diff --git a/.nojekyll b/.nojekyll new file mode 100644 index 0000000000..e69de29bb2 diff --git a/CNAME b/CNAME new file mode 100644 index 0000000000..b501781d13 --- /dev/null +++ b/CNAME @@ -0,0 +1 @@ +workflows.community \ No newline at end of file diff --git a/about.html b/about.html new file mode 100644 index 0000000000..e4751caa3e --- /dev/null +++ b/about.html @@ -0,0 +1,792 @@ + + + + + About - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ About +

+
+
+
+
+ +
+
+
+
+
+
+

The Workflows Community Initiative (WCI) is a community-centered effort for gathering and + promoting long-standing and recent community-focused efforts

+
+
+ +
+
+ Our Board of Directors +

Leadership

+
+
+ +
+ + +
+
+
+ Rafael Ferreira da Silva + Executive Director +
+ + Rafael Ferreira da Silva + + + Oak Ridge National Laboratory + +
+
+ +
+
+
+ Kyle Chard + Deputy Executive Director +
+ + Kyle Chard + + + University of Chicago + +
+
+ +
+
+
+ Rosa M. Badia + Director of Systems and Applications Performance +
+ + Rosa M. Badia + + + Barcelona Supercomputing Center + +
+
+ +
+
+
+ Henri Casanova + Director of Education +
+ + Henri Casanova + + + University of Hawaii + +
+
+ +
+
+
+ Michael R. Crusoe + Director of APIs and Standards +
+ + Michael R. Crusoe + + + + +
+
+ +
+
+
+ Björn Enders + Director of Facilities Operations +
+ + Björn Enders + + + National Energy Research Scientific Computing Center + +
+
+ +
+
+
+ Carole Goble + Director of FAIR Computational Workflows +
+ + Carole Goble + + + University of Manchester + +
+
+ +
+
+
+ Lavanya Ramakrishnan + Director of Training and User Engagement +
+ + Lavanya Ramakrishnan + + + Lawrence Berkeley National Laboratory + +
+
+ +
+
+
+ Douglas Thain + Director of Distributed Computing Systems +
+ + Douglas Thain + + + University of Notre Dame + +
+
+ +
+ +
+
+
+ Our Board of Advisors +

Steering Committee

+
+
+ +
+ + +
+
+
+ Daniel S. Katz + Chair +
+ + Daniel S. Katz + + + University of Illinois at Urbana-Champaign + +
+
+ +
+
+
+ David Abramson + Member +
+ + David Abramson + + + University of Queensland, Australia + +
+
+ +
+
+
+ İlkay Altintaş + Member +
+ + İlkay Altintaş + + + University of California San Diego + +
+
+ +
+
+
+ Ewa Deelman + Member +
+ + Ewa Deelman + + + University of Southern California + +
+
+ +
+
+
+ Frank Di Natale + Member +
+ + Frank Di Natale + + + Nvidia + +
+
+ +
+
+
+ Paolo Di Tommaso + Member +
+ + Paolo Di Tommaso + + + Seqera Labs + +
+
+ +
+
+
+ Christopher Erdmann + Member +
+ + Christopher Erdmann + + + American Geophysical Union + +
+
+ +
+
+
+ Thomas Fahringer + Member +
+ + Thomas Fahringer + + + University of Innsbruck + +
+
+ +
+
+
+ Rosa Filgueira + Member +
+ + Rosa Filgueira + + + University of St Andrews + +
+
+ +
+
+
+ Andrew Gallo + Member +
+ + Andrew Gallo + + + GE Research + +
+
+ +
+
+
+ Tom Gibbs + Member +
+ + Tom Gibbs + + + Nvidia + +
+
+ +
+
+
+ Björn Grüning + Member +
+ + Björn Grüning + + + University of Freiburg + +
+
+ +
+
+
+ Shantenu Jha + Member +
+ + Shantenu Jha + + + Brookhaven National Laboratory + +
+
+ +
+
+
+ Johannes Köster + Member +
+ + Johannes Köster + + + University of Duisburg-Essen + +
+
+ +
+
+
+ Ulf Leser + Member +
+ + Ulf Leser + + + Humboldt University of Berlin + +
+
+ +
+
+
+ Marta Mattoso + Member +
+ + Marta Mattoso + + + Federal University of Rio de Janeiro + +
+
+ +
+
+
+ J. Luc Peterson + Member +
+ + J. Luc Peterson + + + Lawrence Livermore National Laboratory + +
+
+ +
+
+
+ Frédéric Suter + Member +
+ + Frédéric Suter + + + Oak Ridge National Laboratory + +
+
+ +
+
+
+ Matthew Wolf + Member +
+ + Matthew Wolf + + + Samsung Electronics + +
+
+ +
+
+
+ Justin M. Wozniak + Member +
+ + Justin M. Wozniak + + + Argonne National Laboratory + +
+
+ +
+ +
+
+
+ Our Technical Experts +

Technical Leads

+
+
+ +
+ + +
+
+
+ Stian Soiland-Reyes + Technical and Community Advisor +
+ + Stian Soiland-Reyes + + + University of Manchester + +
+
+ +
+
+
+ Sean R. Wilkinson + FAIR Computational Workflows +
+ + Sean R. Wilkinson + + + Oak Ridge National Laboratory + +
+
+ +
+ +
+ + + +
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/apple-touch-icon.png b/apple-touch-icon.png new file mode 100644 index 0000000000..46c1a7ed7e Binary files /dev/null and b/apple-touch-icon.png differ diff --git a/assets/css/animate.css b/assets/css/animate.css new file mode 100644 index 0000000000..df737888fa --- /dev/null +++ b/assets/css/animate.css @@ -0,0 +1,3377 @@ +@charset "UTF-8"; + +/*! +Animate.css - http://daneden.me/animate +Licensed under the MIT license - http://opensource.org/licenses/MIT + +Copyright (c) 2015 Daniel Eden +*/ + +.animated { + -webkit-animation-duration: 1s; + animation-duration: 1s; + -webkit-animation-fill-mode: both; + animation-fill-mode: both; +} +.animated-fast { + -webkit-animation-duration: .2s; + animation-duration: .2s; + -webkit-animation-fill-mode: both; + animation-fill-mode: both; +} +.ftco-animated { + -webkit-animation-duration: .5s; + animation-duration: .5s; + -webkit-animation-fill-mode: both; + animation-fill-mode: both; +} + +.animated.infinite { + -webkit-animation-iteration-count: infinite; + animation-iteration-count: infinite; +} + +.animated.hinge { + -webkit-animation-duration: 2s; + animation-duration: 2s; +} + +.animated.bounceIn, +.animated.bounceOut { + -webkit-animation-duration: .75s; + animation-duration: .75s; +} + +.animated.flipOutX, +.animated.flipOutY { + -webkit-animation-duration: .75s; + animation-duration: .75s; +} + +@-webkit-keyframes bounce { + from, 20%, 53%, 80%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + -webkit-transform: translate3d(0,0,0); + transform: translate3d(0,0,0); + } + + 40%, 43% { + -webkit-animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + -webkit-transform: translate3d(0, -30px, 0); + transform: translate3d(0, -30px, 0); + } + + 70% { + -webkit-animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + -webkit-transform: translate3d(0, -15px, 0); + transform: translate3d(0, -15px, 0); + } + + 90% { + -webkit-transform: translate3d(0,-4px,0); + transform: translate3d(0,-4px,0); + } +} + +@keyframes bounce { + from, 20%, 53%, 80%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + -webkit-transform: translate3d(0,0,0); + transform: translate3d(0,0,0); + } + + 40%, 43% { + -webkit-animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + -webkit-transform: translate3d(0, -30px, 0); + transform: translate3d(0, -30px, 0); + } + + 70% { + -webkit-animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + animation-timing-function: cubic-bezier(0.755, 0.050, 0.855, 0.060); + -webkit-transform: translate3d(0, -15px, 0); + transform: translate3d(0, -15px, 0); + } + + 90% { + -webkit-transform: translate3d(0,-4px,0); + transform: translate3d(0,-4px,0); + } +} + +.bounce { + -webkit-animation-name: bounce; + animation-name: bounce; + -webkit-transform-origin: center bottom; + transform-origin: center bottom; +} + +@-webkit-keyframes flash { + from, 50%, to { + opacity: 1; + } + + 25%, 75% { + opacity: 0; + } +} + +@keyframes flash { + from, 50%, to { + opacity: 1; + } + + 25%, 75% { + opacity: 0; + } +} + +.flash { + -webkit-animation-name: flash; + animation-name: flash; +} + +/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */ + +@-webkit-keyframes pulse { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 50% { + -webkit-transform: scale3d(1.05, 1.05, 1.05); + transform: scale3d(1.05, 1.05, 1.05); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +@keyframes pulse { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 50% { + -webkit-transform: scale3d(1.05, 1.05, 1.05); + transform: scale3d(1.05, 1.05, 1.05); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +.pulse { + -webkit-animation-name: pulse; + animation-name: pulse; +} + +@-webkit-keyframes rubberBand { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 30% { + -webkit-transform: scale3d(1.25, 0.75, 1); + transform: scale3d(1.25, 0.75, 1); + } + + 40% { + -webkit-transform: scale3d(0.75, 1.25, 1); + transform: scale3d(0.75, 1.25, 1); + } + + 50% { + -webkit-transform: scale3d(1.15, 0.85, 1); + transform: scale3d(1.15, 0.85, 1); + } + + 65% { + -webkit-transform: scale3d(.95, 1.05, 1); + transform: scale3d(.95, 1.05, 1); + } + + 75% { + -webkit-transform: scale3d(1.05, .95, 1); + transform: scale3d(1.05, .95, 1); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +@keyframes rubberBand { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 30% { + -webkit-transform: scale3d(1.25, 0.75, 1); + transform: scale3d(1.25, 0.75, 1); + } + + 40% { + -webkit-transform: scale3d(0.75, 1.25, 1); + transform: scale3d(0.75, 1.25, 1); + } + + 50% { + -webkit-transform: scale3d(1.15, 0.85, 1); + transform: scale3d(1.15, 0.85, 1); + } + + 65% { + -webkit-transform: scale3d(.95, 1.05, 1); + transform: scale3d(.95, 1.05, 1); + } + + 75% { + -webkit-transform: scale3d(1.05, .95, 1); + transform: scale3d(1.05, .95, 1); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +.rubberBand { + -webkit-animation-name: rubberBand; + animation-name: rubberBand; +} + +@-webkit-keyframes shake { + from, to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + 10%, 30%, 50%, 70%, 90% { + -webkit-transform: translate3d(-10px, 0, 0); + transform: translate3d(-10px, 0, 0); + } + + 20%, 40%, 60%, 80% { + -webkit-transform: translate3d(10px, 0, 0); + transform: translate3d(10px, 0, 0); + } +} + +@keyframes shake { + from, to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + 10%, 30%, 50%, 70%, 90% { + -webkit-transform: translate3d(-10px, 0, 0); + transform: translate3d(-10px, 0, 0); + } + + 20%, 40%, 60%, 80% { + -webkit-transform: translate3d(10px, 0, 0); + transform: translate3d(10px, 0, 0); + } +} + +.shake { + -webkit-animation-name: shake; + animation-name: shake; +} + +@-webkit-keyframes swing { + 20% { + -webkit-transform: rotate3d(0, 0, 1, 15deg); + transform: rotate3d(0, 0, 1, 15deg); + } + + 40% { + -webkit-transform: rotate3d(0, 0, 1, -10deg); + transform: rotate3d(0, 0, 1, -10deg); + } + + 60% { + -webkit-transform: rotate3d(0, 0, 1, 5deg); + transform: rotate3d(0, 0, 1, 5deg); + } + + 80% { + -webkit-transform: rotate3d(0, 0, 1, -5deg); + transform: rotate3d(0, 0, 1, -5deg); + } + + to { + -webkit-transform: rotate3d(0, 0, 1, 0deg); + transform: rotate3d(0, 0, 1, 0deg); + } +} + +@keyframes swing { + 20% { + -webkit-transform: rotate3d(0, 0, 1, 15deg); + transform: rotate3d(0, 0, 1, 15deg); + } + + 40% { + -webkit-transform: rotate3d(0, 0, 1, -10deg); + transform: rotate3d(0, 0, 1, -10deg); + } + + 60% { + -webkit-transform: rotate3d(0, 0, 1, 5deg); + transform: rotate3d(0, 0, 1, 5deg); + } + + 80% { + -webkit-transform: rotate3d(0, 0, 1, -5deg); + transform: rotate3d(0, 0, 1, -5deg); + } + + to { + -webkit-transform: rotate3d(0, 0, 1, 0deg); + transform: rotate3d(0, 0, 1, 0deg); + } +} + +.swing { + -webkit-transform-origin: top center; + transform-origin: top center; + -webkit-animation-name: swing; + animation-name: swing; +} + +@-webkit-keyframes tada { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 10%, 20% { + -webkit-transform: scale3d(.9, .9, .9) rotate3d(0, 0, 1, -3deg); + transform: scale3d(.9, .9, .9) rotate3d(0, 0, 1, -3deg); + } + + 30%, 50%, 70%, 90% { + -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); + transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); + } + + 40%, 60%, 80% { + -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); + transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +@keyframes tada { + from { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } + + 10%, 20% { + -webkit-transform: scale3d(.9, .9, .9) rotate3d(0, 0, 1, -3deg); + transform: scale3d(.9, .9, .9) rotate3d(0, 0, 1, -3deg); + } + + 30%, 50%, 70%, 90% { + -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); + transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); + } + + 40%, 60%, 80% { + -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); + transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); + } + + to { + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +.tada { + -webkit-animation-name: tada; + animation-name: tada; +} + +/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */ + +@-webkit-keyframes wobble { + from { + -webkit-transform: none; + transform: none; + } + + 