SETRTABLE", Const, 1}, + {"SYS_SETSGROUPS", Const, 0}, + {"SYS_SETSID", Const, 0}, + {"SYS_SETSOCKOPT", Const, 0}, + {"SYS_SETTID", Const, 0}, + {"SYS_SETTID_WITH_PID", Const, 0}, + {"SYS_SETTIMEOFDAY", Const, 0}, + {"SYS_SETUID", Const, 0}, + {"SYS_SETUID32", Const, 0}, + {"SYS_SETWGROUPS", Const, 0}, + {"SYS_SETXATTR", Const, 0}, + {"SYS_SET_MEMPOLICY", Const, 0}, + {"SYS_SET_ROBUST_LIST", Const, 0}, + {"SYS_SET_THREAD_AREA", Const, 0}, + {"SYS_SET_TID_ADDRESS", Const, 0}, + {"SYS_SGETMASK", Const, 0}, + {"SYS_SHARED_REGION_CHECK_NP", Const, 0}, + {"SYS_SHARED_REGION_MAP_AND_SLIDE_NP", Const, 0}, + {"SYS_SHMAT", Const, 0}, + {"SYS_SHMCTL", Const, 0}, + {"SYS_SHMDT", Const, 0}, + {"SYS_SHMGET", Const, 0}, + {"SYS_SHMSYS", Const, 0}, + {"SYS_SHM_OPEN", Const, 0}, + {"SYS_SHM_UNLINK", Const, 0}, + {"SYS_SHUTDOWN", Const, 0}, + {"SYS_SIGACTION", Const, 0}, + {"SYS_SIGALTSTACK", Const, 0}, + {"SYS_SIGNAL", Const, 0}, + {"SYS_SIGNALFD", Const, 0}, + {"SYS_SIGNALFD4", Const, 0}, + {"SYS_SIGPENDING", Const, 0}, + {"SYS_SIGPROCMASK", Const, 0}, + {"SYS_SIGQUEUE", Const, 0}, + {"SYS_SIGQUEUEINFO", Const, 1}, + {"SYS_SIGRETURN", Const, 0}, + {"SYS_SIGSUSPEND", Const, 0}, + {"SYS_SIGSUSPEND_NOCANCEL", Const, 0}, + {"SYS_SIGTIMEDWAIT", Const, 0}, + {"SYS_SIGWAIT", Const, 0}, + {"SYS_SIGWAITINFO", Const, 0}, + {"SYS_SOCKET", Const, 0}, + {"SYS_SOCKETCALL", Const, 0}, + {"SYS_SOCKETPAIR", Const, 0}, + {"SYS_SPLICE", Const, 0}, + {"SYS_SSETMASK", Const, 0}, + {"SYS_SSTK", Const, 0}, + {"SYS_STACK_SNAPSHOT", Const, 0}, + {"SYS_STAT", Const, 0}, + {"SYS_STAT64", Const, 0}, + {"SYS_STAT64_EXTENDED", Const, 0}, + {"SYS_STATFS", Const, 0}, + {"SYS_STATFS64", Const, 0}, + {"SYS_STATV", Const, 0}, + {"SYS_STATVFS1", Const, 1}, + {"SYS_STAT_EXTENDED", Const, 0}, + {"SYS_STIME", Const, 0}, + {"SYS_STTY", Const, 0}, + {"SYS_SWAPCONTEXT", Const, 0}, + {"SYS_SWAPCTL", Const, 1}, + {"SYS_SWAPOFF", Const, 0}, + {"SYS_SWAPON", Const, 0}, + {"SYS_SYMLINK", Const, 0}, + {"SYS_SYMLINKAT", Const, 0}, + {"SYS_SYNC", Const, 0}, + {"SYS_SYNCFS", Const, 0}, + {"SYS_SYNC_FILE_RANGE", Const, 0}, + {"SYS_SYSARCH", Const, 0}, + {"SYS_SYSCALL", Const, 0}, + {"SYS_SYSCALL_BASE", Const, 0}, + {"SYS_SYSFS", Const, 0}, + {"SYS_SYSINFO", Const, 0}, + {"SYS_SYSLOG", Const, 0}, + {"SYS_TEE", Const, 0}, + {"SYS_TGKILL", Const, 0}, + {"SYS_THREAD_SELFID", Const, 0}, + {"SYS_THR_CREATE", Const, 0}, + {"SYS_THR_EXIT", Const, 0}, + {"SYS_THR_KILL", Const, 0}, + {"SYS_THR_KILL2", Const, 0}, + {"SYS_THR_NEW", Const, 0}, + {"SYS_THR_SELF", Const, 0}, + {"SYS_THR_SET_NAME", Const, 0}, + {"SYS_THR_SUSPEND", Const, 0}, + {"SYS_THR_WAKE", Const, 0}, + {"SYS_TIME", Const, 0}, + {"SYS_TIMERFD_CREATE", Const, 0}, + {"SYS_TIMERFD_GETTIME", Const, 0}, + {"SYS_TIMERFD_SETTIME", Const, 0}, + {"SYS_TIMER_CREATE", Const, 0}, + {"SYS_TIMER_DELETE", Const, 0}, + {"SYS_TIMER_GETOVERRUN", Const, 0}, + {"SYS_TIMER_GETTIME", Const, 0}, + {"SYS_TIMER_SETTIME", Const, 0}, + {"SYS_TIMES", Const, 0}, + {"SYS_TKILL", Const, 0}, + {"SYS_TRUNCATE", Const, 0}, + {"SYS_TRUNCATE64", Const, 0}, + {"SYS_TUXCALL", Const, 0}, + {"SYS_UGETRLIMIT", Const, 0}, + {"SYS_ULIMIT", Const, 0}, + {"SYS_UMASK", Const, 0}, + {"SYS_UMASK_EXTENDED", Const, 0}, + {"SYS_UMOUNT", Const, 0}, + {"SYS_UMOUNT2", Const, 0}, + {"SYS_UNAME", Const, 0}, + {"SYS_UNDELETE", Const, 0}, + {"SYS_UNLINK", Const, 0}, + {"SYS_UNLINKAT", Const, 0}, + {"SYS_UNMOUNT", Const, 0}, + {"SYS_UNSHARE", Const, 0}, + {"SYS_USELIB", Const, 0}, + {"SYS_USTAT", Const, 0}, + {"SYS_UTIME", Const, 0}, + {"SYS_UTIMENSAT", Const, 0}, + {"SYS_UTIMES", Const, 0}, + {"SYS_UTRACE", Const, 0}, + {"SYS_UUIDGEN", Const, 0}, + {"SYS_VADVISE", Const, 1}, + {"SYS_VFORK", Const, 0}, + {"SYS_VHANGUP", Const, 0}, + {"SYS_VM86", Const, 0}, + {"SYS_VM86OLD", Const, 0}, + {"SYS_VMSPLICE", Const, 0}, + {"SYS_VM_PRESSURE_MONITOR", Const, 0}, + {"SYS_VSERVER", Const, 0}, + {"SYS_WAIT4", Const, 0}, + {"SYS_WAIT4_NOCANCEL", Const, 0}, + {"SYS_WAIT6", Const, 1}, + {"SYS_WAITEVENT", Const, 0}, + {"SYS_WAITID", Const, 0}, + {"SYS_WAITID_NOCANCEL", Const, 0}, + {"SYS_WAITPID", Const, 0}, + {"SYS_WATCHEVENT", Const, 0}, + {"SYS_WORKQ_KERNRETURN", Const, 0}, + {"SYS_WORKQ_OPEN", Const, 0}, + {"SYS_WRITE", Const, 0}, + {"SYS_WRITEV", Const, 0}, + {"SYS_WRITEV_NOCANCEL", Const, 0}, + {"SYS_WRITE_NOCANCEL", Const, 0}, + {"SYS_YIELD", Const, 0}, + {"SYS__LLSEEK", Const, 0}, + {"SYS__LWP_CONTINUE", Const, 1}, + {"SYS__LWP_CREATE", Const, 1}, + {"SYS__LWP_CTL", Const, 1}, + {"SYS__LWP_DETACH", Const, 1}, + {"SYS__LWP_EXIT", Const, 1}, + {"SYS__LWP_GETNAME", Const, 1}, + {"SYS__LWP_GETPRIVATE", Const, 1}, + {"SYS__LWP_KILL", Const, 1}, + {"SYS__LWP_PARK", Const, 1}, + {"SYS__LWP_SELF", Const, 1}, + {"SYS__LWP_SETNAME", Const, 1}, + {"SYS__LWP_SETPRIVATE", Const, 1}, + {"SYS__LWP_SUSPEND", Const, 1}, + {"SYS__LWP_UNPARK", Const, 1}, + {"SYS__LWP_UNPARK_ALL", Const, 1}, + {"SYS__LWP_WAIT", Const, 1}, + {"SYS__LWP_WAKEUP", Const, 1}, + {"SYS__NEWSELECT", Const, 0}, + {"SYS__PSET_BIND", Const, 1}, + {"SYS__SCHED_GETAFFINITY", Const, 1}, + {"SYS__SCHED_GETPARAM", Const, 1}, + {"SYS__SCHED_SETAFFINITY", Const, 1}, + {"SYS__SCHED_SETPARAM", Const, 1}, + {"SYS__SYSCTL", Const, 0}, + {"SYS__UMTX_LOCK", Const, 0}, + {"SYS__UMTX_OP", Const, 0}, + {"SYS__UMTX_UNLOCK", Const, 0}, + {"SYS___ACL_ACLCHECK_FD", Const, 0}, + {"SYS___ACL_ACLCHECK_FILE", Const, 0}, + {"SYS___ACL_ACLCHECK_LINK", Const, 0}, + {"SYS___ACL_DELETE_FD", Const, 0}, + {"SYS___ACL_DELETE_FILE", Const, 0}, + {"SYS___ACL_DELETE_LINK", Const, 0}, + {"SYS___ACL_GET_FD", Const, 0}, + {"SYS___ACL_GET_FILE", Const, 0}, + {"SYS___ACL_GET_LINK", Const, 0}, + {"SYS___ACL_SET_FD", Const, 0}, + {"SYS___ACL_SET_FILE", Const, 0}, + {"SYS___ACL_SET_LINK", Const, 0}, + {"SYS___CAP_RIGHTS_GET", Const, 14}, + {"SYS___CLONE", Const, 1}, + {"SYS___DISABLE_THREADSIGNAL", Const, 0}, + {"SYS___GETCWD", Const, 0}, + {"SYS___GETLOGIN", Const, 1}, + {"SYS___GET_TCB", Const, 1}, + {"SYS___MAC_EXECVE", Const, 0}, + {"SYS___MAC_GETFSSTAT", Const, 0}, + {"SYS___MAC_GET_FD", Const, 0}, + {"SYS___MAC_GET_FILE", Const, 0}, + {"SYS___MAC_GET_LCID", Const, 0}, + {"SYS___MAC_GET_LCTX", Const, 0}, + {"SYS___MAC_GET_LINK", Const, 0}, + {"SYS___MAC_GET_MOUNT", Const, 0}, + {"SYS___MAC_GET_PID", Const, 0}, + {"SYS___MAC_GET_PROC", Const, 0}, + {"SYS___MAC_MOUNT", Const, 0}, + {"SYS___MAC_SET_FD", Const, 0}, + {"SYS___MAC_SET_FILE", Const, 0}, + {"SYS___MAC_SET_LCTX", Const, 0}, + {"SYS___MAC_SET_LINK", Const, 0}, + {"SYS___MAC_SET_PROC", Const, 0}, + {"SYS___MAC_SYSCALL", Const, 0}, + {"SYS___OLD_SEMWAIT_SIGNAL", Const, 0}, + {"SYS___OLD_SEMWAIT_SIGNAL_NOCANCEL", Const, 0}, + {"SYS___POSIX_CHOWN", Const, 1}, + {"SYS___POSIX_FCHOWN", Const, 1}, + {"SYS___POSIX_LCHOWN", Const, 1}, + {"SYS___POSIX_RENAME", Const, 1}, + {"SYS___PTHREAD_CANCELED", Const, 0}, + {"SYS___PTHREAD_CHDIR", Const, 0}, + {"SYS___PTHREAD_FCHDIR", Const, 0}, + {"SYS___PTHREAD_KILL", Const, 0}, + {"SYS___PTHREAD_MARKCANCEL", Const, 0}, + {"SYS___PTHREAD_SIGMASK", Const, 0}, + {"SYS___QUOTACTL", Const, 1}, + {"SYS___SEMCTL", Const, 1}, + {"SYS___SEMWAIT_SIGNAL", Const, 0}, + {"SYS___SEMWAIT_SIGNAL_NOCANCEL", Const, 0}, + {"SYS___SETLOGIN", Const, 1}, + {"SYS___SETUGID", Const, 0}, + {"SYS___SET_TCB", Const, 1}, + {"SYS___SIGACTION_SIGTRAMP", Const, 1}, + {"SYS___SIGTIMEDWAIT", Const, 1}, + {"SYS___SIGWAIT", Const, 0}, + {"SYS___SIGWAIT_NOCANCEL", Const, 0}, + {"SYS___SYSCTL", Const, 0}, + {"SYS___TFORK", Const, 1}, + {"SYS___THREXIT", Const, 1}, + {"SYS___THRSIGDIVERT", Const, 1}, + {"SYS___THRSLEEP", Const, 1}, + {"SYS___THRWAKEUP", Const, 1}, + {"S_ARCH1", Const, 1}, + {"S_ARCH2", Const, 1}, + {"S_BLKSIZE", Const, 0}, + {"S_IEXEC", Const, 0}, + {"S_IFBLK", Const, 0}, + {"S_IFCHR", Const, 0}, + {"S_IFDIR", Const, 0}, + {"S_IFIFO", Const, 0}, + {"S_IFLNK", Const, 0}, + {"S_IFMT", Const, 0}, + {"S_IFREG", Const, 0}, + {"S_IFSOCK", Const, 0}, + {"S_IFWHT", Const, 0}, + {"S_IREAD", Const, 0}, + {"S_IRGRP", Const, 0}, + {"S_IROTH", Const, 0}, + {"S_IRUSR", Const, 0}, + {"S_IRWXG", Const, 0}, + {"S_IRWXO", Const, 0}, + {"S_IRWXU", Const, 0}, + {"S_ISGID", Const, 0}, + {"S_ISTXT", Const, 0}, + {"S_ISUID", Const, 0}, + {"S_ISVTX", Const, 0}, + {"S_IWGRP", Const, 0}, + {"S_IWOTH", Const, 0}, + {"S_IWRITE", Const, 0}, + {"S_IWUSR", Const, 0}, + {"S_IXGRP", Const, 0}, + {"S_IXOTH", Const, 0}, + {"S_IXUSR", Const, 0}, + {"S_LOGIN_SET", Const, 1}, + {"SecurityAttributes", Type, 0}, + {"SecurityAttributes.InheritHandle", Field, 0}, + {"SecurityAttributes.Length", Field, 0}, + {"SecurityAttributes.SecurityDescriptor", Field, 0}, + {"Seek", Func, 0}, + {"Select", Func, 0}, + {"Sendfile", Func, 0}, + {"Sendmsg", Func, 0}, + {"SendmsgN", Func, 3}, + {"Sendto", Func, 0}, + {"Servent", Type, 0}, + {"Servent.Aliases", Field, 0}, + {"Servent.Name", Field, 0}, + {"Servent.Port", Field, 0}, + {"Servent.Proto", Field, 0}, + {"SetBpf", Func, 0}, + {"SetBpfBuflen", Func, 0}, + {"SetBpfDatalink", Func, 0}, + {"SetBpfHeadercmpl", Func, 0}, + {"SetBpfImmediate", Func, 0}, + {"SetBpfInterface", Func, 0}, + {"SetBpfPromisc", Func, 0}, + {"SetBpfTimeout", Func, 0}, + {"SetCurrentDirectory", Func, 0}, + {"SetEndOfFile", Func, 0}, + {"SetEnvironmentVariable", Func, 0}, + {"SetFileAttributes", Func, 0}, + {"SetFileCompletionNotificationModes", Func, 2}, + {"SetFilePointer", Func, 0}, + {"SetFileTime", Func, 0}, + {"SetHandleInformation", Func, 0}, + {"SetKevent", Func, 0}, + {"SetLsfPromisc", Func, 0}, + {"SetNonblock", Func, 0}, + {"Setdomainname", Func, 0}, + {"Setegid", Func, 0}, + {"Setenv", Func, 0}, + {"Seteuid", Func, 0}, + {"Setfsgid", Func, 0}, + {"Setfsuid", Func, 0}, + {"Setgid", Func, 0}, + {"Setgroups", Func, 0}, + {"Sethostname", Func, 0}, + {"Setlogin", Func, 0}, + {"Setpgid", Func, 0}, + {"Setpriority", Func, 0}, + {"Setprivexec", Func, 0}, + {"Setregid", Func, 0}, + {"Setresgid", Func, 0}, + {"Setresuid", Func, 0}, + {"Setreuid", Func, 0}, + {"Setrlimit", Func, 0}, + {"Setsid", Func, 0}, + {"Setsockopt", Func, 0}, + {"SetsockoptByte", Func, 0}, + {"SetsockoptICMPv6Filter", Func, 2}, + {"SetsockoptIPMreq", Func, 0}, + {"SetsockoptIPMreqn", Func, 0}, + {"SetsockoptIPv6Mreq", Func, 0}, + {"SetsockoptInet4Addr", Func, 0}, + {"SetsockoptInt", Func, 0}, + {"SetsockoptLinger", Func, 0}, + {"SetsockoptString", Func, 0}, + {"SetsockoptTimeval", Func, 0}, + {"Settimeofday", Func, 0}, + {"Setuid", Func, 0}, + {"Setxattr", Func, 1}, + {"Shutdown", Func, 0}, + {"SidTypeAlias", Const, 0}, + {"SidTypeComputer", Const, 0}, + {"SidTypeDeletedAccount", Const, 0}, + {"SidTypeDomain", Const, 0}, + {"SidTypeGroup", Const, 0}, + {"SidTypeInvalid", Const, 0}, + {"SidTypeLabel", Const, 0}, + {"SidTypeUnknown", Const, 0}, + {"SidTypeUser", Const, 0}, + {"SidTypeWellKnownGroup", Const, 0}, + {"Signal", Type, 0}, + {"SizeofBpfHdr", Const, 0}, + {"SizeofBpfInsn", Const, 0}, + {"SizeofBpfProgram", Const, 0}, + {"SizeofBpfStat", Const, 0}, + {"SizeofBpfVersion", Const, 0}, + {"SizeofBpfZbuf", Const, 0}, + {"SizeofBpfZbufHeader", Const, 0}, + {"SizeofCmsghdr", Const, 0}, + {"SizeofICMPv6Filter", Const, 2}, + {"SizeofIPMreq", Const, 0}, + {"SizeofIPMreqn", Const, 0}, + {"SizeofIPv6MTUInfo", Const, 2}, + {"SizeofIPv6Mreq", Const, 0}, + {"SizeofIfAddrmsg", Const, 0}, + {"SizeofIfAnnounceMsghdr", Const, 1}, + {"SizeofIfData", Const, 0}, + {"SizeofIfInfomsg", Const, 0}, + {"SizeofIfMsghdr", Const, 0}, + {"SizeofIfaMsghdr", Const, 0}, + {"SizeofIfmaMsghdr", Const, 0}, + {"SizeofIfmaMsghdr2", Const, 0}, + {"SizeofInet4Pktinfo", Const, 0}, + {"SizeofInet6Pktinfo", Const, 0}, + {"SizeofInotifyEvent", Const, 0}, + {"SizeofLinger", Const, 0}, + {"SizeofMsghdr", Const, 0}, + {"SizeofNlAttr", Const, 0}, + {"SizeofNlMsgerr", Const, 0}, + {"SizeofNlMsghdr", Const, 0}, + {"SizeofRtAttr", Const, 0}, + {"SizeofRtGenmsg", Const, 0}, + {"SizeofRtMetrics", Const, 0}, + {"SizeofRtMsg", Const, 0}, + {"SizeofRtMsghdr", Const, 0}, + {"SizeofRtNexthop", Const, 0}, + {"SizeofSockFilter", Const, 0}, + {"SizeofSockFprog", Const, 0}, + {"SizeofSockaddrAny", Const, 0}, + {"SizeofSockaddrDatalink", Const, 0}, + {"SizeofSockaddrInet4", Const, 0}, + {"SizeofSockaddrInet6", Const, 0}, + {"SizeofSockaddrLinklayer", Const, 0}, + {"SizeofSockaddrNetlink", Const, 0}, + {"SizeofSockaddrUnix", Const, 0}, + {"SizeofTCPInfo", Const, 1}, + {"SizeofUcred", Const, 0}, + {"SlicePtrFromStrings", Func, 1}, + {"SockFilter", Type, 0}, + {"SockFilter.Code", Field, 0}, + {"SockFilter.Jf", Field, 0}, + {"SockFilter.Jt", Field, 0}, + {"SockFilter.K", Field, 0}, + {"SockFprog", Type, 0}, + {"SockFprog.Filter", Field, 0}, + {"SockFprog.Len", Field, 0}, + {"SockFprog.Pad_cgo_0", Field, 0}, + {"Sockaddr", Type, 0}, + {"SockaddrDatalink", Type, 0}, + {"SockaddrDatalink.Alen", Field, 0}, + {"SockaddrDatalink.Data", Field, 0}, + {"SockaddrDatalink.Family", Field, 0}, + {"SockaddrDatalink.Index", Field, 0}, + {"SockaddrDatalink.Len", Field, 0}, + {"SockaddrDatalink.Nlen", Field, 0}, + {"SockaddrDatalink.Slen", Field, 0}, + {"SockaddrDatalink.Type", Field, 0}, + {"SockaddrGen", Type, 0}, + {"SockaddrInet4", Type, 0}, + {"SockaddrInet4.Addr", Field, 0}, + {"SockaddrInet4.Port", Field, 0}, + {"SockaddrInet6", Type, 0}, + {"SockaddrInet6.Addr", Field, 0}, + {"SockaddrInet6.Port", Field, 0}, + {"SockaddrInet6.ZoneId", Field, 0}, + {"SockaddrLinklayer", Type, 0}, + {"SockaddrLinklayer.Addr", Field, 0}, + {"SockaddrLinklayer.Halen", Field, 0}, + {"SockaddrLinklayer.Hatype", Field, 0}, + {"SockaddrLinklayer.Ifindex", Field, 0}, + {"SockaddrLinklayer.Pkttype", Field, 0}, + {"SockaddrLinklayer.Protocol", Field, 0}, + {"SockaddrNetlink", Type, 0}, + {"SockaddrNetlink.Family", Field, 0}, + {"SockaddrNetlink.Groups", Field, 0}, + {"SockaddrNetlink.Pad", Field, 0}, + {"SockaddrNetlink.Pid", Field, 0}, + {"SockaddrUnix", Type, 0}, + {"SockaddrUnix.Name", Field, 0}, + {"Socket", Func, 0}, + {"SocketControlMessage", Type, 0}, + {"SocketControlMessage.Data", Field, 0}, + {"SocketControlMessage.Header", Field, 0}, + {"SocketDisableIPv6", Var, 0}, + {"Socketpair", Func, 0}, + {"Splice", Func, 0}, + {"StartProcess", Func, 0}, + {"StartupInfo", Type, 0}, + {"StartupInfo.Cb", Field, 0}, + {"StartupInfo.Desktop", Field, 0}, + {"StartupInfo.FillAttribute", Field, 0}, + {"StartupInfo.Flags", Field, 0}, + {"StartupInfo.ShowWindow", Field, 0}, + {"StartupInfo.StdErr", Field, 0}, + {"StartupInfo.StdInput", Field, 0}, + {"StartupInfo.StdOutput", Field, 0}, + {"StartupInfo.Title", Field, 0}, + {"StartupInfo.X", Field, 0}, + {"StartupInfo.XCountChars", Field, 0}, + {"StartupInfo.XSize", Field, 0}, + {"StartupInfo.Y", Field, 0}, + {"StartupInfo.YCountChars", Field, 0}, + {"StartupInfo.YSize", Field, 0}, + {"Stat", Func, 0}, + {"Stat_t", Type, 0}, + {"Stat_t.Atim", Field, 0}, + {"Stat_t.Atim_ext", Field, 12}, + {"Stat_t.Atimespec", Field, 0}, + {"Stat_t.Birthtimespec", Field, 0}, + {"Stat_t.Blksize", Field, 0}, + {"Stat_t.Blocks", Field, 0}, + {"Stat_t.Btim_ext", Field, 12}, + {"Stat_t.Ctim", Field, 0}, + {"Stat_t.Ctim_ext", Field, 12}, + {"Stat_t.Ctimespec", Field, 0}, + {"Stat_t.Dev", Field, 0}, + {"Stat_t.Flags", Field, 0}, + {"Stat_t.Gen", Field, 0}, + {"Stat_t.Gid", Field, 0}, + {"Stat_t.Ino", Field, 0}, + {"Stat_t.Lspare", Field, 0}, + {"Stat_t.Lspare0", Field, 2}, + {"Stat_t.Lspare1", Field, 2}, + {"Stat_t.Mode", Field, 0}, + {"Stat_t.Mtim", Field, 0}, + {"Stat_t.Mtim_ext", Field, 12}, + {"Stat_t.Mtimespec", Field, 0}, + {"Stat_t.Nlink", Field, 0}, + {"Stat_t.Pad_cgo_0", Field, 0}, + {"Stat_t.Pad_cgo_1", Field, 0}, + {"Stat_t.Pad_cgo_2", Field, 0}, + {"Stat_t.Padding0", Field, 12}, + {"Stat_t.Padding1", Field, 12}, + {"Stat_t.Qspare", Field, 0}, + {"Stat_t.Rdev", Field, 0}, + {"Stat_t.Size", Field, 0}, + {"Stat_t.Spare", Field, 2}, + {"Stat_t.Uid", Field, 0}, + {"Stat_t.X__pad0", Field, 0}, + {"Stat_t.X__pad1", Field, 0}, + {"Stat_t.X__pad2", Field, 0}, + {"Stat_t.X__st_birthtim", Field, 2}, + {"Stat_t.X__st_ino", Field, 0}, + {"Stat_t.X__unused", Field, 0}, + {"Statfs", Func, 0}, + {"Statfs_t", Type, 0}, + {"Statfs_t.Asyncreads", Field, 0}, + {"Statfs_t.Asyncwrites", Field, 0}, + {"Statfs_t.Bavail", Field, 0}, + {"Statfs_t.Bfree", Field, 0}, + {"Statfs_t.Blocks", Field, 0}, + {"Statfs_t.Bsize", Field, 0}, + {"Statfs_t.Charspare", Field, 0}, + {"Statfs_t.F_asyncreads", Field, 2}, + {"Statfs_t.F_asyncwrites", Field, 2}, + {"Statfs_t.F_bavail", Field, 2}, + {"Statfs_t.F_bfree", Field, 2}, + {"Statfs_t.F_blocks", Field, 2}, + {"Statfs_t.F_bsize", Field, 2}, + {"Statfs_t.F_ctime", Field, 2}, + {"Statfs_t.F_favail", Field, 2}, + {"Statfs_t.F_ffree", Field, 2}, + {"Statfs_t.F_files", Field, 2}, + {"Statfs_t.F_flags", Field, 2}, + {"Statfs_t.F_fsid", Field, 2}, + {"Statfs_t.F_fstypename", Field, 2}, + {"Statfs_t.F_iosize", Field, 2}, + {"Statfs_t.F_mntfromname", Field, 2}, + {"Statfs_t.F_mntfromspec", Field, 3}, + {"Statfs_t.F_mntonname", Field, 2}, + {"Statfs_t.F_namemax", Field, 2}, + {"Statfs_t.F_owner", Field, 2}, + {"Statfs_t.F_spare", Field, 2}, + {"Statfs_t.F_syncreads", Field, 2}, + {"Statfs_t.F_syncwrites", Field, 2}, + {"Statfs_t.Ffree", Field, 0}, + {"Statfs_t.Files", Field, 0}, + {"Statfs_t.Flags", Field, 0}, + {"Statfs_t.Frsize", Field, 0}, + {"Statfs_t.Fsid", Field, 0}, + {"Statfs_t.Fssubtype", Field, 0}, + {"Statfs_t.Fstypename", Field, 0}, + {"Statfs_t.Iosize", Field, 0}, + {"Statfs_t.Mntfromname", Field, 0}, + {"Statfs_t.Mntonname", Field, 0}, + {"Statfs_t.Mount_info", Field, 2}, + {"Statfs_t.Namelen", Field, 0}, + {"Statfs_t.Namemax", Field, 0}, + {"Statfs_t.Owner", Field, 0}, + {"Statfs_t.Pad_cgo_0", Field, 0}, + {"Statfs_t.Pad_cgo_1", Field, 2}, + {"Statfs_t.Reserved", Field, 0}, + {"Statfs_t.Spare", Field, 0}, + {"Statfs_t.Syncreads", Field, 0}, + {"Statfs_t.Syncwrites", Field, 0}, + {"Statfs_t.Type", Field, 0}, + {"Statfs_t.Version", Field, 0}, + {"Stderr", Var, 0}, + {"Stdin", Var, 0}, + {"Stdout", Var, 0}, + {"StringBytePtr", Func, 0}, + {"StringByteSlice", Func, 0}, + {"StringSlicePtr", Func, 0}, + {"StringToSid", Func, 0}, + {"StringToUTF16", Func, 0}, + {"StringToUTF16Ptr", Func, 0}, + {"Symlink", Func, 0}, + {"Sync", Func, 0}, + {"SyncFileRange", Func, 0}, + {"SysProcAttr", Type, 0}, + {"SysProcAttr.AdditionalInheritedHandles", Field, 17}, + {"SysProcAttr.AmbientCaps", Field, 9}, + {"SysProcAttr.CgroupFD", Field, 20}, + {"SysProcAttr.Chroot", Field, 0}, + {"SysProcAttr.Cloneflags", Field, 2}, + {"SysProcAttr.CmdLine", Field, 0}, + {"SysProcAttr.CreationFlags", Field, 1}, + {"SysProcAttr.Credential", Field, 0}, + {"SysProcAttr.Ctty", Field, 1}, + {"SysProcAttr.Foreground", Field, 5}, + {"SysProcAttr.GidMappings", Field, 4}, + {"SysProcAttr.GidMappingsEnableSetgroups", Field, 5}, + {"SysProcAttr.HideWindow", Field, 0}, + {"SysProcAttr.Jail", Field, 21}, + {"SysProcAttr.NoInheritHandles", Field, 16}, + {"SysProcAttr.Noctty", Field, 0}, + {"SysProcAttr.ParentProcess", Field, 17}, + {"SysProcAttr.Pdeathsig", Field, 0}, + {"SysProcAttr.Pgid", Field, 5}, + {"SysProcAttr.PidFD", Field, 22}, + {"SysProcAttr.ProcessAttributes", Field, 13}, + {"SysProcAttr.Ptrace", Field, 0}, + {"SysProcAttr.Setctty", Field, 0}, + {"SysProcAttr.Setpgid", Field, 0}, + {"SysProcAttr.Setsid", Field, 0}, + {"SysProcAttr.ThreadAttributes", Field, 13}, + {"SysProcAttr.Token", Field, 10}, + {"SysProcAttr.UidMappings", Field, 4}, + {"SysProcAttr.Unshareflags", Field, 7}, + {"SysProcAttr.UseCgroupFD", Field, 20}, + {"SysProcIDMap", Type, 4}, + {"SysProcIDMap.ContainerID", Field, 4}, + {"SysProcIDMap.HostID", Field, 4}, + {"SysProcIDMap.Size", Field, 4}, + {"Syscall", Func, 0}, + {"Syscall12", Func, 0}, + {"Syscall15", Func, 0}, + {"Syscall18", Func, 12}, + {"Syscall6", Func, 0}, + {"Syscall9", Func, 0}, + {"SyscallN", Func, 18}, + {"Sysctl", Func, 0}, + {"SysctlUint32", Func, 0}, + {"Sysctlnode", Type, 2}, + {"Sysctlnode.Flags", Field, 2}, + {"Sysctlnode.Name", Field, 2}, + {"Sysctlnode.Num", Field, 2}, + {"Sysctlnode.Un", Field, 2}, + {"Sysctlnode.Ver", Field, 2}, + {"Sysctlnode.X__rsvd", Field, 2}, + {"Sysctlnode.X_sysctl_desc", Field, 2}, + {"Sysctlnode.X_sysctl_func", Field, 2}, + {"Sysctlnode.X_sysctl_parent", Field, 2}, + {"Sysctlnode.X_sysctl_size", Field, 2}, + {"Sysinfo", Func, 0}, + {"Sysinfo_t", Type, 0}, + {"Sysinfo_t.Bufferram", Field, 0}, + {"Sysinfo_t.Freehigh", Field, 0}, + {"Sysinfo_t.Freeram", Field, 0}, + {"Sysinfo_t.Freeswap", Field, 0}, + {"Sysinfo_t.Loads", Field, 0}, + {"Sysinfo_t.Pad", Field, 0}, + {"Sysinfo_t.Pad_cgo_0", Field, 0}, + {"Sysinfo_t.Pad_cgo_1", Field, 0}, + {"Sysinfo_t.Procs", Field, 0}, + {"Sysinfo_t.Sharedram", Field, 0}, + {"Sysinfo_t.Totalhigh", Field, 0}, + {"Sysinfo_t.Totalram", Field, 0}, + {"Sysinfo_t.Totalswap", Field, 0}, + {"Sysinfo_t.Unit", Field, 0}, + {"Sysinfo_t.Uptime", Field, 0}, + {"Sysinfo_t.X_f", Field, 0}, + {"Systemtime", Type, 0}, + {"Systemtime.Day", Field, 0}, + {"Systemtime.DayOfWeek", Field, 0}, + {"Systemtime.Hour", Field, 0}, + {"Systemtime.Milliseconds", Field, 0}, + {"Systemtime.Minute", Field, 0}, + {"Systemtime.Month", Field, 0}, + {"Systemtime.Second", Field, 0}, + {"Systemtime.Year", Field, 0}, + {"TCGETS", Const, 0}, + {"TCIFLUSH", Const, 1}, + {"TCIOFLUSH", Const, 1}, + {"TCOFLUSH", Const, 1}, + {"TCPInfo", Type, 1}, + {"TCPInfo.Advmss", Field, 1}, + {"TCPInfo.Ato", Field, 1}, + {"TCPInfo.Backoff", Field, 1}, + {"TCPInfo.Ca_state", Field, 1}, + {"TCPInfo.Fackets", Field, 1}, + {"TCPInfo.Last_ack_recv", Field, 1}, + {"TCPInfo.Last_ack_sent", Field, 1}, + {"TCPInfo.Last_data_recv", Field, 1}, + {"TCPInfo.Last_data_sent", Field, 1}, + {"TCPInfo.Lost", Field, 1}, + {"TCPInfo.Options", Field, 1}, + {"TCPInfo.Pad_cgo_0", Field, 1}, + {"TCPInfo.Pmtu", Field, 1}, + {"TCPInfo.Probes", Field, 1}, + {"TCPInfo.Rcv_mss", Field, 1}, + {"TCPInfo.Rcv_rtt", Field, 1}, + {"TCPInfo.Rcv_space", Field, 1}, + {"TCPInfo.Rcv_ssthresh", Field, 1}, + {"TCPInfo.Reordering", Field, 1}, + {"TCPInfo.Retrans", Field, 1}, + {"TCPInfo.Retransmits", Field, 1}, + {"TCPInfo.Rto", Field, 1}, + {"TCPInfo.Rtt", Field, 1}, + {"TCPInfo.Rttvar", Field, 1}, + {"TCPInfo.Sacked", Field, 1}, + {"TCPInfo.Snd_cwnd", Field, 1}, + {"TCPInfo.Snd_mss", Field, 1}, + {"TCPInfo.Snd_ssthresh", Field, 1}, + {"TCPInfo.State", Field, 1}, + {"TCPInfo.Total_retrans", Field, 1}, + {"TCPInfo.Unacked", Field, 1}, + {"TCPKeepalive", Type, 3}, + {"TCPKeepalive.Interval", Field, 3}, + {"TCPKeepalive.OnOff", Field, 3}, + {"TCPKeepalive.Time", Field, 3}, + {"TCP_CA_NAME_MAX", Const, 0}, + {"TCP_CONGCTL", Const, 1}, + {"TCP_CONGESTION", Const, 0}, + {"TCP_CONNECTIONTIMEOUT", Const, 0}, + {"TCP_CORK", Const, 0}, + {"TCP_DEFER_ACCEPT", Const, 0}, + {"TCP_ENABLE_ECN", Const, 16}, + {"TCP_INFO", Const, 0}, + {"TCP_KEEPALIVE", Const, 0}, + {"TCP_KEEPCNT", Const, 0}, + {"TCP_KEEPIDLE", Const, 0}, + {"TCP_KEEPINIT", Const, 1}, + {"TCP_KEEPINTVL", Const, 0}, + {"TCP_LINGER2", Const, 0}, + {"TCP_MAXBURST", Const, 0}, + {"TCP_MAXHLEN", Const, 0}, + {"TCP_MAXOLEN", Const, 0}, + {"TCP_MAXSEG", Const, 0}, + {"TCP_MAXWIN", Const, 0}, + {"TCP_MAX_SACK", Const, 0}, + {"TCP_MAX_WINSHIFT", Const, 0}, + {"TCP_MD5SIG", Const, 0}, + {"TCP_MD5SIG_MAXKEYLEN", Const, 0}, + {"TCP_MINMSS", Const, 0}, + {"TCP_MINMSSOVERLOAD", Const, 0}, + {"TCP_MSS", Const, 0}, + {"TCP_NODELAY", Const, 0}, + {"TCP_NOOPT", Const, 0}, + {"TCP_NOPUSH", Const, 0}, + {"TCP_NOTSENT_LOWAT", Const, 16}, + {"TCP_NSTATES", Const, 1}, + {"TCP_QUICKACK", Const, 0}, + {"TCP_RXT_CONNDROPTIME", Const, 0}, + {"TCP_RXT_FINDROP", Const, 0}, + {"TCP_SACK_ENABLE", Const, 1}, + {"TCP_SENDMOREACKS", Const, 16}, + {"TCP_SYNCNT", Const, 0}, + {"TCP_VENDOR", Const, 3}, + {"TCP_WINDOW_CLAMP", Const, 0}, + {"TCSAFLUSH", Const, 1}, + {"TCSETS", Const, 0}, + {"TF_DISCONNECT", Const, 0}, + {"TF_REUSE_SOCKET", Const, 0}, + {"TF_USE_DEFAULT_WORKER", Const, 0}, + {"TF_USE_KERNEL_APC", Const, 0}, + {"TF_USE_SYSTEM_THREAD", Const, 0}, + {"TF_WRITE_BEHIND", Const, 0}, + {"TH32CS_INHERIT", Const, 4}, + {"TH32CS_SNAPALL", Const, 4}, + {"TH32CS_SNAPHEAPLIST", Const, 4}, + {"TH32CS_SNAPMODULE", Const, 4}, + {"TH32CS_SNAPMODULE32", Const, 4}, + {"TH32CS_SNAPPROCESS", Const, 4}, + {"TH32CS_SNAPTHREAD", Const, 4}, + {"TIME_ZONE_ID_DAYLIGHT", Const, 0}, + {"TIME_ZONE_ID_STANDARD", Const, 0}, + {"TIME_ZONE_ID_UNKNOWN", Const, 0}, + {"TIOCCBRK", Const, 0}, + {"TIOCCDTR", Const, 0}, + {"TIOCCONS", Const, 0}, + {"TIOCDCDTIMESTAMP", Const, 0}, + {"TIOCDRAIN", Const, 0}, + {"TIOCDSIMICROCODE", Const, 0}, + {"TIOCEXCL", Const, 0}, + {"TIOCEXT", Const, 0}, + {"TIOCFLAG_CDTRCTS", Const, 1}, + {"TIOCFLAG_CLOCAL", Const, 1}, + {"TIOCFLAG_CRTSCTS", Const, 1}, + {"TIOCFLAG_MDMBUF", Const, 1}, + {"TIOCFLAG_PPS", Const, 1}, + {"TIOCFLAG_SOFTCAR", Const, 1}, + {"TIOCFLUSH", Const, 0}, + {"TIOCGDEV", Const, 0}, + {"TIOCGDRAINWAIT", Const, 0}, + {"TIOCGETA", Const, 0}, + {"TIOCGETD", Const, 0}, + {"TIOCGFLAGS", Const, 1}, + {"TIOCGICOUNT", Const, 0}, + {"TIOCGLCKTRMIOS", Const, 0}, + {"TIOCGLINED", Const, 1}, + {"TIOCGPGRP", Const, 0}, + {"TIOCGPTN", Const, 0}, + {"TIOCGQSIZE", Const, 1}, + {"TIOCGRANTPT", Const, 1}, + {"TIOCGRS485", Const, 0}, + {"TIOCGSERIAL", Const, 0}, + {"TIOCGSID", Const, 0}, + {"TIOCGSIZE", Const, 1}, + {"TIOCGSOFTCAR", Const, 0}, + {"TIOCGTSTAMP", Const, 1}, + {"TIOCGWINSZ", Const, 0}, + {"TIOCINQ", Const, 0}, + {"TIOCIXOFF", Const, 0}, + {"TIOCIXON", Const, 0}, + {"TIOCLINUX", Const, 0}, + {"TIOCMBIC", Const, 0}, + {"TIOCMBIS", Const, 0}, + {"TIOCMGDTRWAIT", Const, 0}, + {"TIOCMGET", Const, 0}, + {"TIOCMIWAIT", Const, 0}, + {"TIOCMODG", Const, 0}, + {"TIOCMODS", Const, 0}, + {"TIOCMSDTRWAIT", Const, 0}, + {"TIOCMSET", Const, 0}, + {"TIOCM_CAR", Const, 0}, + {"TIOCM_CD", Const, 0}, + {"TIOCM_CTS", Const, 0}, + {"TIOCM_DCD", Const, 0}, + {"TIOCM_DSR", Const, 0}, + {"TIOCM_DTR", Const, 0}, + {"TIOCM_LE", Const, 0}, + {"TIOCM_RI", Const, 0}, + {"TIOCM_RNG", Const, 0}, + {"TIOCM_RTS", Const, 0}, + {"TIOCM_SR", Const, 0}, + {"TIOCM_ST", Const, 0}, + {"TIOCNOTTY", Const, 0}, + {"TIOCNXCL", Const, 0}, + {"TIOCOUTQ", Const, 0}, + {"TIOCPKT", Const, 0}, + {"TIOCPKT_DATA", Const, 0}, + {"TIOCPKT_DOSTOP", Const, 0}, + {"TIOCPKT_FLUSHREAD", Const, 0}, + {"TIOCPKT_FLUSHWRITE", Const, 0}, + {"TIOCPKT_IOCTL", Const, 0}, + {"TIOCPKT_NOSTOP", Const, 0}, + {"TIOCPKT_START", Const, 0}, + {"TIOCPKT_STOP", Const, 0}, + {"TIOCPTMASTER", Const, 0}, + {"TIOCPTMGET", Const, 1}, + {"TIOCPTSNAME", Const, 1}, + {"TIOCPTYGNAME", Const, 0}, + {"TIOCPTYGRANT", Const, 0}, + {"TIOCPTYUNLK", Const, 0}, + {"TIOCRCVFRAME", Const, 1}, + {"TIOCREMOTE", Const, 0}, + {"TIOCSBRK", Const, 0}, + {"TIOCSCONS", Const, 0}, + {"TIOCSCTTY", Const, 0}, + {"TIOCSDRAINWAIT", Const, 0}, + {"TIOCSDTR", Const, 0}, + {"TIOCSERCONFIG", Const, 0}, + {"TIOCSERGETLSR", Const, 0}, + {"TIOCSERGETMULTI", Const, 0}, + {"TIOCSERGSTRUCT", Const, 0}, + {"TIOCSERGWILD", Const, 0}, + {"TIOCSERSETMULTI", Const, 0}, + {"TIOCSERSWILD", Const, 0}, + {"TIOCSER_TEMT", Const, 0}, + {"TIOCSETA", Const, 0}, + {"TIOCSETAF", Const, 0}, + {"TIOCSETAW", Const, 0}, + {"TIOCSETD", Const, 0}, + {"TIOCSFLAGS", Const, 1}, + {"TIOCSIG", Const, 0}, + {"TIOCSLCKTRMIOS", Const, 0}, + {"TIOCSLINED", Const, 1}, + {"TIOCSPGRP", Const, 0}, + {"TIOCSPTLCK", Const, 0}, + {"TIOCSQSIZE", Const, 1}, + {"TIOCSRS485", Const, 0}, + {"TIOCSSERIAL", Const, 0}, + {"TIOCSSIZE", Const, 1}, + {"TIOCSSOFTCAR", Const, 0}, + {"TIOCSTART", Const, 0}, + {"TIOCSTAT", Const, 0}, + {"TIOCSTI", Const, 0}, + {"TIOCSTOP", Const, 0}, + {"TIOCSTSTAMP", Const, 1}, + {"TIOCSWINSZ", Const, 0}, + {"TIOCTIMESTAMP", Const, 0}, + {"TIOCUCNTL", Const, 0}, + {"TIOCVHANGUP", Const, 0}, + {"TIOCXMTFRAME", Const, 1}, + {"TOKEN_ADJUST_DEFAULT", Const, 0}, + {"TOKEN_ADJUST_GROUPS", Const, 0}, + {"TOKEN_ADJUST_PRIVILEGES", Const, 0}, + {"TOKEN_ADJUST_SESSIONID", Const, 11}, + {"TOKEN_ALL_ACCESS", Const, 0}, + {"TOKEN_ASSIGN_PRIMARY", Const, 0}, + {"TOKEN_DUPLICATE", Const, 0}, + {"TOKEN_EXECUTE", Const, 0}, + {"TOKEN_IMPERSONATE", Const, 0}, + {"TOKEN_QUERY", Const, 0}, + {"TOKEN_QUERY_SOURCE", Const, 0}, + {"TOKEN_READ", Const, 0}, + {"TOKEN_WRITE", Const, 0}, + {"TOSTOP", Const, 0}, + {"TRUNCATE_EXISTING", Const, 0}, + {"TUNATTACHFILTER", Const, 0}, + {"TUNDETACHFILTER", Const, 0}, + {"TUNGETFEATURES", Const, 0}, + {"TUNGETIFF", Const, 0}, + {"TUNGETSNDBUF", Const, 0}, + {"TUNGETVNETHDRSZ", Const, 0}, + {"TUNSETDEBUG", Const, 0}, + {"TUNSETGROUP", Const, 0}, + {"TUNSETIFF", Const, 0}, + {"TUNSETLINK", Const, 0}, + {"TUNSETNOCSUM", Const, 0}, + {"TUNSETOFFLOAD", Const, 0}, + {"TUNSETOWNER", Const, 0}, + {"TUNSETPERSIST", Const, 0}, + {"TUNSETSNDBUF", Const, 0}, + {"TUNSETTXFILTER", Const, 0}, + {"TUNSETVNETHDRSZ", Const, 0}, + {"Tee", Func, 0}, + {"TerminateProcess", Func, 0}, + {"Termios", Type, 0}, + {"Termios.Cc", Field, 0}, + {"Termios.Cflag", Field, 0}, + {"Termios.Iflag", Field, 0}, + {"Termios.Ispeed", Field, 0}, + {"Termios.Lflag", Field, 0}, + {"Termios.Line", Field, 0}, + {"Termios.Oflag", Field, 0}, + {"Termios.Ospeed", Field, 0}, + {"Termios.Pad_cgo_0", Field, 0}, + {"Tgkill", Func, 0}, + {"Time", Func, 0}, + {"Time_t", Type, 0}, + {"Times", Func, 0}, + {"Timespec", Type, 0}, + {"Timespec.Nsec", Field, 0}, + {"Timespec.Pad_cgo_0", Field, 2}, + {"Timespec.Sec", Field, 0}, + {"TimespecToNsec", Func, 0}, + {"Timeval", Type, 0}, + {"Timeval.Pad_cgo_0", Field, 0}, + {"Timeval.Sec", Field, 0}, + {"Timeval.Usec", Field, 0}, + {"Timeval32", Type, 0}, + {"Timeval32.Sec", Field, 0}, + {"Timeval32.Usec", Field, 0}, + {"TimevalToNsec", Func, 0}, + {"Timex", Type, 0}, + {"Timex.Calcnt", Field, 0}, + {"Timex.Constant", Field, 0}, + {"Timex.Errcnt", Field, 0}, + {"Timex.Esterror", Field, 0}, + {"Timex.Freq", Field, 0}, + {"Timex.Jitcnt", Field, 0}, + {"Timex.Jitter", Field, 0}, + {"Timex.Maxerror", Field, 0}, + {"Timex.Modes", Field, 0}, + {"Timex.Offset", Field, 0}, + {"Timex.Pad_cgo_0", Field, 0}, + {"Timex.Pad_cgo_1", Field, 0}, + {"Timex.Pad_cgo_2", Field, 0}, + {"Timex.Pad_cgo_3", Field, 0}, + {"Timex.Ppsfreq", Field, 0}, + {"Timex.Precision", Field, 0}, + {"Timex.Shift", Field, 0}, + {"Timex.Stabil", Field, 0}, + {"Timex.Status", Field, 0}, + {"Timex.Stbcnt", Field, 0}, + {"Timex.Tai", Field, 0}, + {"Timex.Tick", Field, 0}, + {"Timex.Time", Field, 0}, + {"Timex.Tolerance", Field, 0}, + {"Timezoneinformation", Type, 0}, + {"Timezoneinformation.Bias", Field, 0}, + {"Timezoneinformation.DaylightBias", Field, 0}, + {"Timezoneinformation.DaylightDate", Field, 0}, + {"Timezoneinformation.DaylightName", Field, 0}, + {"Timezoneinformation.StandardBias", Field, 0}, + {"Timezoneinformation.StandardDate", Field, 0}, + {"Timezoneinformation.StandardName", Field, 0}, + {"Tms", Type, 0}, + {"Tms.Cstime", Field, 0}, + {"Tms.Cutime", Field, 0}, + {"Tms.Stime", Field, 0}, + {"Tms.Utime", Field, 0}, + {"Token", Type, 0}, + {"TokenAccessInformation", Const, 0}, + {"TokenAuditPolicy", Const, 0}, + {"TokenDefaultDacl", Const, 0}, + {"TokenElevation", Const, 0}, + {"TokenElevationType", Const, 0}, + {"TokenGroups", Const, 0}, + {"TokenGroupsAndPrivileges", Const, 0}, + {"TokenHasRestrictions", Const, 0}, + {"TokenImpersonationLevel", Const, 0}, + {"TokenIntegrityLevel", Const, 0}, + {"TokenLinkedToken", Const, 0}, + {"TokenLogonSid", Const, 0}, + {"TokenMandatoryPolicy", Const, 0}, + {"TokenOrigin", Const, 0}, + {"TokenOwner", Const, 0}, + {"TokenPrimaryGroup", Const, 0}, + {"TokenPrivileges", Const, 0}, + {"TokenRestrictedSids", Const, 0}, + {"TokenSandBoxInert", Const, 0}, + {"TokenSessionId", Const, 0}, + {"TokenSessionReference", Const, 0}, + {"TokenSource", Const, 0}, + {"TokenStatistics", Const, 0}, + {"TokenType", Const, 0}, + {"TokenUIAccess", Const, 0}, + {"TokenUser", Const, 0}, + {"TokenVirtualizationAllowed", Const, 0}, + {"TokenVirtualizationEnabled", Const, 0}, + {"Tokenprimarygroup", Type, 0}, + {"Tokenprimarygroup.PrimaryGroup", Field, 0}, + {"Tokenuser", Type, 0}, + {"Tokenuser.User", Field, 0}, + {"TranslateAccountName", Func, 0}, + {"TranslateName", Func, 0}, + {"TransmitFile", Func, 0}, + {"TransmitFileBuffers", Type, 0}, + {"TransmitFileBuffers.Head", Field, 0}, + {"TransmitFileBuffers.HeadLength", Field, 0}, + {"TransmitFileBuffers.Tail", Field, 0}, + {"TransmitFileBuffers.TailLength", Field, 0}, + {"Truncate", Func, 0}, + {"UNIX_PATH_MAX", Const, 12}, + {"USAGE_MATCH_TYPE_AND", Const, 0}, + {"USAGE_MATCH_TYPE_OR", Const, 0}, + {"UTF16FromString", Func, 1}, + {"UTF16PtrFromString", Func, 1}, + {"UTF16ToString", Func, 0}, + {"Ucred", Type, 0}, + {"Ucred.Gid", Field, 0}, + {"Ucred.Pid", Field, 0}, + {"Ucred.Uid", Field, 0}, + {"Umask", Func, 0}, + {"Uname", Func, 0}, + {"Undelete", Func, 0}, + {"UnixCredentials", Func, 0}, + {"UnixRights", Func, 0}, + {"Unlink", Func, 0}, + {"Unlinkat", Func, 0}, + {"UnmapViewOfFile", Func, 0}, + {"Unmount", Func, 0}, + {"Unsetenv", Func, 4}, + {"Unshare", Func, 0}, + {"UserInfo10", Type, 0}, + {"UserInfo10.Comment", Field, 0}, + {"UserInfo10.FullName", Field, 0}, + {"UserInfo10.Name", Field, 0}, + {"UserInfo10.UsrComment", Field, 0}, + {"Ustat", Func, 0}, + {"Ustat_t", Type, 0}, + {"Ustat_t.Fname", Field, 0}, + {"Ustat_t.Fpack", Field, 0}, + {"Ustat_t.Pad_cgo_0", Field, 0}, + {"Ustat_t.Pad_cgo_1", Field, 0}, + {"Ustat_t.Tfree", Field, 0}, + {"Ustat_t.Tinode", Field, 0}, + {"Utimbuf", Type, 0}, + {"Utimbuf.Actime", Field, 0}, + {"Utimbuf.Modtime", Field, 0}, + {"Utime", Func, 0}, + {"Utimes", Func, 