15% { + -webkit-transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); + transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); + } + + 30% { + -webkit-transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); + transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); + } + + 45% { + -webkit-transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); + transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); + } + + 60% { + -webkit-transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); + transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); + } + + 75% { + -webkit-transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); + transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +@keyframes wobble { + from { + -webkit-transform: none; + transform: none; + } + + 15% { + -webkit-transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); + transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); + } + + 30% { + -webkit-transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); + transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); + } + + 45% { + -webkit-transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); + transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); + } + + 60% { + -webkit-transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); + transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); + } + + 75% { + -webkit-transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); + transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +.wobble { + -webkit-animation-name: wobble; + animation-name: wobble; +} + +@-webkit-keyframes jello { + from, 11.1%, to { + -webkit-transform: none; + transform: none; + } + + 22.2% { + -webkit-transform: skewX(-12.5deg) skewY(-12.5deg); + transform: skewX(-12.5deg) skewY(-12.5deg); + } + + 33.3% { + -webkit-transform: skewX(6.25deg) skewY(6.25deg); + transform: skewX(6.25deg) skewY(6.25deg); + } + + 44.4% { + -webkit-transform: skewX(-3.125deg) skewY(-3.125deg); + transform: skewX(-3.125deg) skewY(-3.125deg); + } + + 55.5% { + -webkit-transform: skewX(1.5625deg) skewY(1.5625deg); + transform: skewX(1.5625deg) skewY(1.5625deg); + } + + 66.6% { + -webkit-transform: skewX(-0.78125deg) skewY(-0.78125deg); + transform: skewX(-0.78125deg) skewY(-0.78125deg); + } + + 77.7% { + -webkit-transform: skewX(0.390625deg) skewY(0.390625deg); + transform: skewX(0.390625deg) skewY(0.390625deg); + } + + 88.8% { + -webkit-transform: skewX(-0.1953125deg) skewY(-0.1953125deg); + transform: skewX(-0.1953125deg) skewY(-0.1953125deg); + } +} + +@keyframes jello { + from, 11.1%, to { + -webkit-transform: none; + transform: none; + } + + 22.2% { + -webkit-transform: skewX(-12.5deg) skewY(-12.5deg); + transform: skewX(-12.5deg) skewY(-12.5deg); + } + + 33.3% { + -webkit-transform: skewX(6.25deg) skewY(6.25deg); + transform: skewX(6.25deg) skewY(6.25deg); + } + + 44.4% { + -webkit-transform: skewX(-3.125deg) skewY(-3.125deg); + transform: skewX(-3.125deg) skewY(-3.125deg); + } + + 55.5% { + -webkit-transform: skewX(1.5625deg) skewY(1.5625deg); + transform: skewX(1.5625deg) skewY(1.5625deg); + } + + 66.6% { + -webkit-transform: skewX(-0.78125deg) skewY(-0.78125deg); + transform: skewX(-0.78125deg) skewY(-0.78125deg); + } + + 77.7% { + -webkit-transform: skewX(0.390625deg) skewY(0.390625deg); + transform: skewX(0.390625deg) skewY(0.390625deg); + } + + 88.8% { + -webkit-transform: skewX(-0.1953125deg) skewY(-0.1953125deg); + transform: skewX(-0.1953125deg) skewY(-0.1953125deg); + } +} + +.jello { + -webkit-animation-name: jello; + animation-name: jello; + -webkit-transform-origin: center; + transform-origin: center; +} + +@-webkit-keyframes bounceIn { + from, 20%, 40%, 60%, 80%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + 20% { + -webkit-transform: scale3d(1.1, 1.1, 1.1); + transform: scale3d(1.1, 1.1, 1.1); + } + + 40% { + -webkit-transform: scale3d(.9, .9, .9); + transform: scale3d(.9, .9, .9); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(1.03, 1.03, 1.03); + transform: scale3d(1.03, 1.03, 1.03); + } + + 80% { + -webkit-transform: scale3d(.97, .97, .97); + transform: scale3d(.97, .97, .97); + } + + to { + opacity: 1; + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +@keyframes bounceIn { + from, 20%, 40%, 60%, 80%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + 20% { + -webkit-transform: scale3d(1.1, 1.1, 1.1); + transform: scale3d(1.1, 1.1, 1.1); + } + + 40% { + -webkit-transform: scale3d(.9, .9, .9); + transform: scale3d(.9, .9, .9); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(1.03, 1.03, 1.03); + transform: scale3d(1.03, 1.03, 1.03); + } + + 80% { + -webkit-transform: scale3d(.97, .97, .97); + transform: scale3d(.97, .97, .97); + } + + to { + opacity: 1; + -webkit-transform: scale3d(1, 1, 1); + transform: scale3d(1, 1, 1); + } +} + +.bounceIn { + -webkit-animation-name: bounceIn; + animation-name: bounceIn; +} + +@-webkit-keyframes bounceInDown { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: translate3d(0, -3000px, 0); + transform: translate3d(0, -3000px, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(0, 25px, 0); + transform: translate3d(0, 25px, 0); + } + + 75% { + -webkit-transform: translate3d(0, -10px, 0); + transform: translate3d(0, -10px, 0); + } + + 90% { + -webkit-transform: translate3d(0, 5px, 0); + transform: translate3d(0, 5px, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +@keyframes bounceInDown { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: translate3d(0, -3000px, 0); + transform: translate3d(0, -3000px, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(0, 25px, 0); + transform: translate3d(0, 25px, 0); + } + + 75% { + -webkit-transform: translate3d(0, -10px, 0); + transform: translate3d(0, -10px, 0); + } + + 90% { + -webkit-transform: translate3d(0, 5px, 0); + transform: translate3d(0, 5px, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +.bounceInDown { + -webkit-animation-name: bounceInDown; + animation-name: bounceInDown; +} + +@-webkit-keyframes bounceInLeft { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: translate3d(-3000px, 0, 0); + transform: translate3d(-3000px, 0, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(25px, 