0}, + {"UtimesNano", Func, 1}, + {"Utsname", Type, 0}, + {"Utsname.Domainname", Field, 0}, + {"Utsname.Machine", Field, 0}, + {"Utsname.Nodename", Field, 0}, + {"Utsname.Release", Field, 0}, + {"Utsname.Sysname", Field, 0}, + {"Utsname.Version", Field, 0}, + {"VDISCARD", Const, 0}, + {"VDSUSP", Const, 1}, + {"VEOF", Const, 0}, + {"VEOL", Const, 0}, + {"VEOL2", Const, 0}, + {"VERASE", Const, 0}, + {"VERASE2", Const, 1}, + {"VINTR", Const, 0}, + {"VKILL", Const, 0}, + {"VLNEXT", Const, 0}, + {"VMIN", Const, 0}, + {"VQUIT", Const, 0}, + {"VREPRINT", Const, 0}, + {"VSTART", Const, 0}, + {"VSTATUS", Const, 1}, + {"VSTOP", Const, 0}, + {"VSUSP", Const, 0}, + {"VSWTC", Const, 0}, + {"VT0", Const, 1}, + {"VT1", Const, 1}, + {"VTDLY", Const, 1}, + {"VTIME", Const, 0}, + {"VWERASE", Const, 0}, + {"VirtualLock", Func, 0}, + {"VirtualUnlock", Func, 0}, + {"WAIT_ABANDONED", Const, 0}, + {"WAIT_FAILED", Const, 0}, + {"WAIT_OBJECT_0", Const, 0}, + {"WAIT_TIMEOUT", Const, 0}, + {"WALL", Const, 0}, + {"WALLSIG", Const, 1}, + {"WALTSIG", Const, 1}, + {"WCLONE", Const, 0}, + {"WCONTINUED", Const, 0}, + {"WCOREFLAG", Const, 0}, + {"WEXITED", Const, 0}, + {"WLINUXCLONE", Const, 0}, + {"WNOHANG", Const, 0}, + {"WNOTHREAD", Const, 0}, + {"WNOWAIT", Const, 0}, + {"WNOZOMBIE", Const, 1}, + {"WOPTSCHECKED", Const, 1}, + {"WORDSIZE", Const, 0}, + {"WSABuf", Type, 0}, + {"WSABuf.Buf", Field, 0}, + {"WSABuf.Len", Field, 0}, + {"WSACleanup", Func, 0}, + {"WSADESCRIPTION_LEN", Const, 0}, + {"WSAData", Type, 0}, + {"WSAData.Description", Field, 0}, + {"WSAData.HighVersion", Field, 0}, + {"WSAData.MaxSockets", Field, 0}, + {"WSAData.MaxUdpDg", Field, 0}, + {"WSAData.SystemStatus", Field, 0}, + {"WSAData.VendorInfo", Field, 0}, + {"WSAData.Version", Field, 0}, + {"WSAEACCES", Const, 2}, + {"WSAECONNABORTED", Const, 9}, + {"WSAECONNRESET", Const, 3}, + {"WSAEnumProtocols", Func, 2}, + {"WSAID_CONNECTEX", Var, 1}, + {"WSAIoctl", Func, 0}, + {"WSAPROTOCOL_LEN", Const, 2}, + {"WSAProtocolChain", Type, 2}, + {"WSAProtocolChain.ChainEntries", Field, 2}, + {"WSAProtocolChain.ChainLen", Field, 2}, + {"WSAProtocolInfo", Type, 2}, + {"WSAProtocolInfo.AddressFamily", Field, 2}, + {"WSAProtocolInfo.CatalogEntryId", Field, 2}, + {"WSAProtocolInfo.MaxSockAddr", Field, 2}, + {"WSAProtocolInfo.MessageSize", Field, 2}, + {"WSAProtocolInfo.MinSockAddr", Field, 2}, + {"WSAProtocolInfo.NetworkByteOrder", Field, 2}, + {"WSAProtocolInfo.Protocol", Field, 2}, + {"WSAProtocolInfo.ProtocolChain", Field, 2}, + {"WSAProtocolInfo.ProtocolMaxOffset", Field, 2}, + {"WSAProtocolInfo.ProtocolName", Field, 2}, + {"WSAProtocolInfo.ProviderFlags", Field, 2}, + {"WSAProtocolInfo.ProviderId", Field, 2}, + {"WSAProtocolInfo.ProviderReserved", Field, 2}, + {"WSAProtocolInfo.SecurityScheme", Field, 2}, + {"WSAProtocolInfo.ServiceFlags1", Field, 2}, + {"WSAProtocolInfo.ServiceFlags2", Field, 2}, + {"WSAProtocolInfo.ServiceFlags3", Field, 2}, + {"WSAProtocolInfo.ServiceFlags4", Field, 2}, + {"WSAProtocolInfo.SocketType", Field, 2}, + {"WSAProtocolInfo.Version", Field, 2}, + {"WSARecv", Func, 0}, + {"WSARecvFrom", Func, 0}, + {"WSASYS_STATUS_LEN", Const, 0}, + {"WSASend", Func, 0}, + {"WSASendTo", Func, 0}, + {"WSASendto", Func, 0}, + {"WSAStartup", Func, 0}, + {"WSTOPPED", Const, 0}, + {"WTRAPPED", Const, 1}, + {"WUNTRACED", Const, 0}, + {"Wait4", Func, 0}, + {"WaitForSingleObject", Func, 0}, + {"WaitStatus", Type, 0}, + {"WaitStatus.ExitCode", Field, 0}, + {"Win32FileAttributeData", Type, 0}, + {"Win32FileAttributeData.CreationTime", Field, 0}, + {"Win32FileAttributeData.FileAttributes", Field, 0}, + {"Win32FileAttributeData.FileSizeHigh", Field, 0}, + {"Win32FileAttributeData.FileSizeLow", Field, 0}, + {"Win32FileAttributeData.LastAccessTime", Field, 0}, + {"Win32FileAttributeData.LastWriteTime", Field, 0}, + {"Win32finddata", Type, 0}, + {"Win32finddata.AlternateFileName", Field, 0}, + {"Win32finddata.CreationTime", Field, 0}, + {"Win32finddata.FileAttributes", Field, 0}, + {"Win32finddata.FileName", Field, 0}, + {"Win32finddata.FileSizeHigh", Field, 0}, + {"Win32finddata.FileSizeLow", Field, 0}, + {"Win32finddata.LastAccessTime", Field, 0}, + {"Win32finddata.LastWriteTime", Field, 0}, + {"Win32finddata.Reserved0", Field, 0}, + {"Win32finddata.Reserved1", Field, 0}, + {"Write", Func, 0}, + {"WriteConsole", Func, 1}, + {"WriteFile", Func, 0}, + {"X509_ASN_ENCODING", Const, 0}, + {"XCASE", Const, 0}, + {"XP1_CONNECTIONLESS", Const, 2}, + {"XP1_CONNECT_DATA", Const, 2}, + {"XP1_DISCONNECT_DATA", Const, 2}, + {"XP1_EXPEDITED_DATA", Const, 2}, + {"XP1_GRACEFUL_CLOSE", Const, 2}, + {"XP1_GUARANTEED_DELIVERY", Const, 2}, + {"XP1_GUARANTEED_ORDER", Const, 2}, + {"XP1_IFS_HANDLES", Const, 2}, + {"XP1_MESSAGE_ORIENTED", Const, 2}, + {"XP1_MULTIPOINT_CONTROL_PLANE", Const, 2}, + {"XP1_MULTIPOINT_DATA_PLANE", Const, 2}, + {"XP1_PARTIAL_MESSAGE", Const, 2}, + {"XP1_PSEUDO_STREAM", Const, 2}, + {"XP1_QOS_SUPPORTED", Const, 2}, + {"XP1_SAN_SUPPORT_SDP", Const, 2}, + {"XP1_SUPPORT_BROADCAST", Const, 2}, + {"XP1_SUPPORT_MULTIPOINT", Const, 2}, + {"XP1_UNI_RECV", Const, 2}, + {"XP1_UNI_SEND", Const, 2}, + }, + "syscall/js": { + {"CopyBytesToGo", Func, 0}, + {"CopyBytesToJS", Func, 0}, + {"Error", Type, 0}, + {"Func", Type, 0}, + {"FuncOf", Func, 0}, + {"Global", Func, 0}, + {"Null", Func, 0}, + {"Type", Type, 0}, + {"TypeBoolean", Const, 0}, + {"TypeFunction", Const, 0}, + {"TypeNull", Const, 0}, + {"TypeNumber", Const, 0}, + {"TypeObject", Const, 0}, + {"TypeString", Const, 0}, + {"TypeSymbol", Const, 0}, + {"TypeUndefined", Const, 0}, + {"Undefined", Func, 0}, + {"Value", Type, 0}, + {"ValueError", Type, 0}, + {"ValueOf", Func, 0}, + }, + "testing": { + {"(*B).Cleanup", Method, 14}, + {"(*B).Elapsed", Method, 20}, + {"(*B).Error", Method, 0}, + {"(*B).Errorf", Method, 0}, + {"(*B).Fail", Method, 0}, + {"(*B).FailNow", Method, 0}, + {"(*B).Failed", Method, 0}, + {"(*B).Fatal", Method, 0}, + {"(*B).Fatalf", Method, 0}, + {"(*B).Helper", Method, 9}, + {"(*B).Log", Method, 0}, + {"(*B).Logf", Method, 0}, + {"(*B).Name", Method, 8}, + {"(*B).ReportAllocs", Method, 1}, + {"(*B).ReportMetric", Method, 13}, + {"(*B).ResetTimer", Method, 0}, + {"(*B).Run", Method, 7}, + {"(*B).RunParallel", Method, 3}, + {"(*B).SetBytes", Method, 0}, + {"(*B).SetParallelism", Method, 3}, + {"(*B).Setenv", Method, 17}, + {"(*B).Skip", Method, 1}, + {"(*B).SkipNow", Method, 1}, + {"(*B).Skipf", Method, 1}, + {"(*B).Skipped", Method, 1}, + {"(*B).StartTimer", Method, 0}, + {"(*B).StopTimer", Method, 0}, + {"(*B).TempDir", Method, 15}, + {"(*F).Add", Method, 18}, + {"(*F).Cleanup", Method, 18}, + {"(*F).Error", Method, 18}, + {"(*F).Errorf", Method, 18}, + {"(*F).Fail", Method, 18}, + {"(*F).FailNow", Method, 18}, + {"(*F).Failed", Method, 18}, + {"(*F).Fatal", Method, 18}, + {"(*F).Fatalf", Method, 18}, + {"(*F).Fuzz", Method, 18}, + {"(*F).Helper", Method, 18}, + {"(*F).Log", Method, 18}, + {"(*F).Logf", Method, 18}, + {"(*F).Name", Method, 18}, + {"(*F).Setenv", Method, 18}, + {"(*F).Skip", Method, 18}, + {"(*F).SkipNow", Method, 18}, + {"(*F).Skipf", Method, 18}, + {"(*F).Skipped", Method, 18}, + {"(*F).TempDir", Method, 18}, + {"(*M).Run", Method, 4}, + {"(*PB).Next", Method, 3}, + {"(*T).Cleanup", Method, 14}, + {"(*T).Deadline", Method, 15}, + {"(*T).Error", Method, 0}, + {"(*T).Errorf", Method, 0}, + {"(*T).Fail", Method, 0}, + {"(*T).FailNow", Method, 0}, + {"(*T).Failed", Method, 0}, + {"(*T).Fatal", Method, 0}, + {"(*T).Fatalf", Method, 0}, + {"(*T).Helper", Method, 9}, + {"(*T).Log", Method, 0}, + {"(*T).Logf", Method, 0}, + {"(*T).Name", Method, 8}, + {"(*T).Parallel", Method, 0}, + {"(*T).Run", Method, 7}, + {"(*T).Setenv", Method, 17}, + {"(*T).Skip", Method, 1}, + {"(*T).SkipNow", Method, 1}, + {"(*T).Skipf", Method, 1}, + {"(*T).Skipped", Method, 1}, + {"(*T).TempDir", Method, 15}, + {"(BenchmarkResult).AllocedBytesPerOp", Method, 1}, + {"(BenchmarkResult).AllocsPerOp", Method, 1}, + {"(BenchmarkResult).MemString", Method, 1}, + {"(BenchmarkResult).NsPerOp", Method, 0}, + {"(BenchmarkResult).String", Method, 0}, + {"AllocsPerRun", Func, 1}, + {"B", Type, 0}, + {"B.N", Field, 0}, + {"Benchmark", Func, 0}, + {"BenchmarkResult", Type, 0}, + {"BenchmarkResult.Bytes", Field, 0}, + {"BenchmarkResult.Extra", Field, 13}, + {"BenchmarkResult.MemAllocs", Field, 1}, + {"BenchmarkResult.MemBytes", Field, 1}, + {"BenchmarkResult.N", Field, 0}, + {"BenchmarkResult.T", Field, 0}, + {"Cover", Type, 2}, + {"Cover.Blocks", Field, 2}, + {"Cover.Counters", Field, 2}, + {"Cover.CoveredPackages", Field, 2}, + {"Cover.Mode", Field, 2}, + {"CoverBlock", Type, 2}, + {"CoverBlock.Col0", Field, 2}, + {"CoverBlock.Col1", Field, 2}, + {"CoverBlock.Line0", Field, 2}, + {"CoverBlock.Line1", Field, 2}, + {"CoverBlock.Stmts", Field, 2}, + {"CoverMode", Func, 8}, + {"Coverage", Func, 4}, + {"F", Type, 18}, + {"Init", Func, 13}, + {"InternalBenchmark", Type, 0}, + {"InternalBenchmark.F", Field, 0}, + {"InternalBenchmark.Name", Field, 0}, + {"InternalExample", Type, 0}, + {"InternalExample.F", Field, 0}, + {"InternalExample.Name", Field, 0}, + {"InternalExample.Output", Field, 0}, + {"InternalExample.Unordered", Field, 7}, + {"InternalFuzzTarget", Type, 18}, + {"InternalFuzzTarget.Fn", Field, 18}, + {"InternalFuzzTarget.Name", Field, 18}, + {"InternalTest", Type, 0}, + {"InternalTest.F", Field, 0}, + {"InternalTest.Name", Field, 0}, + {"M", Type, 4}, + {"Main", Func, 0}, + {"MainStart", Func, 4}, + {"PB", Type, 3}, + {"RegisterCover", Func, 2}, + {"RunBenchmarks", Func, 0}, + {"RunExamples", Func, 0}, + {"RunTests", Func, 0}, + {"Short", Func, 0}, + {"T", Type, 0}, + {"TB", Type, 2}, + {"Testing", Func, 21}, + {"Verbose", Func, 1}, + }, + "testing/fstest": { + {"(MapFS).Glob", Method, 16}, + {"(MapFS).Open", Method, 16}, + {"(MapFS).ReadDir", Method, 16}, + {"(MapFS).ReadFile", Method, 16}, + {"(MapFS).Stat", Method, 16}, + {"(MapFS).Sub", Method, 16}, + {"MapFS", Type, 16}, + {"MapFile", Type, 16}, + {"MapFile.Data", Field, 16}, + {"MapFile.ModTime", Field, 16}, + {"MapFile.Mode", Field, 16}, + {"MapFile.Sys", Field, 16}, + {"TestFS", Func, 16}, + }, + "testing/iotest": { + {"DataErrReader", Func, 0}, + {"ErrReader", Func, 16}, + {"ErrTimeout", Var, 0}, + {"HalfReader", Func, 0}, + {"NewReadLogger", Func, 0}, + {"NewWriteLogger", Func, 0}, + {"OneByteReader", Func, 0}, + {"TestReader", Func, 16}, + {"TimeoutReader", Func, 0}, + {"TruncateWriter", Func, 0}, + }, + "testing/quick": { + {"(*CheckEqualError).Error", Method, 0}, + {"(*CheckError).Error", Method, 0}, + {"(SetupError).Error", Method, 0}, + {"Check", Func, 0}, + {"CheckEqual", Func, 0}, + {"CheckEqualError", Type, 0}, + {"CheckEqualError.CheckError", Field, 0}, + {"CheckEqualError.Out1", Field, 0}, + {"CheckEqualError.Out2", Field, 0}, + {"CheckError", Type, 0}, + {"CheckError.Count", Field, 0}, + {"CheckError.In", Field, 0}, + {"Config", Type, 0}, + {"Config.MaxCount", Field, 0}, + {"Config.MaxCountScale", Field, 0}, + {"Config.Rand", Field, 0}, + {"Config.Values", Field, 0}, + {"Generator", Type, 0}, + {"SetupError", Type, 0}, + {"Value", Func, 0}, + }, + "testing/slogtest": { + {"Run", Func, 22}, + {"TestHandler", Func, 21}, + }, + "text/scanner": { + {"(*Position).IsValid", Method, 0}, + {"(*Scanner).Init", Method, 0}, + {"(*Scanner).IsValid", Method, 0}, + {"(*Scanner).Next", Method, 0}, + {"(*Scanner).Peek", Method, 0}, + {"(*Scanner).Pos", Method, 0}, + {"(*Scanner).Scan", Method, 0}, + {"(*Scanner).TokenText", Method, 0}, + {"(Position).String", Method, 0}, + {"(Scanner).String", Method, 0}, + {"Char", Const, 0}, + {"Comment", Const, 0}, + {"EOF", Const, 0}, + {"Float", Const, 0}, + {"GoTokens", Const, 0}, + {"GoWhitespace", Const, 0}, + {"Ident", Const, 0}, + {"Int", Const, 0}, + {"Position", Type, 0}, + {"Position.Column", Field, 0}, + {"Position.Filename", Field, 0}, + {"Position.Line", Field, 0}, + {"Position.Offset", Field, 0}, + {"RawString", Const, 0}, + {"ScanChars", Const, 0}, + {"ScanComments", Const, 0}, + {"ScanFloats", Const, 0}, + {"ScanIdents", Const, 0}, + {"ScanInts", Const, 0}, + {"ScanRawStrings", Const, 0}, + {"ScanStrings", Const, 0}, + {"Scanner", Type, 0}, + {"Scanner.Error", Field, 0}, + {"Scanner.ErrorCount", Field, 0}, + {"Scanner.IsIdentRune", Field, 4}, + {"Scanner.Mode", Field, 0}, + {"Scanner.Position", Field, 0}, + {"Scanner.Whitespace", Field, 0}, + {"SkipComments", Const, 0}, + {"String", Const, 0}, + {"TokenString", Func, 0}, + }, + "text/tabwriter": { + {"(*Writer).Flush", Method, 0}, + {"(*Writer).Init", Method, 0}, + {"(*Writer).Write", Method, 0}, + {"AlignRight", Const, 0}, + {"Debug", Const, 0}, + {"DiscardEmptyColumns", Const, 0}, + {"Escape", Const, 0}, + {"FilterHTML", Const, 0}, + {"NewWriter", Func, 0}, + {"StripEscape", Const, 0}, + {"TabIndent", Const, 0}, + {"Writer", Type, 0}, + }, + "text/template": { + {"(*Template).AddParseTree", Method, 0}, + {"(*Template).Clone", Method, 0}, + {"(*Template).DefinedTemplates", Method, 5}, + {"(*Template).Delims", Method, 0}, + {"(*Template).Execute", Method, 0}, + {"(*Template).ExecuteTemplate", Method, 0}, + {"(*Template).Funcs", Method, 0}, + {"(*Template).Lookup", Method, 0}, + {"(*Template).Name", Method, 0}, + {"(*Template).New", Method, 0}, + {"(*Template).Option", Method, 5}, + {"(*Template).Parse", Method, 0}, + {"(*Template).ParseFS", Method, 16}, + {"(*Template).ParseFiles", Method, 0}, + {"(*Template).ParseGlob", Method, 0}, + {"(*Template).Templates", Method, 0}, + {"(ExecError).Error", Method, 6}, + {"(ExecError).Unwrap", Method, 13}, + {"(Template).Copy", Method, 2}, + {"(Template).ErrorContext", Method, 1}, + {"ExecError", Type, 6}, + {"ExecError.Err", Field, 6}, + {"ExecError.Name", Field, 6}, + {"FuncMap", Type, 0}, + {"HTMLEscape", Func, 0}, + {"HTMLEscapeString", Func, 0}, + {"HTMLEscaper", Func, 0}, + {"IsTrue", Func, 6}, + {"JSEscape", Func, 0}, + {"JSEscapeString", Func, 0}, + {"JSEscaper", Func, 0}, + {"Must", Func, 0}, + {"New", Func, 0}, + {"ParseFS", Func, 16}, + {"ParseFiles", Func, 0}, + {"ParseGlob", Func, 0}, + {"Template", Type, 0}, + {"Template.Tree", Field, 0}, + {"URLQueryEscaper", Func, 0}, + }, + "text/template/parse": { + {"(*ActionNode).Copy", Method, 0}, + {"(*ActionNode).String", Method, 0}, + {"(*BoolNode).Copy", Method, 0}, + {"(*BoolNode).String", Method, 0}, + {"(*BranchNode).Copy", Method, 4}, + {"(*BranchNode).String", Method, 0}, + {"(*BreakNode).Copy", Method, 18}, + {"(*BreakNode).String", Method, 18}, + {"(*ChainNode).Add", Method, 1}, + {"(*ChainNode).Copy", Method, 1}, + {"(*ChainNode).String", Method, 1}, + {"(*CommandNode).Copy", Method, 0}, + {"(*CommandNode).String", Method, 0}, + {"(*CommentNode).Copy", Method, 16}, + {"(*CommentNode).String", Method, 16}, + {"(*ContinueNode).Copy", Method, 18}, + {"(*ContinueNode).String", Method, 18}, + {"(*DotNode).Copy", Method, 0}, + {"(*DotNode).String", Method, 0}, + {"(*DotNode).Type", Method, 0}, + {"(*FieldNode).Copy", Method, 0}, + {"(*FieldNode).String", Method, 0}, + {"(*IdentifierNode).Copy", Method, 0}, + {"(*IdentifierNode).SetPos", Method, 1}, + {"(*IdentifierNode).SetTree", Method, 4}, + {"(*IdentifierNode).String", Method, 0}, + {"(*IfNode).Copy", Method, 0}, + {"(*IfNode).String", Method, 0}, + {"(*ListNode).Copy", Method, 0}, + {"(*ListNode).CopyList", Method, 0}, + {"(*ListNode).String", Method, 0}, + {"(*NilNode).Copy", Method, 1}, + {"(*NilNode).String", Method, 1}, + {"(*NilNode).Type", Method, 1}, + {"(*NumberNode).Copy", Method, 0}, + {"(*NumberNode).String", Method, 0}, + {"(*PipeNode).Copy", Method, 0}, + {"(*PipeNode).CopyPipe", Method, 0}, + {"(*PipeNode).String", Method, 0}, + {"(*RangeNode).Copy", Method, 0}, + {"(*RangeNode).String", Method, 0}, + {"(*StringNode).Copy", Method, 0}, + {"(*StringNode).String", Method, 0}, + {"(*TemplateNode).Copy", Method, 0}, + {"(*TemplateNode).String", Method, 0}, + {"(*TextNode).Copy", Method, 0}, + {"(*TextNode).String", Method, 0}, + {"(*Tree).Copy", Method, 2}, + {"(*Tree).ErrorContext", Method, 1}, + {"(*Tree).Parse", Method, 0}, + {"(*VariableNode).Copy", Method, 0}, + {"(*VariableNode).String", Method, 0}, + {"(*WithNode).Copy", Method, 0}, + {"(*WithNode).String", Method, 0}, + {"(ActionNode).Position", Method, 1}, + {"(ActionNode).Type", Method, 0}, + {"(BoolNode).Position", Method, 1}, + {"(BoolNode).Type", Method, 0}, + {"(BranchNode).Position", Method, 1}, + {"(BranchNode).Type", Method, 0}, + {"(BreakNode).Position", Method, 18}, + {"(BreakNode).Type", Method, 18}, + {"(ChainNode).Position", Method, 1}, + {"(ChainNode).Type", Method, 1}, + {"(CommandNode).Position", Method, 1}, + {"(CommandNode).Type", Method, 0}, + {"(CommentNode).Position", Method, 16}, + {"(CommentNode).Type", Method, 16}, + {"(ContinueNode).Position", Method, 18}, + {"(ContinueNode).Type", Method, 18}, + {"(DotNode).Position", Method, 1}, + {"(FieldNode).Position", Method, 1}, + {"(FieldNode).Type", Method, 0}, + {"(IdentifierNode).Position", Method, 1}, + {"(IdentifierNode).Type", Method, 0}, + {"(IfNode).Position", Method, 1}, + {"(IfNode).Type", Method, 0}, + {"(ListNode).Position", Method, 1}, + {"(ListNode).Type", Method, 0}, + {"(NilNode).Position", Method, 1}, + {"(NodeType).Type", Method, 0}, + {"(NumberNode).Position", Method, 1}, + {"(NumberNode).Type", Method, 0}, + {"(PipeNode).Position", Method, 1}, + {"(PipeNode).Type", Method, 0}, + {"(Pos).Position", Method, 1}, + {"(RangeNode).Position", Method, 1}, + {"(RangeNode).Type", Method, 0}, + {"(StringNode).Position", Method, 1}, + {"(StringNode).Type", Method, 0}, + {"(TemplateNode).Position", Method, 1}, + {"(TemplateNode).Type", Method, 0}, + {"(TextNode).Position", Method, 1}, + {"(TextNode).Type", Method, 0}, + {"(VariableNode).Position", Method, 1}, + {"(VariableNode).Type", Method, 0}, + {"(WithNode).Position", Method, 1}, + {"(WithNode).Type", Method, 0}, + {"ActionNode", Type, 0}, + {"ActionNode.Line", Field, 0}, + {"ActionNode.NodeType", Field, 0}, + {"ActionNode.Pipe", Field, 0}, + {"ActionNode.Pos", Field, 1}, + {"BoolNode", Type, 0}, + {"BoolNode.NodeType", Field, 0}, + {"BoolNode.Pos", Field, 1}, + {"BoolNode.True", Field, 0}, + {"BranchNode", Type, 0}, + {"BranchNode.ElseList", Field, 0}, + {"BranchNode.Line", Field, 0}, + {"BranchNode.List", Field, 0}, + {"BranchNode.NodeType", Field, 0}, + {"BranchNode.Pipe", Field, 0}, + {"BranchNode.Pos", Field, 1}, + {"BreakNode", Type, 18}, + {"BreakNode.Line", Field, 18}, + {"BreakNode.NodeType", Field, 18}, + {"BreakNode.Pos", Field, 18}, + {"ChainNode", Type, 1}, + {"ChainNode.Field", Field, 1}, + {"ChainNode.Node", Field, 1}, + {"ChainNode.NodeType", Field, 1}, + {"ChainNode.Pos", Field, 1}, + {"CommandNode", Type, 0}, + {"CommandNode.Args", Field, 0}, + {"CommandNode.NodeType", Field, 0}, + {"CommandNode.Pos", Field, 1}, + {"CommentNode", Type, 16}, + {"CommentNode.NodeType", Field, 16}, + {"CommentNode.Pos", Field, 16}, + {"CommentNode.Text", Field, 16}, + {"ContinueNode", Type, 18}, + {"ContinueNode.Line", Field, 18}, + {"ContinueNode.NodeType", Field, 18}, + {"ContinueNode.Pos", Field, 18}, + {"DotNode", Type, 0}, + {"DotNode.NodeType", Field, 4}, + {"DotNode.Pos", Field, 1}, + {"FieldNode", Type, 0}, + {"FieldNode.Ident", Field, 0}, + {"FieldNode.NodeType", Field, 0}, + {"FieldNode.Pos", Field, 1}, + {"IdentifierNode", Type, 0}, + {"IdentifierNode.Ident", Field, 0}, + {"IdentifierNode.NodeType", Field, 0}, + {"IdentifierNode.Pos", Field, 1}, + {"IfNode", Type, 0}, + {"IfNode.BranchNode", Field, 0}, + {"IsEmptyTree", Func, 0}, + {"ListNode", Type, 0}, + {"ListNode.NodeType", Field, 0}, + {"ListNode.Nodes", Field, 0}, + {"ListNode.Pos", Field, 1}, + {"Mode", Type, 16}, + {"New", Func, 0}, + {"NewIdentifier", Func, 0}, + {"NilNode", Type, 1}, + {"NilNode.NodeType", Field, 4}, + {"NilNode.Pos", Field, 1}, + {"Node", Type, 0}, + {"NodeAction", Const, 0}, + {"NodeBool", Const, 0}, + {"NodeBreak", Const, 18}, + {"NodeChain", Const, 1}, + {"NodeCommand", Const, 0}, + {"NodeComment", Const, 16}, + {"NodeContinue", Const, 18}, + {"NodeDot", Const, 0}, + {"NodeField", Const, 0}, + {"NodeIdentifier", Const, 0}, + {"NodeIf", Const, 0}, + {"NodeList", Const, 0}, + {"NodeNil", Const, 1}, + {"NodeNumber", Const, 0}, + {"NodePipe", Const, 0}, + {"NodeRange", Const, 0}, + {"NodeString", Const, 0}, + {"NodeTemplate", Const, 0}, + {"NodeText", Const, 0}, + {"NodeType", Type, 0}, + {"NodeVariable", Const, 0}, + {"NodeWith", Const, 0}, + {"NumberNode", Type, 0}, + {"NumberNode.Complex128", Field, 0}, + {"NumberNode.Float64", Field, 0}, + {"NumberNode.Int64", Field, 0}, + {"NumberNode.IsComplex", Field, 0}, + {"NumberNode.IsFloat", Field, 0}, + {"NumberNode.IsInt", Field, 0}, + {"NumberNode.IsUint", Field, 0}, + {"NumberNode.NodeType", Field, 0}, + {"NumberNode.Pos", Field, 1}, + {"NumberNode.Text", Field, 0}, + {"NumberNode.Uint64", Field, 0}, + {"Parse", Func, 0}, + {"ParseComments", Const, 16}, + {"PipeNode", Type, 0}, + {"PipeNode.Cmds", Field, 0}, + {"PipeNode.Decl", Field, 0}, + {"PipeNode.IsAssign", Field, 11}, + {"PipeNode.Line", Field, 0}, + {"PipeNode.NodeType", Field, 0}, + {"PipeNode.Pos", Field, 1}, + {"Pos", Type, 1}, + {"RangeNode", Type, 0}, + {"RangeNode.BranchNode", Field, 0}, + {"SkipFuncCheck", Const, 17}, + {"StringNode", Type, 0}, + {"StringNode.NodeType", Field, 0}, + {"StringNode.Pos", Field, 1}, + {"StringNode.Quoted", Field, 0}, + {"StringNode.Text", Field, 0}, + {"TemplateNode", Type, 0}, + {"TemplateNode.Line", Field, 0}, + {"TemplateNode.Name", Field, 0}, + {"TemplateNode.NodeType", Field, 0}, + {"TemplateNode.Pipe", Field, 0}, + {"TemplateNode.Pos", Field, 1}, + {"TextNode", Type, 0}, + {"TextNode.NodeType", Field, 0}, + {"TextNode.Pos", Field, 1}, + {"TextNode.Text", Field, 0}, + {"Tree", Type, 0}, + {"Tree.Mode", Field, 16}, + {"Tree.Name", Field, 0}, + {"Tree.ParseName", Field, 1}, + {"Tree.Root", Field, 0}, + {"VariableNode", Type, 0}, + {"VariableNode.Ident", Field, 0}, + {"VariableNode.NodeType", Field, 0}, + {"VariableNode.Pos", Field, 1}, + {"WithNode", Type, 0}, + {"WithNode.BranchNode", Field, 0}, + }, + "time": { + {"(*Location).String", Method, 0}, + {"(*ParseError).Error", Method, 0}, + {"(*Ticker).Reset", Method, 15}, + {"(*Ticker).Stop", Method, 0}, + {"(*Time).GobDecode", Method, 0}, + {"(*Time).UnmarshalBinary", Method, 2}, + {"(*Time).UnmarshalJSON", Method, 0}, + {"(*Time).UnmarshalText", Method, 2}, + {"(*Timer).Reset", Method, 1}, + {"(*Timer).Stop", Method, 0}, + {"(Duration).Abs", Method, 19}, + {"(Duration).Hours", Method, 0}, + {"(Duration).Microseconds", Method, 13}, + {"(Duration).Milliseconds", Method, 13}, + {"(Duration).Minutes", Method, 0}, + {"(Duration).Nanoseconds", Method, 0}, + {"(Duration).Round", Method, 9}, + {"(Duration).Seconds", Method, 0}, + {"(Duration).String", Method, 0}, + {"(Duration).Truncate", Method, 9}, + {"(Month).String", Method, 0}, + {"(Time).Add", Method, 0}, + {"(Time).AddDate", Method, 0}, + {"(Time).After", Method, 0}, + {"(Time).AppendFormat", Method, 5}, + {"(Time).Before", Method, 0}, + {"(Time).Clock", Method, 0}, + {"(Time).Compare", Method, 20}, + {"(Time).Date", Method, 0}, + {"(Time).Day", Method, 0}, + {"(Time).Equal", Method, 0}, + {"(Time).Format", Method, 0}, + {"(Time).GoString", Method, 17}, + {"(Time).GobEncode", Method, 0}, + {"(Time).Hour", Method, 0}, + {"(Time).ISOWeek", Method, 0}, + {"(Time).In", Method, 0}, + {"(Time).IsDST", Method, 17}, + {"(Time).IsZero", Method, 0}, + {"(Time).Local", Method, 0}, + {"(Time).Location", Method, 0}, + {"(Time).MarshalBinary", Method, 2}, + {"(Time).MarshalJSON", Method, 0}, + {"(Time).MarshalText", Method, 2}, + {"(Time).Minute", Method, 0}, + {"(Time).Month", Method, 0}, + {"(Time).Nanosecond", Method, 0}, + {"(Time).Round", Method, 1}, + {"(Time).Second", Method, 0}, + {"(Time).String", Method, 0}, + {"(Time).Sub", Method, 0}, + {"(Time).Truncate", Method, 1}, + {"(Time).UTC", Method, 0}, + {"(Time).Unix", Method, 0}, + {"(Time).UnixMicro", Method, 17}, + {"(Time).UnixMilli", Method, 17}, + {"(Time).UnixNano", Method, 0}, + {"(Time).Weekday", Method, 0}, + {"(Time).Year", Method, 0}, + {"(Time).YearDay", Method, 1}, + {"(Time).Zone", Method, 0}, + {"(Time).ZoneBounds", Method, 19}, + {"(Weekday).String", Method, 0}, + {"ANSIC", Const, 0}, + {"After", Func, 0}, + {"AfterFunc", Func, 0}, + {"April", Const, 0}, + {"August", Const, 0}, + {"Date", Func, 0}, + {"DateOnly", Const, 20}, + {"DateTime", Const, 20}, + {"December", Const, 0}, + {"Duration", Type, 0}, + {"February", Const, 0}, + {"FixedZone", Func, 0}, + {"Friday", Const, 0}, + {"Hour", Const, 0}, + {"January", Const, 0}, + {"July", Const, 0}, + {"June", Const, 0}, + {"Kitchen", Const, 0}, + {"Layout", Const, 17}, + {"LoadLocation", Func, 0}, + {"LoadLocationFromTZData", Func, 10}, + {"Local", Var, 0}, + {"Location", Type, 0}, + {"March", Const, 0}, + {"May", Const, 0}, + {"Microsecond", Const, 0}, + {"Millisecond", Const, 0}, + {"Minute", Const, 0}, + {"Monday", Const, 0}, + {"Month", Type, 0}, + {"Nanosecond", Const, 0}, + {"NewTicker", Func, 0}, + {"NewTimer", Func, 0}, + {"November", Const, 0}, + {"Now", Func, 0}, + {"October", Const, 0}, + {"Parse", Func, 0}, + {"ParseDuration", Func, 0}, + {"ParseError", Type, 0}, + {"ParseError.Layout", Field, 0}, + {"ParseError.LayoutElem", Field, 0}, + {"ParseError.Message", Field, 0}, + {"ParseError.Value", Field, 0}, + {"ParseError.ValueElem", Field, 0}, + {"ParseInLocation", Func, 1}, + {"RFC1123", Const, 0}, + {"RFC1123Z", Const, 0}, + {"RFC3339", Const, 0}, + {"RFC3339Nano", Const, 0}, + {"RFC822", Const, 0}, + {"RFC822Z", Const, 0}, + {"RFC850", Const, 0}, + {"RubyDate", Const, 0}, + {"Saturday", Const, 0}, + {"Second", Const, 0}, + {"September", Const, 0}, + {"Since", Func, 0}, + {"Sleep", Func, 0}, + {"Stamp", Const, 0}, + {"StampMicro", Const, 0}, + {"StampMilli", Const, 0}, + {"StampNano", Const, 0}, + {"Sunday", Const, 0}, + {"Thursday", Const, 0}, + {"Tick", Func, 0}, + {"Ticker", Type, 0}, + {"Ticker.C", Field, 0}, + {"Time", Type, 0}, + {"TimeOnly", Const, 20}, + {"Timer", Type, 0}, + {"Timer.C", Field, 0}, + {"Tuesday", Const, 0}, + {"UTC", Var, 0}, + {"Unix", Func, 0}, + {"UnixDate", Const, 0}, + {"UnixMicro", Func, 17}, + {"UnixMilli", Func, 17}, + {"Until", Func, 8}, + {"Wednesday", Const, 0}, + {"Weekday", Type, 0}, + }, + "unicode": { + {"(SpecialCase).ToLower", Method, 0}, + {"(SpecialCase).ToTitle", Method, 0}, + {"(SpecialCase).ToUpper", Method, 0}, + {"ASCII_Hex_Digit", Var, 0}, + {"Adlam", Var, 7}, + {"Ahom", Var, 5}, + {"Anatolian_Hieroglyphs", Var, 5}, + {"Arabic", Var, 0}, + {"Armenian", Var, 0}, + {"Avestan", Var, 0}, + {"AzeriCase", Var, 0}, + {"Balinese", Var, 0}, + {"Bamum", Var, 0}, + {"Bassa_Vah", Var, 4}, + {"Batak", Var, 0}, + {"Bengali", Var, 0}, + {"Bhaiksuki", Var, 7}, + {"Bidi_Control", Var, 0}, + {"Bopomofo", Var, 0}, + {"Brahmi", Var, 0}, + {"Braille", Var, 0}, + {"Buginese", Var, 0}, + {"Buhid", Var, 0}, + {"C", Var, 0}, + {"Canadian_Aboriginal", Var, 0}, + {"Carian", Var, 0}, + {"CaseRange", Type, 0}, + {"CaseRange.Delta", Field, 0}, + {"CaseRange.Hi", Field, 0}, + {"CaseRange.Lo", Field, 0}, + {"CaseRanges", Var, 0}, + {"Categories", Var, 0}, + {"Caucasian_Albanian", Var, 4}, + {"Cc", Var, 0}, + {"Cf", Var, 0}, + {"Chakma", Var, 1}, + {"Cham", Var, 0}, + {"Cherokee", Var, 0}, + {"Chorasmian", Var, 16}, + {"Co", Var, 0}, + {"Common", Var, 0}, + {"Coptic", Var, 0}, + {"Cs", Var, 0}, + {"Cuneiform", Var, 0}, + {"Cypriot", Var, 0}, + {"Cypro_Minoan", Var, 21}, + {"Cyrillic", Var, 0}, + {"Dash", Var, 0}, + {"Deprecated", Var, 0}, + {"Deseret", Var, 0}, + {"Devanagari", Var, 0}, + {"Diacritic", Var, 0}, + {"Digit", Var, 0}, + {"Dives_Akuru", Var, 16}, + {"Dogra", Var, 13}, + {"Duployan", Var, 4}, + {"Egyptian_Hieroglyphs", Var, 0}, + {"Elbasan", Var, 4}, + {"Elymaic", Var, 14}, + {"Ethiopic", Var, 0}, + {"Extender", Var, 0}, + {"FoldCategory", Var, 0}, + {"FoldScript", Var, 0}, + {"Georgian", Var, 0}, + {"Glagolitic", Var, 0}, + {"Gothic", Var, 0}, + {"Grantha", Var, 4}, + {"GraphicRanges", Var, 0}, + {"Greek", Var, 0}, + {"Gujarati", Var, 0}, + {"Gunjala_Gondi", Var, 13}, + {"Gurmukhi", Var, 0}, + {"Han", Var, 0}, + {"Hangul", Var, 0}, + {"Hanifi_Rohingya", Var, 13}, + {"Hanunoo", Var, 0}, + {"Hatran", Var, 5}, + {"Hebrew", Var, 0}, + {"Hex_Digit", Var, 0}, + {"Hiragana", Var, 0}, + {"Hyphen", Var, 0}, + {"IDS_Binary_Operator", Var, 0}, + {"IDS_Trinary_Operator", Var, 0}, + {"Ideographic", Var, 0}, + {"Imperial_Aramaic", Var, 0}, + {"In", Func, 2}, + {"Inherited", Var, 0}, + {"Inscriptional_Pahlavi", Var, 0}, + {"Inscriptional_Parthian", Var, 0}, + {"Is", Func, 0}, + {"IsControl", Func, 0}, + {"IsDigit", Func, 0}, + {"IsGraphic", Func, 0}, + {"IsLetter", Func, 0}, + {"IsLower", Func, 0}, + {"IsMark", Func, 0}, + {"IsNumber", Func, 0}, + {"IsOneOf", Func, 0}, + {"IsPrint", Func, 0}, + {"IsPunct", Func, 0}, + {"IsSpace", Func, 0}, + {"IsSymbol", Func, 0}, + {"IsTitle", Func, 0}, + {"IsUpper", Func, 0}, + {"Javanese", Var, 0}, + {"Join_Control", Var, 0}, + {"Kaithi", Var, 0}, + {"Kannada", Var, 0}, + {"Katakana", Var, 0}, + {"Kawi", Var, 21}, + {"Kayah_Li", Var, 0}, + {"Kharoshthi", Var, 0}, + {"Khitan_Small_Script", Var, 16}, + {"Khmer", Var, 0}, + {"Khojki", Var, 4}, + {"Khudawadi", Var, 4}, + {"L", Var, 0}, + {"Lao", Var, 0}, + {"Latin", Var, 0}, + {"Lepcha", Var, 0}, + {"Letter", Var, 0}, + {"Limbu", Var, 0}, + {"Linear_A", Var, 4}, + {"Linear_B", Var, 0}, + {"Lisu", Var, 0}, + {"Ll", Var, 0}, + {"Lm", Var, 0}, + {"Lo", Var, 0}, + {"Logical_Order_Exception", Var, 0}, + {"Lower", Var, 0}, + {"LowerCase", Const, 0}, + {"Lt", Var, 0}, + {"Lu", Var, 0}, + {"Lycian", Var, 0}, + {"Lydian", Var, 0}, + {"M", Var, 0}, + {"Mahajani", Var, 4}, + {"Makasar", Var, 13}, + {"Malayalam", Var, 0}, + {"Mandaic", Var, 0}, + {"Manichaean", Var, 4}, + {"Marchen", Var, 7}, + {"Mark", Var, 0}, + {"Masaram_Gondi", Var, 10}, + {"MaxASCII", Const, 0}, + {"MaxCase", Const, 0}, + {"MaxLatin1", Const, 0}, + {"MaxRune", Const, 0}, + {"Mc", Var, 0}, + {"Me", Var, 0}, + {"Medefaidrin", Var, 13}, + {"Meetei_Mayek", Var, 0}, + {"Mende_Kikakui", Var, 4}, + {"Meroitic_Cursive", Var, 1}, + {"Meroitic_Hieroglyphs", Var, 1}, + {"Miao", Var, 1}, + {"Mn", Var, 0}, + {"Modi", Var, 4}, + {"Mongolian", Var, 0}, + {"Mro", Var, 4}, + {"Multani", Var, 5}, + {"Myanmar", Var, 0}, + {"N", Var, 0}, + {"Nabataean", Var, 4}, + {"Nag_Mundari", Var, 21}, + {"Nandinagari", Var, 14}, + {"Nd", Var, 0}, + {"New_Tai_Lue", Var, 0}, + {"Newa", Var, 7}, + {"Nko", Var, 0}, + {"Nl", Var, 0}, + {"No", Var, 0}, + {"Noncharacter_Code_Point", Var, 0}, + {"Number", Var, 0}, + {"Nushu", Var, 10}, + {"Nyiakeng_Puachue_Hmong", Var, 14}, + {"Ogham", Var, 0}, + {"Ol_Chiki", Var, 0}, + {"Old_Hungarian", Var, 5}, + {"Old_Italic", Var, 0}, + {"Old_North_Arabian", Var, 4}, + {"Old_Permic", Var, 4}, + {"Old_Persian", Var, 0}, + {"Old_Sogdian", Var, 13}, + {"Old_South_Arabian", Var, 0}, + {"Old_Turkic", Var, 0}, + {"Old_Uyghur", Var, 21}, + {"Oriya", Var, 0}, + {"Osage", Var, 7}, + {"Osmanya", Var, 0}, + {"Other", Var, 0}, + {"Other_Alphabetic", Var, 0}, + {"Other_Default_Ignorable_Code_Point", Var, 0}, + {"Other_Grapheme_Extend", Var, 0}, + {"Other_ID_Continue", Var, 0}, + {"Other_ID_Start", Var, 0}, + {"Other_Lowercase", Var, 0}, + {"Other_Math", Var, 0}, + {"Other_Uppercase", Var, 0}, + {"P", Var, 0}, + {"Pahawh_Hmong", Var, 4}, + {"Palmyrene", Var, 4}, + {"Pattern_Syntax", Var, 0}, + {"Pattern_White_Space", Var, 0}, + {"Pau_Cin_Hau", Var, 4}, + {"Pc", Var, 0}, + {"Pd", Var, 0}, + {"Pe", Var, 0}, + {"Pf", Var, 0}, + {"Phags_Pa", Var, 0}, + {"Phoenician", Var, 0}, + {"Pi", Var, 0}, + {"Po", Var, 0}, + {"Prepended_Concatenation_Mark", Var, 7}, + {"PrintRanges", Var, 0}, + {"Properties", Var, 0}, + {"Ps", Var, 0}, + {"Psalter_Pahlavi", Var, 4}, + {"Punct", Var, 0}, + {"Quotation_Mark", Var, 0}, + {"Radical", Var, 0}, + {"Range16", Type, 0}, + {"Range16.Hi", Field, 0}, + {"Range16.Lo", Field, 0}, + {"Range16.Stride", Field, 0}, + {"Range32", Type, 0}, + {"Range32.Hi", Field, 0}, + {"Range32.Lo", Field, 0}, + {"Range32.Stride", Field, 0}, + {"RangeTable", Type, 0}, + {"RangeTable.LatinOffset", Field, 1}, + {"RangeTable.R16", Field, 0}, + {"RangeTable.R32", Field, 0}, + {"Regional_Indicator", Var, 10}, + {"Rejang", Var, 0}, + {"ReplacementChar", Const, 0}, + {"Runic", Var, 0}, + {"S", Var, 0}, + {"STerm", Var, 0}, + {"Samaritan", Var, 0}, + {"Saurashtra", Var, 0}, + {"Sc", Var, 0}, + {"Scripts", Var, 0}, + {"Sentence_Terminal", Var, 7}, + {"Sharada", Var, 1}, + {"Shavian", Var, 0}, + {"Siddham", Var, 4}, + {"SignWriting", Var, 5}, + {"SimpleFold", Func, 0}, + {"Sinhala", Var, 0}, + {"Sk", Var, 0}, + {"Sm", Var, 0}, + {"So", Var, 0}, + {"Soft_Dotted", Var, 0}, + {"Sogdian", Var, 13}, + {"Sora_Sompeng", Var, 1}, + {"Soyombo", Var, 10}, + {"Space", Var, 0}, + {"SpecialCase", Type, 0}, + {"Sundanese", Var, 0}, + {"Syloti_Nagri", Var, 0}, + {"Symbol", Var, 0}, + {"Syriac", Var, 0}, + {"Tagalog", Var, 0}, + {"Tagbanwa", Var, 0}, + {"Tai_Le", Var, 0}, + {"Tai_Tham", Var, 0}, + {"Tai_Viet", Var, 0}, + {"Takri", Var, 1}, + {"Tamil", Var, 0}, + {"Tangsa", Var, 21}, + {"Tangut", Var, 7}, + {"Telugu", Var, 0}, + {"Terminal_Punctuation", Var, 0}, + {"Thaana", Var, 0}, + {"Thai", Var, 0}, + {"Tibetan", Var, 0}, + {"Tifinagh", Var, 