0, 0); + transform: translate3d(25px, 0, 0); + } + + 75% { + -webkit-transform: translate3d(-10px, 0, 0); + transform: translate3d(-10px, 0, 0); + } + + 90% { + -webkit-transform: translate3d(5px, 0, 0); + transform: translate3d(5px, 0, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +@keyframes bounceInLeft { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + 0% { + opacity: 0; + -webkit-transform: translate3d(-3000px, 0, 0); + transform: translate3d(-3000px, 0, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(25px, 0, 0); + transform: translate3d(25px, 0, 0); + } + + 75% { + -webkit-transform: translate3d(-10px, 0, 0); + transform: translate3d(-10px, 0, 0); + } + + 90% { + -webkit-transform: translate3d(5px, 0, 0); + transform: translate3d(5px, 0, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +.bounceInLeft { + -webkit-animation-name: bounceInLeft; + animation-name: bounceInLeft; +} + +@-webkit-keyframes bounceInRight { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + from { + opacity: 0; + -webkit-transform: translate3d(3000px, 0, 0); + transform: translate3d(3000px, 0, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(-25px, 0, 0); + transform: translate3d(-25px, 0, 0); + } + + 75% { + -webkit-transform: translate3d(10px, 0, 0); + transform: translate3d(10px, 0, 0); + } + + 90% { + -webkit-transform: translate3d(-5px, 0, 0); + transform: translate3d(-5px, 0, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +@keyframes bounceInRight { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + from { + opacity: 0; + -webkit-transform: translate3d(3000px, 0, 0); + transform: translate3d(3000px, 0, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(-25px, 0, 0); + transform: translate3d(-25px, 0, 0); + } + + 75% { + -webkit-transform: translate3d(10px, 0, 0); + transform: translate3d(10px, 0, 0); + } + + 90% { + -webkit-transform: translate3d(-5px, 0, 0); + transform: translate3d(-5px, 0, 0); + } + + to { + -webkit-transform: none; + transform: none; + } +} + +.bounceInRight { + -webkit-animation-name: bounceInRight; + animation-name: bounceInRight; +} + +@-webkit-keyframes bounceInUp { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + from { + opacity: 0; + -webkit-transform: translate3d(0, 3000px, 0); + transform: translate3d(0, 3000px, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(0, -20px, 0); + transform: translate3d(0, -20px, 0); + } + + 75% { + -webkit-transform: translate3d(0, 10px, 0); + transform: translate3d(0, 10px, 0); + } + + 90% { + -webkit-transform: translate3d(0, -5px, 0); + transform: translate3d(0, -5px, 0); + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +@keyframes bounceInUp { + from, 60%, 75%, 90%, to { + -webkit-animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + animation-timing-function: cubic-bezier(0.215, 0.610, 0.355, 1.000); + } + + from { + opacity: 0; + -webkit-transform: translate3d(0, 3000px, 0); + transform: translate3d(0, 3000px, 0); + } + + 60% { + opacity: 1; + -webkit-transform: translate3d(0, -20px, 0); + transform: translate3d(0, -20px, 0); + } + + 75% { + -webkit-transform: translate3d(0, 10px, 0); + transform: translate3d(0, 10px, 0); + } + + 90% { + -webkit-transform: translate3d(0, -5px, 0); + transform: translate3d(0, -5px, 0); + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +.bounceInUp { + -webkit-animation-name: bounceInUp; + animation-name: bounceInUp; +} + +@-webkit-keyframes bounceOut { + 20% { + -webkit-transform: scale3d(.9, .9, .9); + transform: scale3d(.9, .9, .9); + } + + 50%, 55% { + opacity: 1; + -webkit-transform: scale3d(1.1, 1.1, 1.1); + transform: scale3d(1.1, 1.1, 1.1); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } +} + +@keyframes bounceOut { + 20% { + -webkit-transform: scale3d(.9, .9, .9); + transform: scale3d(.9, .9, .9); + } + + 50%, 55% { + opacity: 1; + -webkit-transform: scale3d(1.1, 1.1, 1.1); + transform: scale3d(1.1, 1.1, 1.1); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } +} + +.bounceOut { + -webkit-animation-name: bounceOut; + animation-name: bounceOut; +} + +@-webkit-keyframes bounceOutDown { + 20% { + -webkit-transform: translate3d(0, 10px, 0); + transform: translate3d(0, 10px, 0); + } + + 40%, 45% { + opacity: 1; + -webkit-transform: translate3d(0, -20px, 0); + transform: translate3d(0, -20px, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } +} + +@keyframes bounceOutDown { + 20% { + -webkit-transform: translate3d(0, 10px, 0); + transform: translate3d(0, 10px, 0); + } + + 40%, 45% { + opacity: 1; + -webkit-transform: translate3d(0, -20px, 0); + transform: translate3d(0, -20px, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } +} + +.bounceOutDown { + -webkit-animation-name: bounceOutDown; + animation-name: bounceOutDown; +} + +@-webkit-keyframes bounceOutLeft { + 20% { + opacity: 1; + -webkit-transform: translate3d(20px, 0, 0); + transform: translate3d(20px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } +} + +@keyframes bounceOutLeft { + 20% { + opacity: 1; + -webkit-transform: translate3d(20px, 0, 0); + transform: translate3d(20px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } +} + +.bounceOutLeft { + -webkit-animation-name: bounceOutLeft; + animation-name: bounceOutLeft; +} + +@-webkit-keyframes bounceOutRight { + 20% { + opacity: 1; + -webkit-transform: translate3d(-20px, 0, 0); + transform: translate3d(-20px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } +} + +@keyframes bounceOutRight { + 20% { + opacity: 1; + -webkit-transform: translate3d(-20px, 0, 0); + transform: translate3d(-20px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } +} + +.bounceOutRight { + -webkit-animation-name: bounceOutRight; + animation-name: bounceOutRight; +} + +@-webkit-keyframes bounceOutUp { + 20% { + -webkit-transform: translate3d(0, -10px, 0); + transform: translate3d(0, -10px, 0); + } + + 40%, 45% { + opacity: 1; + -webkit-transform: translate3d(0, 20px, 0); + transform: translate3d(0, 20px, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } +} + +@keyframes bounceOutUp { + 20% { + -webkit-transform: translate3d(0, -10px, 0); + transform: translate3d(0, -10px, 0); + } + + 40%, 45% { + opacity: 