0}, + {"Tirhuta", Var, 4}, + {"Title", Var, 0}, + {"TitleCase", Const, 0}, + {"To", Func, 0}, + {"ToLower", Func, 0}, + {"ToTitle", Func, 0}, + {"ToUpper", Func, 0}, + {"Toto", Var, 21}, + {"TurkishCase", Var, 0}, + {"Ugaritic", Var, 0}, + {"Unified_Ideograph", Var, 0}, + {"Upper", Var, 0}, + {"UpperCase", Const, 0}, + {"UpperLower", Const, 0}, + {"Vai", Var, 0}, + {"Variation_Selector", Var, 0}, + {"Version", Const, 0}, + {"Vithkuqi", Var, 21}, + {"Wancho", Var, 14}, + {"Warang_Citi", Var, 4}, + {"White_Space", Var, 0}, + {"Yezidi", Var, 16}, + {"Yi", Var, 0}, + {"Z", Var, 0}, + {"Zanabazar_Square", Var, 10}, + {"Zl", Var, 0}, + {"Zp", Var, 0}, + {"Zs", Var, 0}, + }, + "unicode/utf16": { + {"AppendRune", Func, 20}, + {"Decode", Func, 0}, + {"DecodeRune", Func, 0}, + {"Encode", Func, 0}, + {"EncodeRune", Func, 0}, + {"IsSurrogate", Func, 0}, + }, + "unicode/utf8": { + {"AppendRune", Func, 18}, + {"DecodeLastRune", Func, 0}, + {"DecodeLastRuneInString", Func, 0}, + {"DecodeRune", Func, 0}, + {"DecodeRuneInString", Func, 0}, + {"EncodeRune", Func, 0}, + {"FullRune", Func, 0}, + {"FullRuneInString", Func, 0}, + {"MaxRune", Const, 0}, + {"RuneCount", Func, 0}, + {"RuneCountInString", Func, 0}, + {"RuneError", Const, 0}, + {"RuneLen", Func, 0}, + {"RuneSelf", Const, 0}, + {"RuneStart", Func, 0}, + {"UTFMax", Const, 0}, + {"Valid", Func, 0}, + {"ValidRune", Func, 1}, + {"ValidString", Func, 0}, + }, + "unsafe": { + {"Add", Func, 0}, + {"Alignof", Func, 0}, + {"Offsetof", Func, 0}, + {"Pointer", Type, 0}, + {"Sizeof", Func, 0}, + {"Slice", Func, 0}, + {"SliceData", Func, 0}, + {"String", Func, 0}, + {"StringData", Func, 0}, + }, +} diff --git a/vendor/golang.org/x/tools/internal/stdlib/stdlib.go b/vendor/golang.org/x/tools/internal/stdlib/stdlib.go new file mode 100644 index 0000000..9890401 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/stdlib/stdlib.go @@ -0,0 +1,97 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run generate.go + +// Package stdlib provides a table of all exported symbols in the +// standard library, along with the version at which they first +// appeared. +package stdlib + +import ( + "fmt" + "strings" +) + +type Symbol struct { + Name string + Kind Kind + Version Version // Go version that first included the symbol +} + +// A Kind indicates the kind of a symbol: +// function, variable, constant, type, and so on. +type Kind int8 + +const ( + Invalid Kind = iota // Example name: + Type // "Buffer" + Func // "Println" + Var // "EOF" + Const // "Pi" + Field // "Point.X" + Method // "(*Buffer).Grow" +) + +func (kind Kind) String() string { + return [...]string{ + Invalid: "invalid", + Type: "type", + Func: "func", + Var: "var", + Const: "const", + Field: "field", + Method: "method", + }[kind] +} + +// A Version represents a version of Go of the form "go1.%d". +type Version int8 + +// String returns a version string of the form "go1.23", without allocating. +func (v Version) String() string { return versions[v] } + +var versions [30]string // (increase constant as needed) + +func init() { + for i := range versions { + versions[i] = fmt.Sprintf("go1.%d", i) + } +} + +// HasPackage reports whether the specified package path is part of +// the standard library's public API. +func HasPackage(path string) bool { + _, ok := PackageSymbols[path] + return ok +} + +// SplitField splits the field symbol name into type and field +// components. It must be called only on Field symbols. +// +// Example: "File.Package" -> ("File", "Package") +func (sym *Symbol) SplitField() (typename, name string) { + if sym.Kind != Field { + panic("not a field") + } + typename, name, _ = strings.Cut(sym.Name, ".") + return +} + +// SplitMethod splits the method symbol name into pointer, receiver, +// and method components. It must be called only on Method symbols. +// +// Example: "(*Buffer).Grow" -> (true, "Buffer", "Grow") +func (sym *Symbol) SplitMethod() (ptr bool, recv, name string) { + if sym.Kind != Method { + panic("not a method") + } + recv, name, _ = strings.Cut(sym.Name, ".") + recv = recv[len("(") : len(recv)-len(")")] + ptr = recv[0] == '*' + if ptr { + recv = recv[len("*"):] + } + return +} diff --git a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go index 7e638ec..ff9437a 100644 --- a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go +++ b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go @@ -34,30 +34,16 @@ func GetLines(file *token.File) []int { lines []int _ []struct{} } - type tokenFile118 struct { - _ *token.FileSet // deleted in go1.19 - tokenFile119 - } - - type uP = unsafe.Pointer - switch unsafe.Sizeof(*file) { - case unsafe.Sizeof(tokenFile118{}): - var ptr *tokenFile118 - *(*uP)(uP(&ptr)) = uP(file) - ptr.mu.Lock() - defer ptr.mu.Unlock() - return ptr.lines - case unsafe.Sizeof(tokenFile119{}): - var ptr *tokenFile119 - *(*uP)(uP(&ptr)) = uP(file) - ptr.mu.Lock() - defer ptr.mu.Unlock() - return ptr.lines - - default: + if unsafe.Sizeof(*file) != unsafe.Sizeof(tokenFile119{}) { panic("unexpected token.File size") } + var ptr *tokenFile119 + type uP = unsafe.Pointer + *(*uP)(uP(&ptr)) = uP(file) + ptr.mu.Lock() + defer ptr.mu.Unlock() + return ptr.lines } // AddExistingFiles adds the specified files to the FileSet if they diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go deleted file mode 100644 index b9e87c6..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ /dev/null @@ -1,198 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package typeparams contains common utilities for writing tools that interact -// with generic Go code, as introduced with Go 1.18. -// -// Many of the types and functions in this package are proxies for the new APIs -// introduced in the standard library with Go 1.18. For example, the -// typeparams.Union type is an alias for go/types.Union, and the ForTypeSpec -// function returns the value of the go/ast.TypeSpec.TypeParams field. At Go -// versions older than 1.18 these helpers are implemented as stubs, allowing -// users of this package to write code that handles generic constructs inline, -// even if the Go version being used to compile does not support generics. -// -// Additionally, this package contains common utilities for working with the -// new generic constructs, to supplement the standard library APIs. Notably, -// the StructuralTerms API computes a minimal representation of the structural -// restrictions on a type parameter. -// -// An external version of these APIs is available in the -// golang.org/x/exp/typeparams module. -package typeparams - -import ( - "go/ast" - "go/token" - "go/types" -) - -// UnpackIndexExpr extracts data from AST nodes that represent index -// expressions. -// -// For an ast.IndexExpr, the resulting indices slice will contain exactly one -// index expression. For an ast.IndexListExpr (go1.18+), it may have a variable -// number of index expressions. -// -// For nodes that don't represent index expressions, the first return value of -// UnpackIndexExpr will be nil. -func UnpackIndexExpr(n ast.Node) (x ast.Expr, lbrack token.Pos, indices []ast.Expr, rbrack token.Pos) { - switch e := n.(type) { - case *ast.IndexExpr: - return e.X, e.Lbrack, []ast.Expr{e.Index}, e.Rbrack - case *IndexListExpr: - return e.X, e.Lbrack, e.Indices, e.Rbrack - } - return nil, token.NoPos, nil, token.NoPos -} - -// PackIndexExpr returns an *ast.IndexExpr or *ast.IndexListExpr, depending on -// the cardinality of indices. Calling PackIndexExpr with len(indices) == 0 -// will panic. -func PackIndexExpr(x ast.Expr, lbrack token.Pos, indices []ast.Expr, rbrack token.Pos) ast.Expr { - switch len(indices) { - case 0: - panic("empty indices") - case 1: - return &ast.IndexExpr{ - X: x, - Lbrack: lbrack, - Index: indices[0], - Rbrack: rbrack, - } - default: - return &IndexListExpr{ - X: x, - Lbrack: lbrack, - Indices: indices, - Rbrack: rbrack, - } - } -} - -// IsTypeParam reports whether t is a type parameter. -func IsTypeParam(t types.Type) bool { - _, ok := t.(*TypeParam) - return ok -} - -// OriginMethod returns the origin method associated with the method fn. -// For methods on a non-generic receiver base type, this is just -// fn. However, for methods with a generic receiver, OriginMethod returns the -// corresponding method in the method set of the origin type. -// -// As a special case, if fn is not a method (has no receiver), OriginMethod -// returns fn. -func OriginMethod(fn *types.Func) *types.Func { - recv := fn.Type().(*types.Signature).Recv() - if recv == nil { - return fn - } - base := recv.Type() - p, isPtr := base.(*types.Pointer) - if isPtr { - base = p.Elem() - } - named, isNamed := base.(*types.Named) - if !isNamed { - // Receiver is a *types.Interface. - return fn - } - if ForNamed(named).Len() == 0 { - // Receiver base has no type parameters, so we can avoid the lookup below. - return fn - } - orig := NamedTypeOrigin(named) - gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) - - // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: - // package p - // type T *int - // func (*T) f() {} - // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. - // Here we make them consistent by force. - // (The go/types bug is general, but this workaround is reached only - // for generic T thanks to the early return above.) - if gfn == nil { - mset := types.NewMethodSet(types.NewPointer(orig)) - for i := 0; i < mset.Len(); i++ { - m := mset.At(i) - if m.Obj().Id() == fn.Id() { - gfn = m.Obj() - break - } - } - } - - return gfn.(*types.Func) -} - -// GenericAssignableTo is a generalization of types.AssignableTo that -// implements the following rule for uninstantiated generic types: -// -// If V and T are generic named types, then V is considered assignable to T if, -// for every possible instantation of V[A_1, ..., A_N], the instantiation -// T[A_1, ..., A_N] is valid and V[A_1, ..., A_N] implements T[A_1, ..., A_N]. -// -// If T has structural constraints, they must be satisfied by V. -// -// For example, consider the following type declarations: -// -// type Interface[T any] interface { -// Accept(T) -// } -// -// type Container[T any] struct { -// Element T -// } -// -// func (c Container[T]) Accept(t T) { c.Element = t } -// -// In this case, GenericAssignableTo reports that instantiations of Container -// are assignable to the corresponding instantiation of Interface. -func GenericAssignableTo(ctxt *Context, V, T types.Type) bool { - // If V and T are not both named, or do not have matching non-empty type - // parameter lists, fall back on types.AssignableTo. - - VN, Vnamed := V.(*types.Named) - TN, Tnamed := T.(*types.Named) - if !Vnamed || !Tnamed { - return types.AssignableTo(V, T) - } - - vtparams := ForNamed(VN) - ttparams := ForNamed(TN) - if vtparams.Len() == 0 || vtparams.Len() != ttparams.Len() || NamedTypeArgs(VN).Len() != 0 || NamedTypeArgs(TN).Len() != 0 { - return types.AssignableTo(V, T) - } - - // V and T have the same (non-zero) number of type params. Instantiate both - // with the type parameters of V. This must always succeed for V, and will - // succeed for T if and only if the type set of each type parameter of V is a - // subset of the type set of the corresponding type parameter of T, meaning - // that every instantiation of V corresponds to a valid instantiation of T. - - // Minor optimization: ensure we share a context across the two - // instantiations below. - if ctxt == nil { - ctxt = NewContext() - } - - var targs []types.Type - for i := 0; i < vtparams.Len(); i++ { - targs = append(targs, vtparams.At(i)) - } - - vinst, err := Instantiate(ctxt, V, targs, true) - if err != nil { - panic("type parameters should satisfy their own constraints") - } - - tinst, err := Instantiate(ctxt, T, targs, true) - if err != nil { - return false - } - - return types.AssignableTo(vinst, tinst) -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/coretype.go b/vendor/golang.org/x/tools/internal/typeparams/coretype.go deleted file mode 100644 index 993135e..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/coretype.go +++ /dev/null @@ -1,122 +0,0 @@ -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package typeparams - -import ( - "go/types" -) - -// CoreType returns the core type of T or nil if T does not have a core type. -// -// See https://go.dev/ref/spec#Core_types for the definition of a core type. -func CoreType(T types.Type) types.Type { - U := T.Underlying() - if _, ok := U.(*types.Interface); !ok { - return U // for non-interface types, - } - - terms, err := _NormalTerms(U) - if len(terms) == 0 || err != nil { - // len(terms) -> empty type set of interface. - // err != nil => U is invalid, exceeds complexity bounds, or has an empty type set. - return nil // no core type. - } - - U = terms[0].Type().Underlying() - var identical int // i in [0,identical) => Identical(U, terms[i].Type().Underlying()) - for identical = 1; identical < len(terms); identical++ { - if !types.Identical(U, terms[identical].Type().Underlying()) { - break - } - } - - if identical == len(terms) { - // https://go.dev/ref/spec#Core_types - // "There is a single type U which is the underlying type of all types in the type set of T" - return U - } - ch, ok := U.(*types.Chan) - if !ok { - return nil // no core type as identical < len(terms) and U is not a channel. - } - // https://go.dev/ref/spec#Core_types - // "the type chan E if T contains only bidirectional channels, or the type chan<- E or - // <-chan E depending on the direction of the directional channels present." - for chans := identical; chans < len(terms); chans++ { - curr, ok := terms[chans].Type().Underlying().(*types.Chan) - if !ok { - return nil - } - if !types.Identical(ch.Elem(), curr.Elem()) { - return nil // channel elements are not identical. - } - if ch.Dir() == types.SendRecv { - // ch is bidirectional. We can safely always use curr's direction. - ch = curr - } else if curr.Dir() != types.SendRecv && ch.Dir() != curr.Dir() { - // ch and curr are not bidirectional and not the same direction. - return nil - } - } - return ch -} - -// _NormalTerms returns a slice of terms representing the normalized structural -// type restrictions of a type, if any. -// -// For all types other than *types.TypeParam, *types.Interface, and -// *types.Union, this is just a single term with Tilde() == false and -// Type() == typ. For *types.TypeParam, *types.Interface, and *types.Union, see -// below. -// -// Structural type restrictions of a type parameter are created via -// non-interface types embedded in its constraint interface (directly, or via a -// chain of interface embeddings). For example, in the declaration type -// T[P interface{~int; m()}] int the structural restriction of the type -// parameter P is ~int. -// -// With interface embedding and unions, the specification of structural type -// restrictions may be arbitrarily complex. For example, consider the -// following: -// -// type A interface{ ~string|~[]byte } -// -// type B interface{ int|string } -// -// type C interface { ~string|~int } -// -// type T[P interface{ A|B; C }] int -// -// In this example, the structural type restriction of P is ~string|int: A|B -// expands to ~string|~[]byte|int|string, which reduces to ~string|~[]byte|int, -// which when intersected with C (~string|~int) yields ~string|int. -// -// _NormalTerms computes these expansions and reductions, producing a -// "normalized" form of the embeddings. A structural restriction is normalized -// if it is a single union containing no interface terms, and is minimal in the -// sense that removing any term changes the set of types satisfying the -// constraint. It is left as a proof for the reader that, modulo sorting, there -// is exactly one such normalized form. -// -// Because the minimal representation always takes this form, _NormalTerms -// returns a slice of tilde terms corresponding to the terms of the union in -// the normalized structural restriction. An error is returned if the type is -// invalid, exceeds complexity bounds, or has an empty type set. In the latter -// case, _NormalTerms returns ErrEmptyTypeSet. -// -// _NormalTerms makes no guarantees about the order of terms, except that it -// is deterministic. -func _NormalTerms(typ types.Type) ([]*Term, error) { - switch typ := typ.(type) { - case *TypeParam: - return StructuralTerms(typ) - case *Union: - return UnionTermSet(typ) - case *types.Interface: - return InterfaceTermSet(typ) - default: - return []*Term{NewTerm(false, typ)}, nil - } -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go b/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go deleted file mode 100644 index 1821239..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package typeparams - -// Enabled reports whether type parameters are enabled in the current build -// environment. -const Enabled = false diff --git a/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go b/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go deleted file mode 100644 index d671488..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go +++ /dev/null @@ -1,15 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.18 -// +build go1.18 - -package typeparams - -// Note: this constant is in a separate file as this is the only acceptable -// diff between the <1.18 API of this package and the 1.18 API. - -// Enabled reports whether type parameters are enabled in the current build -// environment. -const Enabled = true diff --git a/vendor/golang.org/x/tools/internal/typeparams/normalize.go b/vendor/golang.org/x/tools/internal/typeparams/normalize.go deleted file mode 100644 index 9c631b6..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/normalize.go +++ /dev/null @@ -1,218 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package typeparams - -import ( - "errors" - "fmt" - "go/types" - "os" - "strings" -) - -//go:generate go run copytermlist.go - -const debug = false - -var ErrEmptyTypeSet = errors.New("empty type set") - -// StructuralTerms returns a slice of terms representing the normalized -// structural type restrictions of a type parameter, if any. -// -// Structural type restrictions of a type parameter are created via -// non-interface types embedded in its constraint interface (directly, or via a -// chain of interface embeddings). For example, in the declaration -// -// type T[P interface{~int; m()}] int -// -// the structural restriction of the type parameter P is ~int. -// -// With interface embedding and unions, the specification of structural type -// restrictions may be arbitrarily complex. For example, consider the -// following: -// -// type A interface{ ~string|~[]byte } -// -// type B interface{ int|string } -// -// type C interface { ~string|~int } -// -// type T[P interface{ A|B; C }] int -// -// In this example, the structural type restriction of P is ~string|int: A|B -// expands to ~string|~[]byte|int|string, which reduces to ~string|~[]byte|int, -// which when intersected with C (~string|~int) yields ~string|int. -// -// StructuralTerms computes these expansions and reductions, producing a -// "normalized" form of the embeddings. A structural restriction is normalized -// if it is a single union containing no interface terms, and is minimal in the -// sense that removing any term changes the set of types satisfying the -// constraint. It is left as a proof for the reader that, modulo sorting, there -// is exactly one such normalized form. -// -// Because the minimal representation always takes this form, StructuralTerms -// returns a slice of tilde terms corresponding to the terms of the union in -// the normalized structural restriction. An error is returned if the -// constraint interface is invalid, exceeds complexity bounds, or has an empty -// type set. In the latter case, StructuralTerms returns ErrEmptyTypeSet. -// -// StructuralTerms makes no guarantees about the order of terms, except that it -// is deterministic. -func StructuralTerms(tparam *TypeParam) ([]*Term, error) { - constraint := tparam.Constraint() - if constraint == nil { - return nil, fmt.Errorf("%s has nil constraint", tparam) - } - iface, _ := constraint.Underlying().(*types.Interface) - if iface == nil { - return nil, fmt.Errorf("constraint is %T, not *types.Interface", constraint.Underlying()) - } - return InterfaceTermSet(iface) -} - -// InterfaceTermSet computes the normalized terms for a constraint interface, -// returning an error if the term set cannot be computed or is empty. In the -// latter case, the error will be ErrEmptyTypeSet. -// -// See the documentation of StructuralTerms for more information on -// normalization. -func InterfaceTermSet(iface *types.Interface) ([]*Term, error) { - return computeTermSet(iface) -} - -// UnionTermSet computes the normalized terms for a union, returning an error -// if the term set cannot be computed or is empty. In the latter case, the -// error will be ErrEmptyTypeSet. -// -// See the documentation of StructuralTerms for more information on -// normalization. -func UnionTermSet(union *Union) ([]*Term, error) { - return computeTermSet(union) -} - -func computeTermSet(typ types.Type) ([]*Term, error) { - tset, err := computeTermSetInternal(typ, make(map[types.Type]*termSet), 0) - if err != nil { - return nil, err - } - if tset.terms.isEmpty() { - return nil, ErrEmptyTypeSet - } - if tset.terms.isAll() { - return nil, nil - } - var terms []*Term - for _, term := range tset.terms { - terms = append(terms, NewTerm(term.tilde, term.typ)) - } - return terms, nil -} - -// A termSet holds the normalized set of terms for a given type. -// -// The name termSet is intentionally distinct from 'type set': a type set is -// all types that implement a type (and includes method restrictions), whereas -// a term set just represents the structural restrictions on a type. -type termSet struct { - complete bool - terms termlist -} - -func indentf(depth int, format string, args ...interface{}) { - fmt.Fprintf(os.Stderr, strings.Repeat(".", depth)+format+"\n", args...) -} - -func computeTermSetInternal(t types.Type, seen map[types.Type]*termSet, depth int) (res *termSet, err error) { - if t == nil { - panic("nil type") - } - - if debug { - indentf(depth, "%s", t.String()) - defer func() { - if err != nil { - indentf(depth, "=> %s", err) - } else { - indentf(depth, "=> %s", res.terms.String()) - } - }() - } - - const maxTermCount = 100 - if tset, ok := seen[t]; ok { - if !tset.complete { - return nil, fmt.Errorf("cycle detected in the declaration of %s", t) - } - return tset, nil - } - - // Mark the current type as seen to avoid infinite recursion. - tset := new(termSet) - defer func() { - tset.complete = true - }() - seen[t] = tset - - switch u := t.Underlying().(type) { - case *types.Interface: - // The term set of an interface is the intersection of the term sets of its - // embedded types. - tset.terms = allTermlist - for i := 0; i < u.NumEmbeddeds(); i++ { - embedded := u.EmbeddedType(i) - if _, ok := embedded.Underlying().(*TypeParam); ok { - return nil, fmt.Errorf("invalid embedded type %T", embedded) - } - tset2, err := computeTermSetInternal(embedded, seen, depth+1) - if err != nil { - return nil, err - } - tset.terms = tset.terms.intersect(tset2.terms) - } - case *Union: - // The term set of a union is the union of term sets of its terms. - tset.terms = nil - for i := 0; i < u.Len(); i++ { - t := u.Term(i) - var terms termlist - switch t.Type().Underlying().(type) { - case *types.Interface: - tset2, err := computeTermSetInternal(t.Type(), seen, depth+1) - if err != nil { - return nil, err - } - terms = tset2.terms - case *TypeParam, *Union: - // A stand-alone type parameter or union is not permitted as union - // term. - return nil, fmt.Errorf("invalid union term %T", t) - default: - if t.Type() == types.Typ[types.Invalid] { - continue - } - terms = termlist{{t.Tilde(), t.Type()}} - } - tset.terms = tset.terms.union(terms) - if len(tset.terms) > maxTermCount { - return nil, fmt.Errorf("exceeded max term count %d", maxTermCount) - } - } - case *TypeParam: - panic("unreachable") - default: - // For all other types, the term set is just a single non-tilde term - // holding the type itself. - if u != types.Typ[types.Invalid] { - tset.terms = termlist{{false, t}} - } - } - return tset, nil -} - -// under is a facade for the go/types internal function of the same name. It is -// used by typeterm.go. -func under(t types.Type) types.Type { - return t.Underlying() -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/termlist.go b/vendor/golang.org/x/tools/internal/typeparams/termlist.go deleted file mode 100644 index 933106a..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/termlist.go +++ /dev/null @@ -1,163 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Code generated by copytermlist.go DO NOT EDIT. - -package typeparams - -import ( - "bytes" - "go/types" -) - -// A termlist represents the type set represented by the union -// t1 βˆͺ y2 βˆͺ ... tn of the type sets of the terms t1 to tn. -// A termlist is in normal form if all terms are disjoint. -// termlist operations don't require the operands to be in -// normal form. -type termlist []*term - -// allTermlist represents the set of all types. -// It is in normal form. -var allTermlist = termlist{new(term)} - -// String prints the termlist exactly (without normalization). -func (xl termlist) String() string { - if len(xl) == 0 { - return "βˆ…" - } - var buf bytes.Buffer - for i, x := range xl { - if i > 0 { - buf.WriteString(" βˆͺ ") - } - buf.WriteString(x.String()) - } - return buf.String() -} - -// isEmpty reports whether the termlist xl represents the empty set of types. -func (xl termlist) isEmpty() bool { - // If there's a non-nil term, the entire list is not empty. - // If the termlist is in normal form, this requires at most - // one iteration. - for _, x := range xl { - if x != nil { - return false - } - } - return true -} - -// isAll reports whether the termlist xl represents the set of all types. -func (xl termlist) isAll() bool { - // If there's a 𝓀 term, the entire list is 𝓀. - // If the termlist is in normal form, this requires at most - // one iteration. - for _, x := range xl { - if x != nil && x.typ == nil { - return true - } - } - return false -} - -// norm returns the normal form of xl. -func (xl termlist) norm() termlist { - // Quadratic algorithm, but good enough for now. - // TODO(gri) fix asymptotic performance - used := make([]bool, len(xl)) - var rl termlist - for i, xi := range xl { - if xi == nil || used[i] { - continue - } - for j := i + 1; j < len(xl); j++ { - xj := xl[j] - if xj == nil || used[j] { - continue - } - if u1, u2 := xi.union(xj); u2 == nil { - // If we encounter a 𝓀 term, the entire list is 𝓀. - // Exit early. - // (Note that this is not just an optimization; - // if we continue, we may end up with a 𝓀 term - // and other terms and the result would not be - // in normal form.) - if u1.typ == nil { - return allTermlist - } - xi = u1 - used[j] = true // xj is now unioned into xi - ignore it in future iterations - } - } - rl = append(rl, xi) - } - return rl -} - -// union returns the union xl βˆͺ yl. -func (xl termlist) union(yl termlist) termlist { - return append(xl, yl...).norm() -} - -// intersect returns the intersection xl ∩ yl. -func (xl termlist) intersect(yl termlist) termlist { - if xl.isEmpty() || yl.isEmpty() { - return nil - } - - // Quadratic algorithm, but good enough for now. - // TODO(gri) fix asymptotic performance - var rl termlist - for _, x := range xl { - for _, y := range yl { - if r := x.intersect(y); r != nil { - rl = append(rl, r) - } - } - } - return rl.norm() -} - -// equal reports whether xl and yl represent the same type set. -func (xl termlist) equal(yl termlist) bool { - // TODO(gri) this should be more efficient - return xl.subsetOf(yl) && yl.subsetOf(xl) -} - -// includes reports whether t ∈ xl. -func (xl termlist) includes(t types.Type) bool { - for _, x := range xl { - if x.includes(t) { - return true - } - } - return false -} - -// supersetOf reports whether y βŠ† xl. -func (xl termlist) supersetOf(y *term) bool { - for _, x := range xl { - if y.subsetOf(x) { - return true - } - } - return false -} - -// subsetOf reports whether xl βŠ† yl. -func (xl termlist) subsetOf(yl termlist) bool { - if yl.isEmpty() { - return xl.isEmpty() - } - - // each term x of xl must be a subset of yl - for _, x := range xl { - if !yl.supersetOf(x) { - return false // x is not a subset yl - } - } - return true -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go deleted file mode 100644 index b478897..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go +++ /dev/null @@ -1,197 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.18 -// +build !go1.18 - -package typeparams - -import ( - "go/ast" - "go/token" - "go/types" -) - -func unsupported() { - panic("type parameters are unsupported at this go version") -} - -// IndexListExpr is a placeholder type, as type parameters are not supported at -// this Go version. Its methods panic on use. -type IndexListExpr struct { - ast.Expr - X ast.Expr // expression - Lbrack token.Pos // position of "[" - Indices []ast.Expr // index expressions - Rbrack token.Pos // position of "]" -} - -// ForTypeSpec returns an empty field list, as type parameters on not supported -// at this Go version. -func ForTypeSpec(*ast.TypeSpec) *ast.FieldList { - return nil -} - -// ForFuncType returns an empty field list, as type parameters are not -// supported at this Go version. -func ForFuncType(*ast.FuncType) *ast.FieldList { - return nil -} - -// TypeParam is a placeholder type, as type parameters are not supported at -// this Go version. Its methods panic on use. -type TypeParam struct{ types.Type } - -func (*TypeParam) Index() int { unsupported(); return 0 } -func (*TypeParam) Constraint() types.Type { unsupported(); return nil } -func (*TypeParam) Obj() *types.TypeName { unsupported(); return nil } - -// TypeParamList is a placeholder for an empty type parameter list. -type TypeParamList struct{} - -func (*TypeParamList) Len() int { return 0 } -func (*TypeParamList) At(int) *TypeParam { unsupported(); return nil } - -// TypeList is a placeholder for an empty type list. -type TypeList struct{} - -func (*TypeList) Len() int { return 0 } -func (*TypeList) At(int) types.Type { unsupported(); return nil } - -// NewTypeParam is unsupported at this Go version, and panics. -func NewTypeParam(name *types.TypeName, constraint types.Type) *TypeParam { - unsupported() - return nil -} - -// SetTypeParamConstraint is unsupported at this Go version, and panics. -func SetTypeParamConstraint(tparam *TypeParam, constraint types.Type) { - unsupported() -} - -// NewSignatureType calls types.NewSignature, panicking if recvTypeParams or -// typeParams is non-empty. -func NewSignatureType(recv *types.Var, recvTypeParams, typeParams []*TypeParam, params, results *types.Tuple, variadic bool) *types.Signature { - if len(recvTypeParams) != 0 || len(typeParams) != 0 { - panic("signatures cannot have type parameters at this Go version") - } - return types.NewSignature(recv, params, results, variadic) -} - -// ForSignature returns an empty slice. -func ForSignature(*types.Signature) *TypeParamList { - return nil -} - -// RecvTypeParams returns a nil slice. -func RecvTypeParams(sig *types.Signature) *TypeParamList { - return nil -} - -// IsComparable returns false, as no interfaces are type-restricted at this Go -// version. -func IsComparable(*types.Interface) bool { - return false -} - -// IsMethodSet returns true, as no interfaces are type-restricted at this Go -// version. -func IsMethodSet(*types.Interface) bool { - return true -} - -// IsImplicit returns false, as no interfaces are implicit at this Go version. -func IsImplicit(*types.Interface) bool { - return false -} - -// MarkImplicit does nothing, because this Go version does not have implicit -// interfaces. -func MarkImplicit(*types.Interface) {} - -// ForNamed returns an empty type parameter list, as type parameters are not -// supported at this Go version. -func ForNamed(*types.Named) *TypeParamList { - return nil -} - -// SetForNamed panics if tparams is non-empty. -func SetForNamed(_ *types.Named, tparams []*TypeParam) { - if len(tparams) > 0 { - unsupported() - } -} - -// NamedTypeArgs returns nil. -func NamedTypeArgs(*types.Named) *TypeList { - return nil -} - -// NamedTypeOrigin is the identity method at this Go version. -func NamedTypeOrigin(named *types.Named) types.Type { - return named -} - -// Term holds information about a structural type restriction. -type Term struct { - tilde bool - typ types.Type -} - -func (m *Term) Tilde() bool { return m.tilde } -func (m *Term) Type() types.Type { return m.typ } -func (m *Term) String() string { - pre := "" - if m.tilde { - pre = "~" - } - return pre + m.typ.String() -} - -// NewTerm is unsupported at this Go version, and panics. -func NewTerm(tilde bool, typ types.Type) *Term { - return &Term{tilde, typ} -} - -// Union is a placeholder type, as type parameters are not supported at this Go -// version. Its methods panic on use. -type Union struct{ types.Type } - -func (*Union) Len() int { return 0 } -func (*Union) Term(i int) *Term { unsupported(); return nil } - -// NewUnion is unsupported at this Go version, and panics. -func NewUnion(terms []*Term) *Union { - unsupported() - return nil -} - -// InitInstanceInfo is a noop at this Go version. -func InitInstanceInfo(*types.Info) {} - -// Instance is a placeholder type, as type parameters are not supported at this -// Go version. -type Instance struct { - TypeArgs *TypeList - Type types.Type -} - -// GetInstances returns a nil map, as type parameters are not supported at this -// Go version. -func GetInstances(info *types.Info) map[*ast.Ident]Instance { return nil } - -// Context is a placeholder type, as type parameters are not supported at -// this Go version. -type Context struct{} - -// NewContext returns a placeholder Context instance. -func NewContext() *Context { - return &Context{} -} - -// Instantiate is unsupported on this Go version, and panics. -func Instantiate(ctxt *Context, typ types.Type, targs []types.Type, validate bool) (types.Type, error) { - unsupported() - return nil, nil -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go deleted file mode 100644 index 114a36b..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go +++ /dev/null @@ -1,151 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.18 -// +build go1.18 - -package typeparams - -import ( - "go/ast" - "go/types" -) - -// IndexListExpr is an alias for ast.IndexListExpr. -type IndexListExpr = ast.IndexListExpr - -// ForTypeSpec returns n.TypeParams. -func ForTypeSpec(n *ast.TypeSpec) *ast.FieldList { - if n == nil { - return nil - } - return n.TypeParams -} - -// ForFuncType returns n.TypeParams. -func ForFuncType(n *ast.FuncType) *ast.FieldList { - if n == nil { - return nil - } - return n.TypeParams -} - -// TypeParam is an alias for types.TypeParam -type TypeParam = types.TypeParam - -// TypeParamList is an alias for types.TypeParamList -type TypeParamList = types.TypeParamList - -// TypeList is an alias for types.TypeList -type TypeList = types.TypeList - -// NewTypeParam calls types.NewTypeParam. -func NewTypeParam(name *types.TypeName, constraint types.Type) *TypeParam { - return types.NewTypeParam(name, constraint) -} - -// SetTypeParamConstraint calls tparam.SetConstraint(constraint). -func SetTypeParamConstraint(tparam *TypeParam, constraint types.Type) { - tparam.SetConstraint(constraint) -} - -// NewSignatureType calls types.NewSignatureType. -func NewSignatureType(recv *types.Var, recvTypeParams, typeParams []*TypeParam, params, results *types.Tuple, variadic bool) *types.Signature { - return types.NewSignatureType(recv, recvTypeParams, typeParams, params, results, variadic) -} - -// ForSignature returns sig.TypeParams() -func ForSignature(sig *types.Signature) *TypeParamList { - return sig.TypeParams() -} - -// RecvTypeParams returns sig.RecvTypeParams(). -func RecvTypeParams(sig *types.Signature) *TypeParamList { - return sig.RecvTypeParams() -} - -// IsComparable calls iface.IsComparable(). -func IsComparable(iface *types.Interface) bool { - return iface.IsComparable() -} - -// IsMethodSet calls iface.IsMethodSet(). -func IsMethodSet(iface *types.Interface) bool { - return iface.IsMethodSet() -} - -// IsImplicit calls iface.IsImplicit(). -func IsImplicit(iface *types.Interface) bool { - return iface.IsImplicit() -} - -// MarkImplicit calls iface.MarkImplicit(). -func MarkImplicit(iface *types.Interface) { - iface.MarkImplicit() -} - -// ForNamed extracts the (possibly empty) type parameter object list from -// named. -func ForNamed(named *types.Named) *TypeParamList { - return named.TypeParams() -} - -// SetForNamed sets the type params tparams on n. Each tparam must be of -// dynamic type *types.TypeParam. -func SetForNamed(n *types.Named, tparams []*TypeParam) { - n.SetTypeParams(tparams) -} - -// NamedTypeArgs returns named.TypeArgs(). -func NamedTypeArgs(named *types.Named) *TypeList { - return named.TypeArgs() -} - -// NamedTypeOrigin returns named.Orig(). -func NamedTypeOrigin(named *types.Named) types.Type { - return named.Origin() -} - -// Term is an alias for types.Term. -type Term = types.Term - -// NewTerm calls types.NewTerm. -func NewTerm(tilde bool, typ types.Type) *Term { - return types.NewTerm(tilde, typ) -} - -// Union is an alias for types.Union -type Union = types.Union - -// NewUnion calls types.NewUnion. -func NewUnion(terms []*Term) *Union { - return types.NewUnion(terms) -} - -// InitInstanceInfo initializes info to record information about type and -// function instances. -func InitInstanceInfo(info *types.Info) { - info.Instances = make(map[*ast.Ident]types.Instance) -} - -// Instance is an alias for types.Instance. -type Instance = types.Instance - -// GetInstances returns info.Instances. -func GetInstances(info *types.Info) map[*ast.Ident]Instance { - return info.Instances -} - -// Context is an alias for types.Context. -type Context = types.Context - -// NewContext calls types.NewContext. -func NewContext() *Context { - return types.NewContext() -} - -// Instantiate calls types.Instantiate. -func Instantiate(ctxt *Context, typ types.Type, targs []types.Type, validate bool) (types.Type, error) { - return types.Instantiate(ctxt, typ, targs, validate) -} diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go b/vendor/golang.org/x/tools/internal/typeparams/typeterm.go deleted file mode 100644 index 7ddee28..0000000 --- a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go +++ /dev/null @@ -1,170 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Code generated by copytermlist.go DO NOT EDIT. - -package typeparams - -import "go/types" - -// A term describes elementary type sets: -// -// βˆ…: (*term)(nil) == βˆ… // set of no types (empty set) -// 𝓀: &term{} == 𝓀 // set of all types (𝓀niverse) -// T: &term{false, T} == {T} // set of type T -// ~t: &term{true, t} == {t' | under(t') == t} // set of types with underlying type t -// -type term struct { - tilde bool // valid if typ != nil - typ types.Type -} - -func (x *term) String() string { - switch { - case x == nil: - return "βˆ…" - case x.typ == nil: - return "𝓀" - case x.tilde: - return "~" + x.typ.String() - default: - return x.typ.String() - } -} - -// equal reports whether x and y represent the same type set. -func (x *term) equal(y *term) bool { - // easy cases - switch { - case x == nil || y == nil: - return x == y - case x.typ == nil || y.typ == nil: - return x.typ == y.typ - } - // βˆ… βŠ‚ x, y βŠ‚ 𝓀 - - return x.tilde == y.tilde && types.Identical(x.typ, y.typ) -} - -// union returns the union x βˆͺ y: zero, one, or two non-nil terms. -func (x *term) union(y *term) (_, _ *term) { - // easy cases - switch { - case x == nil && y == nil: - return nil, nil // βˆ… βˆͺ βˆ… == βˆ… - case x == nil: - return y, nil // βˆ… βˆͺ y == y - case y == nil: - return x, nil // x βˆͺ βˆ… == x - case x.typ == nil: - return x, nil // 𝓀 βˆͺ y == 𝓀 - case y.typ == nil: - return y, nil // x βˆͺ 𝓀 == 𝓀 - } - // βˆ… βŠ‚ x, y βŠ‚ 𝓀 - - if x.disjoint(y) { - return x, y // x βˆͺ y == (x, y) if x ∩ y == βˆ… - } - // x.typ == y.typ - - // ~t βˆͺ ~t == ~t - // ~t βˆͺ T == ~t - // T βˆͺ ~t == ~t - // T βˆͺ T == T - if x.tilde || !y.tilde { - return x, nil - } - return y, nil -} - -// intersect returns the intersection x ∩ y. -func (x *term) intersect(y *term) *term { - // easy cases - switch { - case x == nil || y == nil: - return nil // βˆ… ∩ y == βˆ… and ∩ βˆ… == βˆ… - case x.typ == nil: - return y // 𝓀 ∩ y == y - case y.typ == nil: - return x // x ∩ 𝓀 == x - } - // βˆ… βŠ‚ x, y βŠ‚ 𝓀 - - if x.disjoint(y) { - return nil // x ∩ y == βˆ… if x ∩ y == βˆ… - } - // x.typ == y.typ - - // ~t ∩ ~t == ~t - // ~t ∩ T == T - // T ∩ ~t == T - // T ∩ T == T - if !x.tilde || y.tilde { - return x - } - return y -} - -// includes reports whether t ∈ x. -func (x *term) includes(t types.Type) bool { - // easy cases - switch { - case x == nil: - return false // t ∈ βˆ… == false - case x.typ == nil: - return true // t ∈ 𝓀 == true - } - // βˆ… βŠ‚ x βŠ‚ 𝓀 - - u := t - if x.tilde { - u = under(u) - } - return types.Identical(x.typ, u) -} - -// subsetOf reports whether x βŠ† y. -func (x *term) subsetOf(y *term) bool { - // easy cases - switch { - case x == nil: - return true // βˆ… βŠ† y == true - case y == nil: - return false // x βŠ† βˆ… == false since x != βˆ… - case y.typ == nil: - return true // x βŠ† 𝓀 == true - case x.typ == nil: - return false // 𝓀 βŠ† y == false since y != 𝓀 - } - // βˆ… βŠ‚ x, y βŠ‚ 𝓀 - - if x.disjoint(y) { - return false // x βŠ† y == false if x ∩ y == βˆ… - } - // x.typ == y.typ - - // ~t βŠ† ~t == true - // ~t βŠ† T == false - // T βŠ† ~t == true - // T βŠ† T == true - return !x.tilde || y.tilde -} - -// disjoint reports whether x ∩ y == βˆ…. -// x.typ and y.typ must not be nil. -func (x *term) disjoint(y *term) bool { - if debug && (x.typ == nil || y.typ == nil) { - panic("invalid argument(s)") - } - ux := x.typ - if y.tilde { - ux = under(ux) - } - uy := y.typ - if x.tilde { - uy = under(uy) - } - return !types.Identical(ux, uy) -} diff --git a/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go b/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go index 0748407..834e053 100644 --- a/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go +++ b/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go @@ -167,7 +167,7 @@ const ( UntypedNilUse // WrongAssignCount occurs when the number of values on the right-hand side - // of an assignment or or initialization expression does not match the number + // of an assignment or initialization expression does not match the number // of variables on the left-hand side. // // Example: @@ -1449,10 +1449,10 @@ const ( NotAGenericType // WrongTypeArgCount occurs when a type or function is instantiated with an - // incorrent number of type arguments, including when a generic type or + // incorrect number of type arguments, including when a generic type or // function is used without instantiation. // - // Errors inolving failed type inference are assigned other error codes. + // Errors involving failed type inference are assigned other error codes. // // Example: // type T[p any] int diff --git a/vendor/golang.org/x/tools/internal/typesinternal/recv.go b/vendor/golang.org/x/tools/internal/typesinternal/recv.go new file mode 100644 index 0000000..fea7c8b --- /dev/null +++ b/vendor/golang.org/x/tools/internal/typesinternal/recv.go @@ -0,0 +1,43 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package typesinternal + +import ( + "go/types" + + "golang.org/x/tools/internal/aliases" +) + +// ReceiverNamed returns the named type (if any) associated with the +// type of recv, which may be of the form N or *N, or aliases thereof. +// It also reports whether a Pointer was present. +func ReceiverNamed(recv *types.Var) (isPtr bool, named *types.Named) { + t := recv.Type() + if ptr, ok := aliases.Unalias(t).(*types.Pointer); ok { + isPtr = true + t = ptr.Elem() + } + named, _ = aliases.Unalias(t).(*types.Named) + return +} + +// Unpointer returns T given *T or an alias thereof. +// For all other types it is the identity function. +// It does not look at underlying types. +// The result may be an alias. +// +// Use this function to strip off the optional pointer on a receiver +// in a field or method selection, without losing the named type +// (which is needed to compute the method set). +// +// See also [typeparams.MustDeref], which removes one level of +// indirection from the type, regardless of named types (analogous to +// a LOAD instruction). +func Unpointer(t types.Type) types.Type { + if ptr, ok := aliases.Unalias(t).(*types.Pointer); ok { + return ptr.Elem() + } + return t +} diff --git a/vendor/golang.org/x/tools/internal/typesinternal/toonew.go b/vendor/golang.org/x/tools/internal/typesinternal/toonew.go new file mode 100644 index 0000000..cc86487 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/typesinternal/toonew.go @@ -0,0 +1,89 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package typesinternal + +import ( + "go/types" + + "golang.org/x/tools/internal/stdlib" + "golang.org/x/tools/internal/versions" +) + +// TooNewStdSymbols computes the set of package-level symbols +// exported by pkg that are not available at the specified version. +// The result maps each symbol to its minimum version. +// +// The pkg is allowed to contain type errors. +func TooNewStdSymbols(pkg *types.Package, version string) map[types.Object]string { + disallowed := make(map[types.Object]string) + + // Pass 1: package-level symbols. + symbols := stdlib.PackageSymbols[pkg.Path()] + for _, sym := range symbols { + symver := sym.Version.String() + if versions.Before(version, symver) { + switch sym.Kind { + case stdlib.Func, stdlib.Var, stdlib.Const, stdlib.Type: + disallowed[pkg.Scope().Lookup(sym.Name)] = symver + } + } + } + + // Pass 2: fields and methods. + // + // We allow fields and methods if their associated type is + // disallowed, as otherwise we would report false positives + // for compatibility shims. Consider: + // + // //go:build go1.22 + // type T struct { F std.Real } // correct new API + // + // //go:build !go1.22 + // type T struct { F fake } // shim + // type fake struct { ... } + // func (fake) M () {} + // + // These alternative declarations of T use either the std.Real + // type, introduced in go1.22, or a fake type, for the field + // F. (The fakery could be arbitrarily deep, involving more + // nested fields and methods than are shown here.) Clients + // that use the compatibility shim T will compile with any + // version of go, whether older or newer than go1.22, but only + // the newer version will use the std.Real implementation. + // + // Now consider a reference to method M in new(T).F.M() in a + // module that requires a minimum of go1.21. The analysis may + // occur using a version of Go higher than 1.21, selecting the + // first version of T, so the method M is Real.M. This would + // spuriously cause the analyzer to report a reference to a + // too-new symbol even though this expression compiles just + // fine (with the fake implementation) using go1.21. + for _, sym := range symbols { + symVersion := sym.Version.String() + if !versions.Before(version, symVersion) { + continue // allowed + } + + var obj types.Object + switch sym.Kind { + case stdlib.Field: + typename, name := sym.SplitField() + if t := pkg.Scope().Lookup(typename); t != nil && disallowed[t] == "" { + obj, _, _ = types.LookupFieldOrMethod(t.Type(), false, pkg, name) + } + + case stdlib.Method: + ptr, recvname, name := sym.SplitMethod() + if t := pkg.Scope().Lookup(recvname); t != nil && disallowed[t] == "" { + obj, _, _ = types.LookupFieldOrMethod(t.Type(), ptr, pkg, name) + } + } + if obj != nil { + disallowed[obj] = symVersion + } + } + + return disallowed +} diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types.go b/vendor/golang.org/x/tools/internal/typesinternal/types.go index ce7d435..7c77c2f 100644 --- a/vendor/golang.org/x/tools/internal/typesinternal/types.go +++ b/vendor/golang.org/x/tools/internal/typesinternal/types.go @@ -48,5 +48,3 @@ func ReadGo116ErrorData(err types.Error) (code ErrorCode, start, end token.Pos, } return ErrorCode(data[0]), token.Pos(data[1]), token.Pos(data[2]), true } - -var SetGoVersion = func(conf *types.Config, version string) bool { return false } diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types_118.go b/vendor/golang.org/x/tools/internal/typesinternal/types_118.go deleted file mode 100644 index a42b072..0000000 --- a/vendor/golang.org/x/tools/internal/typesinternal/types_118.go +++ /dev/null @@ -1,19 +0,0 @@ -// Copyright 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.18 -// +build go1.18 - -package typesinternal - -import ( - "go/types" -) - -func init() { - SetGoVersion = func(conf *types.Config, version string) bool { - conf.GoVersion = version - return true - } -} diff --git a/vendor/golang.org/x/tools/internal/versions/features.go b/vendor/golang.org/x/tools/internal/versions/features.go new file mode 100644 index 0000000..b53f178 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/features.go @@ -0,0 +1,43 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package versions + +// This file contains predicates for working with file versions to +// decide when a tool should consider a language feature enabled. + +// GoVersions that features in x/tools can be gated to. +const ( + Go1_18 = "go1.18" + Go1_19 = "go1.19" + Go1_20 = "go1.20" + Go1_21 = "go1.21" + Go1_22 = "go1.22" +) + +// Future is an invalid unknown Go version sometime in the future. +// Do not use directly with Compare. +const Future = "" + +// AtLeast reports whether the file version v comes after a Go release. +// +// Use this predicate to enable a behavior once a certain Go release +// has happened (and stays enabled in the future). +func AtLeast(v, release string) bool { + if v == Future { + return true // an unknown future version is always after y. + } + return Compare(Lang(v), Lang(release)) >= 0 +} + +// Before reports whether the file version v is strictly before a Go release. +// +// Use this predicate to disable a behavior once a certain Go release +// has happened (and stays enabled in the future). +func Before(v, release string) bool { + if v == Future { + return false // an unknown future version happens after y. + } + return Compare(Lang(v), Lang(release)) < 0 +} diff --git a/vendor/golang.org/x/tools/internal/versions/gover.go b/vendor/golang.org/x/tools/internal/versions/gover.go new file mode 100644 index 0000000..bbabcd2 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/gover.go @@ -0,0 +1,172 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// This is a fork of internal/gover for use by x/tools until +// go1.21 and earlier are no longer supported by x/tools. + +package versions + +import "strings" + +// A gover is a parsed Go gover: major[.Minor[.Patch]][kind[pre]] +// The numbers are the original decimal strings to avoid integer overflows +// and since there is very little actual math. (Probably overflow doesn't matter in practice, +// but at the time this code was written, there was an existing test that used +// go1.99999999999, which does not fit in an int on 32-bit platforms. +// The "big decimal" representation avoids the problem entirely.) +type gover struct { + major string // decimal + minor string // decimal or "" + patch string // decimal or "" + kind string // "", "alpha", "beta", "rc" + pre string // decimal or "" +} + +// compare returns -1, 0, or +1 depending on whether +// x < y, x == y, or x > y, interpreted as toolchain versions. +// The versions x and y must not begin with a "go" prefix: just "1.21" not "go1.21". +// Malformed versions compare less than well-formed versions and equal to each other. +// The language version "1.21" compares less than the release candidate and eventual releases "1.21rc1" and "1.21.0". +func compare(x, y string) int { + vx := parse(x) + vy := parse(y) + + if c := cmpInt(vx.major, vy.major); c != 0 { + return c + } + if c := cmpInt(vx.minor, vy.minor); c != 0 { + return c + } + if c := cmpInt(vx.patch, vy.patch); c != 0 { + return c + } + if c := strings.Compare(vx.kind, vy.kind); c != 0 { // "" < alpha < beta < rc + return c + } + if c := cmpInt(vx.pre, vy.pre); c != 0 { + return c + } + return 0 +} + +// lang returns the Go language version. For example, lang("1.2.3") == "1.2". +func lang(x string) string { + v := parse(x) + if v.minor == "" || v.major == "1" && v.minor == "0" { + return v.major + } + return v.major + "." + v.minor +} + +// isValid reports whether the version x is valid. +func isValid(x string) bool { + return parse(x) != gover{} +} + +// parse parses the Go version string x into a version. +// It returns the zero version if x is malformed. +func parse(x string) gover { + var v gover + + // Parse major version. + var ok bool + v.major, x, ok = cutInt(x) + if !ok { + return gover{} + } + if x == "" { + // Interpret "1" as "1.0.0". + v.minor = "0" + v.patch = "0" + return v + } + + // Parse . before minor version. + if x[0] != '.' { + return gover{} + } + + // Parse minor version. + v.minor, x, ok = cutInt(x[1:]) + if !ok { + return gover{} + } + if x == "" { + // Patch missing is same as "0" for older versions. + // Starting in Go 1.21, patch missing is different from explicit .0. + if cmpInt(v.minor, "21") < 0 { + v.patch = "0" + } + return v + } + + // Parse patch if present. + if x[0] == '.' { + v.patch, x, ok = cutInt(x[1:]) + if !ok || x != "" { + // Note that we are disallowing prereleases (alpha, beta, rc) for patch releases here (x != ""). + // Allowing them would be a bit confusing because we already have: + // 1.21 < 1.21rc1 + // But a prerelease of a patch would have the opposite effect: + // 1.21.3rc1 < 1.21.3 + // We've never needed them before, so let's not start now. + return gover{} + } + return v + } + + // Parse prerelease. + i := 0 + for i < len(x) && (x[i] < '0' || '9' < x[i]) { + if x[i] < 'a' || 'z' < x[i] { + return gover{} + } + i++ + } + if i == 0 { + return gover{} + } + v.kind, x = x[:i], x[i:] + if x == "" { + return v + } + v.pre, x, ok = cutInt(x) + if !ok || x != "" { + return gover{} + } + + return v +} + +// cutInt scans the leading decimal number at the start of x to an integer +// and returns that value and the rest of the string. +func cutInt(x string) (n, rest string, ok bool) { + i := 0 + for i < len(x) && '0' <= x[i] && x[i] <= '9' { + i++ + } + if i == 0 || x[0] == '0' && i != 1 { // no digits or unnecessary leading zero + return "", "", false + } + return x[:i], x[i:], true +} + +// cmpInt returns cmp.Compare(x, y) interpreting x and y as decimal numbers. +// (Copied from golang.org/x/mod/semver's compareInt.) +func cmpInt(x, y string) int { + if x == y { + return 0 + } + if len(x) < len(y) { + return -1 + } + if len(x) > len(y) { + return +1 + } + if x < y { + return -1 + } else { + return +1 + } +} diff --git a/vendor/golang.org/x/tools/internal/versions/toolchain.go b/vendor/golang.org/x/tools/internal/versions/toolchain.go new file mode 100644 index 0000000..377bf7a --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/toolchain.go @@ -0,0 +1,14 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package versions + +// toolchain is maximum version (<1.22) that the go toolchain used +// to build the current tool is known to support. +// +// When a tool is built with >=1.22, the value of toolchain is unused. +// +// x/tools does not support building with go <1.18. So we take this +// as the minimum possible maximum. +var toolchain string = Go1_18 diff --git a/vendor/golang.org/x/tools/internal/versions/toolchain_go119.go b/vendor/golang.org/x/tools/internal/versions/toolchain_go119.go new file mode 100644 index 0000000..f65beed --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/toolchain_go119.go @@ -0,0 +1,14 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.19 +// +build go1.19 + +package versions + +func init() { + if Compare(toolchain, Go1_19) < 0 { + toolchain = Go1_19 + } +} diff --git a/vendor/golang.org/x/tools/internal/versions/toolchain_go120.go b/vendor/golang.org/x/tools/internal/versions/toolchain_go120.go new file mode 100644 index 0000000..1a9efa1 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/toolchain_go120.go @@ -0,0 +1,14 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.20 +// +build go1.20 + +package versions + +func init() { + if Compare(toolchain, Go1_20) < 0 { + toolchain = Go1_20 + } +} diff --git a/vendor/golang.org/x/tools/internal/versions/toolchain_go121.go b/vendor/golang.org/x/tools/internal/versions/toolchain_go121.go new file mode 100644 index 0000000..b7ef216 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/toolchain_go121.go @@ -0,0 +1,14 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.21 +// +build go1.21 + +package versions + +func init() { + if Compare(toolchain, Go1_21) < 0 { + toolchain = Go1_21 + } +} diff --git a/vendor/golang.org/x/tools/internal/versions/types.go b/vendor/golang.org/x/tools/internal/versions/types.go new file mode 100644 index 0000000..562eef2 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/types.go @@ -0,0 +1,19 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package versions + +import ( + "go/types" +) + +// GoVersion returns the Go version of the type package. +// It returns zero if no version can be determined. +func GoVersion(pkg *types.Package) string { + // TODO(taking): x/tools can call GoVersion() [from 1.21] after 1.25. + if pkg, ok := any(pkg).(interface{ GoVersion() string }); ok { + return pkg.GoVersion() + } + return "" +} diff --git a/vendor/golang.org/x/tools/internal/versions/types_go121.go b/vendor/golang.org/x/tools/internal/versions/types_go121.go new file mode 100644 index 0000000..b4345d3 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/types_go121.go @@ -0,0 +1,30 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.22 +// +build !go1.22 + +package versions + +import ( + "go/ast" + "go/types" +) + +// FileVersion returns a language version (<=1.21) derived from runtime.Version() +// or an unknown future version. +func FileVersion(info *types.Info, file *ast.File) string { + // In x/tools built with Go <= 1.21, we do not have Info.FileVersions + // available. We use a go version derived from the toolchain used to + // compile the tool by default. + // This will be <= go1.21. We take this as the maximum version that + // this tool can support. + // + // There are no features currently in x/tools that need to tell fine grained + // differences for versions <1.22. + return toolchain +} + +// InitFileVersions is a noop when compiled with this Go version. +func InitFileVersions(*types.Info) {} diff --git a/vendor/golang.org/x/tools/internal/versions/types_go122.go b/vendor/golang.org/x/tools/internal/versions/types_go122.go new file mode 100644 index 0000000..e818063 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/types_go122.go @@ -0,0 +1,41 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.22 +// +build go1.22 + +package versions + +import ( + "go/ast" + "go/types" +) + +// FileVersions returns a file's Go version. +// The reported version is an unknown Future version if a +// version cannot be determined. +func FileVersion(info *types.Info, file *ast.File) string { + // In tools built with Go >= 1.22, the Go version of a file + // follow a cascades of sources: + // 1) types.Info.FileVersion, which follows the cascade: + // 1.a) file version (ast.File.GoVersion), + // 1.b) the package version (types.Config.GoVersion), or + // 2) is some unknown Future version. + // + // File versions require a valid package version to be provided to types + // in Config.GoVersion. Config.GoVersion is either from the package's module + // or the toolchain (go run). This value should be provided by go/packages + // or unitchecker.Config.GoVersion. + if v := info.FileVersions[file]; IsValid(v) { + return v + } + // Note: we could instead return runtime.Version() [if valid]. + // This would act as a max version on what a tool can support. + return Future +} + +// InitFileVersions initializes info to record Go versions for Go files. +func InitFileVersions(info *types.Info) { + info.FileVersions = make(map[*ast.File]string) +} diff --git a/vendor/golang.org/x/tools/internal/versions/versions.go b/vendor/golang.org/x/tools/internal/versions/versions.go new file mode 100644 index 0000000..8d1f745 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/versions/versions.go @@ -0,0 +1,57 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package versions + +import ( + "strings" +) + +// Note: If we use build tags to use go/versions when go >=1.22, +// we run into go.dev/issue/53737. Under some operations users would see an +// import of "go/versions" even if they would not compile the file. +// For example, during `go get -u ./...` (go.dev/issue/64490) we do not try to include +// For this reason, this library just a clone of go/versions for the moment. + +// Lang returns the Go language version for version x. +// If x is not a valid version, Lang returns the empty string. +// For example: +// +// Lang("go1.21rc2") = "go1.21" +// Lang("go1.21.2") = "go1.21" +// Lang("go1.21") = "go1.21" +// Lang("go1") = "go1" +// Lang("bad") = "" +// Lang("1.21") = "" +func Lang(x string) string { + v := lang(stripGo(x)) + if v == "" { + return "" + } + return x[:2+len(v)] // "go"+v without allocation +} + +// Compare returns -1, 0, or +1 depending on whether +// x < y, x == y, or x > y, interpreted as Go versions. +// The versions x and y must begin with a "go" prefix: "go1.21" not "1.21". +// Invalid versions, including the empty string, compare less than +// valid versions and equal to each other. +// The language version "go1.21" compares less than the +// release candidate and eventual releases "go1.21rc1" and "go1.21.0". +// Custom toolchain suffixes are ignored during comparison: +// "go1.21.0" and "go1.21.0-bigcorp" are equal. +func Compare(x, y string) int { return compare(stripGo(x), stripGo(y)) } + +// IsValid reports whether the version x is valid. +func IsValid(x string) bool { return isValid(stripGo(x)) } + +// stripGo converts from a "go1.21" version to a "1.21" version. +// If v does not start with "go", stripGo returns the empty string (a known invalid version). +func stripGo(v string) string { + v, _, _ = strings.Cut(v, "-") // strip -bigcorp suffix. + if len(v) < 2 || v[:2] != "go" { + return "" + } + return v[2:] +} diff --git a/vendor/modules.txt b/vendor/modules.txt index 6220cf1..2599d88 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,24 +1,25 @@ -# github.com/caddyserver/certmagic v0.20.0 -## explicit; go 1.19 +# github.com/caddyserver/certmagic v0.21.2 +## explicit; go 1.21 github.com/caddyserver/certmagic +# github.com/caddyserver/zerossl v0.1.3 +## explicit; go 1.21 +github.com/caddyserver/zerossl # github.com/go-chi/chi/v5 v5.0.12 ## explicit; go 1.14 github.com/go-chi/chi/v5 -# github.com/klauspost/cpuid/v2 v2.2.5 +# github.com/klauspost/cpuid/v2 v2.2.7 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 -# github.com/libdns/libdns v0.2.1 -## explicit; go 1.14 +# github.com/libdns/libdns v0.2.2 +## explicit; go 1.18 github.com/libdns/libdns -# github.com/mholt/acmez v1.2.0 +# github.com/mholt/acmez/v2 v2.0.1 ## explicit; go 1.20 -github.com/mholt/acmez -github.com/mholt/acmez/acme -# github.com/miekg/dns v1.1.55 +github.com/mholt/acmez/v2 +github.com/mholt/acmez/v2/acme +# github.com/miekg/dns v1.1.59 ## explicit; go 1.19 github.com/miekg/dns -# github.com/pkg/errors v0.9.1 -## explicit # github.com/rs/xid v1.5.0 ## explicit; go 1.12 github.com/rs/xid @@ -34,13 +35,10 @@ github.com/zeebo/blake3/internal/alg/hash/hash_avx2 github.com/zeebo/blake3/internal/alg/hash/hash_pure github.com/zeebo/blake3/internal/consts github.com/zeebo/blake3/internal/utils -# go.uber.org/atomic v1.11.0 -## explicit; go 1.18 -go.uber.org/atomic # go.uber.org/multierr v1.11.0 ## explicit; go 1.19 go.uber.org/multierr -# go.uber.org/zap v1.24.0 +# go.uber.org/zap v1.27.0 ## explicit; go 1.19 go.uber.org/zap go.uber.org/zap/buffer @@ -48,8 +46,10 @@ go.uber.org/zap/internal go.uber.org/zap/internal/bufferpool go.uber.org/zap/internal/color go.uber.org/zap/internal/exit +go.uber.org/zap/internal/pool +go.uber.org/zap/internal/stacktrace go.uber.org/zap/zapcore -# golang.org/x/crypto v0.21.0 +# golang.org/x/crypto v0.23.0 ## explicit; go 1.18 golang.org/x/crypto/cryptobyte golang.org/x/crypto/cryptobyte/asn1 @@ -60,10 +60,10 @@ golang.org/x/exp/constraints golang.org/x/exp/slices golang.org/x/exp/slog golang.org/x/exp/slog/internal/buffer -# golang.org/x/mod v0.11.0 -## explicit; go 1.17 +# golang.org/x/mod v0.17.0 +## explicit; go 1.18 golang.org/x/mod/semver -# golang.org/x/net v0.23.0 +# golang.org/x/net v0.25.0 ## explicit; go 1.18 golang.org/x/net/bpf golang.org/x/net/idna @@ -71,31 +71,35 @@ golang.org/x/net/internal/iana golang.org/x/net/internal/socket golang.org/x/net/ipv4 golang.org/x/net/ipv6 -# golang.org/x/sys v0.18.0 +# golang.org/x/sync v0.7.0 +## explicit; go 1.18 +golang.org/x/sync/errgroup +# golang.org/x/sys v0.20.0 ## explicit; go 1.18 -golang.org/x/sys/execabs golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.14.0 +# golang.org/x/text v0.15.0 ## explicit; go 1.18 golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi golang.org/x/text/unicode/norm -# golang.org/x/tools v0.10.0 -## explicit; go 1.18 +# golang.org/x/tools v0.21.0 +## explicit; go 1.19 golang.org/x/tools/go/gcexportdata golang.org/x/tools/go/internal/packagesdriver golang.org/x/tools/go/packages +golang.org/x/tools/go/types/objectpath +golang.org/x/tools/internal/aliases golang.org/x/tools/internal/event golang.org/x/tools/internal/event/core golang.org/x/tools/internal/event/keys golang.org/x/tools/internal/event/label -golang.org/x/tools/internal/event/tag golang.org/x/tools/internal/gcimporter golang.org/x/tools/internal/gocommand golang.org/x/tools/internal/packagesinternal golang.org/x/tools/internal/pkgbits +golang.org/x/tools/internal/stdlib golang.org/x/tools/internal/tokeninternal -golang.org/x/tools/internal/typeparams golang.org/x/tools/internal/typesinternal +golang.org/x/tools/internal/versions