1; + -webkit-transform: translate3d(0, 20px, 0); + transform: translate3d(0, 20px, 0); + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } +} + +.bounceOutUp { + -webkit-animation-name: bounceOutUp; + animation-name: bounceOutUp; +} + +@-webkit-keyframes fadeIn { + from { + opacity: 0; + visibility: hidden; + -ms-transform: scale(0.95); + -webkit-transform: scale(0.95); + transform: scale(0.95); + } + + to { + opacity: 1; + visibility: visible; + -ms-transform: scale(1.0); + -webkit-transform: scale(1.0); + transform: scale(1.0); + } +} + +@keyframes fadeIn { + from { + opacity: 0; + visibility: hidden; + -ms-transform: scale(0.95); + -webkit-transform: scale(0.95); + transform: scale(0.95); + } + + to { + opacity: 1; + visibility: visible; + -ms-transform: scale(1.0); + -webkit-transform: scale(1.0); + transform: scale(1.0); + } +} + +.fadeIn { + -webkit-animation-name: fadeIn; + animation-name: fadeIn; +} + +@-webkit-keyframes fadeInDown { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0);*/ + -webkit-transform: translate3d(0, -50px, 0); + transform: translate3d(0, -50px, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInDown { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0);*/ + -webkit-transform: translate3d(0, -50px, 0); + transform: translate3d(0, -50px, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +.fadeInDown { + -webkit-animation-name: fadeInDown; + animation-name: fadeInDown; +} + +@-webkit-keyframes fadeInDownBig { + from { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInDownBig { + from { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInDownBig { + -webkit-animation-name: fadeInDownBig; + animation-name: fadeInDownBig; +} + +@-webkit-keyframes fadeInLeft { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0);*/ + -webkit-transform: translate3d(-50px, 0, 0); + transform: translate3d(-50px, 0, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInLeft { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0);*/ + -webkit-transform: translate3d(-50px, 0, 0); + transform: translate3d(-50px, 0, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +.fadeInLeft { + -webkit-animation-name: fadeInLeft; + animation-name: fadeInLeft; +} + +@-webkit-keyframes fadeInLeftBig { + from { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInLeftBig { + from { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInLeftBig { + -webkit-animation-name: fadeInLeftBig; + animation-name: fadeInLeftBig; +} + +@-webkit-keyframes fadeInRight { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0);*/ + -webkit-transform: translate3d(50px, 0, 0); + transform: translate3d(50px, 0, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInRight { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0);*/ + -webkit-transform: translate3d(50px, 0, 0); + transform: translate3d(50px, 0, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +.fadeInRight { + -webkit-animation-name: fadeInRight; + animation-name: fadeInRight; +} + +@-webkit-keyframes fadeInRightBig { + from { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInRightBig { + from { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInRightBig { + -webkit-animation-name: fadeInRightBig; + animation-name: fadeInRightBig; +} + +@-webkit-keyframes fadeInUp { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0);*/ + -webkit-transform: translate3d(0, 40px, 0); + transform: translate3d(0, 40px, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInUp { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0);*/ + -webkit-transform: translate3d(0, 40px, 0); + transform: translate3d(0, 40px, 0); + } + + to { + visibility: visible; + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInUp { + -webkit-animation-name: fadeInUp; + animation-name: fadeInUp; +} + +@-webkit-keyframes fadeInUpMenu { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0);*/ + -webkit-transform: translate3d(0, 20px, 0); + transform: translate3d(0, 20px, 0); + } + + to { + opacity: 1; + visibility: visible; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInUpMenu { + from { + opacity: 0; + visibility: hidden; + /*-webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0);*/ + -webkit-transform: translate3d(0, 20px, 0); + transform: translate3d(0, 20px, 0); + } + + to { + visibility: visible; + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInUpMenu { + -webkit-animation-name: fadeInUpMenu; + animation-name: fadeInUpMenu; +} + +@-webkit-keyframes fadeInUpBig { + from { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +@keyframes fadeInUpBig { + from { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.fadeInUpBig { + -webkit-animation-name: fadeInUpBig; + animation-name: fadeInUpBig; +} + +@-webkit-keyframes fadeOut { + from { + opacity: 1; + } + + to { + opacity: 0; + } +} + +@keyframes fadeOut { + from { + opacity: 1; + } + + to { + opacity: 0; + } +} + +.fadeOut { + -webkit-animation-name: fadeOut; + animation-name: fadeOut; +} + +@-webkit-keyframes fadeOutDown { + from { + opacity: 1; + visibility: visible; + } + + to { + opacity: 0; + visibility: hidden; + -webkit-transform: translate3d(0, 40px, 0); + transform: translate3d(0, 40px, 0); + } +} + +@keyframes fadeOutDown { + from { + opacity: 1; + visibility: visible; + } + + to { + opacity: 0; + visibility: hidden; + -webkit-transform: translate3d(0, 40px, 0); + transform: translate3d(0, 40px, 0); + } +} + +.fadeOutDown { + -webkit-animation-name: fadeOutDown; + animation-name: fadeOutDown; +} + +@-webkit-keyframes fadeOutDownBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } +} + +@keyframes fadeOutDownBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, 2000px, 0); + transform: translate3d(0, 2000px, 0); + } +} + +.fadeOutDownBig { + -webkit-animation-name: fadeOutDownBig; + animation-name: fadeOutDownBig; +} + +@-webkit-keyframes fadeOutLeft { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + } +} + +@keyframes fadeOutLeft { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + } +} + +.fadeOutLeft { + -webkit-animation-name: fadeOutLeft; + animation-name: fadeOutLeft; +} + +@-webkit-keyframes fadeOutLeftBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } +} + +@keyframes fadeOutLeftBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(-2000px, 0, 0); + transform: translate3d(-2000px, 0, 0); + } +} + +.fadeOutLeftBig { + -webkit-animation-name: fadeOutLeftBig; + animation-name: fadeOutLeftBig; +} + +@-webkit-keyframes fadeOutRight { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + } +} + +@keyframes fadeOutRight { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + } +} + +.fadeOutRight { + -webkit-animation-name: fadeOutRight; + animation-name: fadeOutRight; +} + +@-webkit-keyframes fadeOutRightBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } +} + +@keyframes fadeOutRightBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(2000px, 0, 0); + transform: translate3d(2000px, 0, 0); + } +} + +.fadeOutRightBig { + -webkit-animation-name: fadeOutRightBig; + animation-name: fadeOutRightBig; +} + +@-webkit-keyframes fadeOutUp { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + } +} + +@keyframes fadeOutUp { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + } +} + +.fadeOutUp { + -webkit-animation-name: fadeOutUp; + animation-name: fadeOutUp; +} + +@-webkit-keyframes fadeOutUpBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } +} + +@keyframes fadeOutUpBig { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(0, -2000px, 0); + transform: translate3d(0, -2000px, 0); + } +} + +.fadeOutUpBig { + -webkit-animation-name: fadeOutUpBig; + animation-name: fadeOutUpBig; +} + +@-webkit-keyframes flip { + from { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -360deg); + transform: perspective(400px) rotate3d(0, 1, 0, -360deg); + -webkit-animation-timing-function: ease-out; + animation-timing-function: ease-out; + } + + 40% { + -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg); + transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg); + -webkit-animation-timing-function: ease-out; + animation-timing-function: ease-out; + } + + 50% { + -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg); + transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 80% { + -webkit-transform: perspective(400px) scale3d(.95, .95, .95); + transform: perspective(400px) scale3d(.95, .95, .95); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } +} + +@keyframes flip { + from { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -360deg); + transform: perspective(400px) rotate3d(0, 1, 0, -360deg); + -webkit-animation-timing-function: ease-out; + animation-timing-function: ease-out; + } + + 40% { + -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg); + transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg); + -webkit-animation-timing-function: ease-out; + animation-timing-function: ease-out; + } + + 50% { + -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg); + transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 80% { + -webkit-transform: perspective(400px) scale3d(.95, .95, .95); + transform: perspective(400px) scale3d(.95, .95, .95); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } +} + +.animated.flip { + -webkit-backface-visibility: visible; + backface-visibility: visible; + -webkit-animation-name: flip; + animation-name: flip; +} + +@-webkit-keyframes flipInX { + from { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + opacity: 0; + } + + 40% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 60% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 10deg); + transform: perspective(400px) rotate3d(1, 0, 0, 10deg); + opacity: 1; + } + + 80% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -5deg); + transform: perspective(400px) rotate3d(1, 0, 0, -5deg); + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } +} + +@keyframes flipInX { + from { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + opacity: 0; + } + + 40% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 60% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 10deg); + transform: perspective(400px) rotate3d(1, 0, 0, 10deg); + opacity: 1; + } + + 80% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -5deg); + transform: perspective(400px) rotate3d(1, 0, 0, -5deg); + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } +} + +.flipInX { + -webkit-backface-visibility: visible !important; + backface-visibility: visible !important; + -webkit-animation-name: flipInX; + animation-name: flipInX; +} + +@-webkit-keyframes flipInY { + from { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + opacity: 0; + } + + 40% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -20deg); + transform: perspective(400px) rotate3d(0, 1, 0, -20deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 60% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 10deg); + transform: perspective(400px) rotate3d(0, 1, 0, 10deg); + opacity: 1; + } + + 80% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -5deg); + transform: perspective(400px) rotate3d(0, 1, 0, -5deg); + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } +} + +@keyframes flipInY { + from { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + opacity: 0; + } + + 40% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -20deg); + transform: perspective(400px) rotate3d(0, 1, 0, -20deg); + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; + } + + 60% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 10deg); + transform: perspective(400px) rotate3d(0, 1, 0, 10deg); + opacity: 1; + } + + 80% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -5deg); + transform: perspective(400px) rotate3d(0, 1, 0, -5deg); + } + + to { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } +} + +.flipInY { + -webkit-backface-visibility: visible !important; + backface-visibility: visible !important; + -webkit-animation-name: flipInY; + animation-name: flipInY; +} + +@-webkit-keyframes flipOutX { + from { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } + + 30% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + opacity: 1; + } + + to { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + opacity: 0; + } +} + +@keyframes flipOutX { + from { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } + + 30% { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + transform: perspective(400px) rotate3d(1, 0, 0, -20deg); + opacity: 1; + } + + to { + -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + transform: perspective(400px) rotate3d(1, 0, 0, 90deg); + opacity: 0; + } +} + +.flipOutX { + -webkit-animation-name: flipOutX; + animation-name: flipOutX; + -webkit-backface-visibility: visible !important; + backface-visibility: visible !important; +} + +@-webkit-keyframes flipOutY { + from { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } + + 30% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -15deg); + transform: perspective(400px) rotate3d(0, 1, 0, -15deg); + opacity: 1; + } + + to { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + opacity: 0; + } +} + +@keyframes flipOutY { + from { + -webkit-transform: perspective(400px); + transform: perspective(400px); + } + + 30% { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -15deg); + transform: perspective(400px) rotate3d(0, 1, 0, -15deg); + opacity: 1; + } + + to { + -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + transform: perspective(400px) rotate3d(0, 1, 0, 90deg); + opacity: 0; + } +} + +.flipOutY { + -webkit-backface-visibility: visible !important; + backface-visibility: visible !important; + -webkit-animation-name: flipOutY; + animation-name: flipOutY; +} + +@-webkit-keyframes lightSpeedIn { + from { + -webkit-transform: translate3d(100%, 0, 0) skewX(-30deg); + transform: translate3d(100%, 0, 0) skewX(-30deg); + opacity: 0; + } + + 60% { + -webkit-transform: skewX(20deg); + transform: skewX(20deg); + opacity: 1; + } + + 80% { + -webkit-transform: skewX(-5deg); + transform: skewX(-5deg); + opacity: 1; + } + + to { + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes lightSpeedIn { + from { + -webkit-transform: translate3d(100%, 0, 0) skewX(-30deg); + transform: translate3d(100%, 0, 0) skewX(-30deg); + opacity: 0; + } + + 60% { + -webkit-transform: skewX(20deg); + transform: skewX(20deg); + opacity: 1; + } + + 80% { + -webkit-transform: skewX(-5deg); + transform: skewX(-5deg); + opacity: 1; + } + + to { + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.lightSpeedIn { + -webkit-animation-name: lightSpeedIn; + animation-name: lightSpeedIn; + -webkit-animation-timing-function: ease-out; + animation-timing-function: ease-out; +} + +@-webkit-keyframes lightSpeedOut { + from { + opacity: 1; + } + + to { + -webkit-transform: translate3d(100%, 0, 0) skewX(30deg); + transform: translate3d(100%, 0, 0) skewX(30deg); + opacity: 0; + } +} + +@keyframes lightSpeedOut { + from { + opacity: 1; + } + + to { + -webkit-transform: translate3d(100%, 0, 0) skewX(30deg); + transform: translate3d(100%, 0, 0) skewX(30deg); + opacity: 0; + } +} + +.lightSpeedOut { + -webkit-animation-name: lightSpeedOut; + animation-name: lightSpeedOut; + -webkit-animation-timing-function: ease-in; + animation-timing-function: ease-in; +} + +@-webkit-keyframes rotateIn { + from { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: rotate3d(0, 0, 1, -200deg); + transform: rotate3d(0, 0, 1, -200deg); + opacity: 0; + } + + to { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes rotateIn { + from { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: rotate3d(0, 0, 1, -200deg); + transform: rotate3d(0, 0, 1, -200deg); + opacity: 0; + } + + to { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.rotateIn { + -webkit-animation-name: rotateIn; + animation-name: rotateIn; +} + +@-webkit-keyframes rotateInDownLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes rotateInDownLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.rotateInDownLeft { + -webkit-animation-name: rotateInDownLeft; + animation-name: rotateInDownLeft; +} + +@-webkit-keyframes rotateInDownRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes rotateInDownRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.rotateInDownRight { + -webkit-animation-name: rotateInDownRight; + animation-name: rotateInDownRight; +} + +@-webkit-keyframes rotateInUpLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes rotateInUpLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.rotateInUpLeft { + -webkit-animation-name: rotateInUpLeft; + animation-name: rotateInUpLeft; +} + +@-webkit-keyframes rotateInUpRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, -90deg); + transform: rotate3d(0, 0, 1, -90deg); + opacity: 0; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +@keyframes rotateInUpRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, -90deg); + transform: rotate3d(0, 0, 1, -90deg); + opacity: 0; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: none; + transform: none; + opacity: 1; + } +} + +.rotateInUpRight { + -webkit-animation-name: rotateInUpRight; + animation-name: rotateInUpRight; +} + +@-webkit-keyframes rotateOut { + from { + -webkit-transform-origin: center; + transform-origin: center; + opacity: 1; + } + + to { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: rotate3d(0, 0, 1, 200deg); + transform: rotate3d(0, 0, 1, 200deg); + opacity: 0; + } +} + +@keyframes rotateOut { + from { + -webkit-transform-origin: center; + transform-origin: center; + opacity: 1; + } + + to { + -webkit-transform-origin: center; + transform-origin: center; + -webkit-transform: rotate3d(0, 0, 1, 200deg); + transform: rotate3d(0, 0, 1, 200deg); + opacity: 0; + } +} + +.rotateOut { + -webkit-animation-name: rotateOut; + animation-name: rotateOut; +} + +@-webkit-keyframes rotateOutDownLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } +} + +@keyframes rotateOutDownLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, 45deg); + transform: rotate3d(0, 0, 1, 45deg); + opacity: 0; + } +} + +.rotateOutDownLeft { + -webkit-animation-name: rotateOutDownLeft; + animation-name: rotateOutDownLeft; +} + +@-webkit-keyframes rotateOutDownRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } +} + +@keyframes rotateOutDownRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } +} + +.rotateOutDownRight { + -webkit-animation-name: rotateOutDownRight; + animation-name: rotateOutDownRight; +} + +@-webkit-keyframes rotateOutUpLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } +} + +@keyframes rotateOutUpLeft { + from { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: left bottom; + transform-origin: left bottom; + -webkit-transform: rotate3d(0, 0, 1, -45deg); + transform: rotate3d(0, 0, 1, -45deg); + opacity: 0; + } +} + +.rotateOutUpLeft { + -webkit-animation-name: rotateOutUpLeft; + animation-name: rotateOutUpLeft; +} + +@-webkit-keyframes rotateOutUpRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, 90deg); + transform: rotate3d(0, 0, 1, 90deg); + opacity: 0; + } +} + +@keyframes rotateOutUpRight { + from { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + opacity: 1; + } + + to { + -webkit-transform-origin: right bottom; + transform-origin: right bottom; + -webkit-transform: rotate3d(0, 0, 1, 90deg); + transform: rotate3d(0, 0, 1, 90deg); + opacity: 0; + } +} + +.rotateOutUpRight { + -webkit-animation-name: rotateOutUpRight; + animation-name: rotateOutUpRight; +} + +@-webkit-keyframes hinge { + 0% { + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + } + + 20%, 60% { + -webkit-transform: rotate3d(0, 0, 1, 80deg); + transform: rotate3d(0, 0, 1, 80deg); + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + } + + 40%, 80% { + -webkit-transform: rotate3d(0, 0, 1, 60deg); + transform: rotate3d(0, 0, 1, 60deg); + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + opacity: 1; + } + + to { + -webkit-transform: translate3d(0, 700px, 0); + transform: translate3d(0, 700px, 0); + opacity: 0; + } +} + +@keyframes hinge { + 0% { + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + } + + 20%, 60% { + -webkit-transform: rotate3d(0, 0, 1, 80deg); + transform: rotate3d(0, 0, 1, 80deg); + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + } + + 40%, 80% { + -webkit-transform: rotate3d(0, 0, 1, 60deg); + transform: rotate3d(0, 0, 1, 60deg); + -webkit-transform-origin: top left; + transform-origin: top left; + -webkit-animation-timing-function: ease-in-out; + animation-timing-function: ease-in-out; + opacity: 1; + } + + to { + -webkit-transform: translate3d(0, 700px, 0); + transform: translate3d(0, 700px, 0); + opacity: 0; + } +} + +.hinge { + -webkit-animation-name: hinge; + animation-name: hinge; +} + +/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */ + +@-webkit-keyframes rollIn { + from { + opacity: 0; + -webkit-transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); + transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +@keyframes rollIn { + from { + opacity: 0; + -webkit-transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); + transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); + } + + to { + opacity: 1; + -webkit-transform: none; + transform: none; + } +} + +.rollIn { + -webkit-animation-name: rollIn; + animation-name: rollIn; +} + +/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */ + +@-webkit-keyframes rollOut { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); + transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); + } +} + +@keyframes rollOut { + from { + opacity: 1; + } + + to { + opacity: 0; + -webkit-transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); + transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); + } +} + +.rollOut { + -webkit-animation-name: rollOut; + animation-name: rollOut; +} + +@-webkit-keyframes zoomIn { + from { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + 50% { + opacity: 1; + } +} + +@keyframes zoomIn { + from { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + 50% { + opacity: 1; + } +} + +.zoomIn { + -webkit-animation-name: zoomIn; + animation-name: zoomIn; +} + +@-webkit-keyframes zoomInDown { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, -1000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, -1000px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomInDown { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, -1000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, -1000px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomInDown { + -webkit-animation-name: zoomInDown; + animation-name: zoomInDown; +} + +@-webkit-keyframes zoomInLeft { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(-1000px, 0, 0); + transform: scale3d(.1, .1, .1) translate3d(-1000px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(10px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(10px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomInLeft { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(-1000px, 0, 0); + transform: scale3d(.1, .1, .1) translate3d(-1000px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(10px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(10px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomInLeft { + -webkit-animation-name: zoomInLeft; + animation-name: zoomInLeft; +} + +@-webkit-keyframes zoomInRight { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(1000px, 0, 0); + transform: scale3d(.1, .1, .1) translate3d(1000px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(-10px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(-10px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomInRight { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(1000px, 0, 0); + transform: scale3d(.1, .1, .1) translate3d(1000px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(-10px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(-10px, 0, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomInRight { + -webkit-animation-name: zoomInRight; + animation-name: zoomInRight; +} + +@-webkit-keyframes zoomInUp { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, 1000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, 1000px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomInUp { + from { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, 1000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, 1000px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + 60% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomInUp { + -webkit-animation-name: zoomInUp; + animation-name: zoomInUp; +} + +@-webkit-keyframes zoomOut { + from { + opacity: 1; + } + + 50% { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + to { + opacity: 0; + } +} + +@keyframes zoomOut { + from { + opacity: 1; + } + + 50% { + opacity: 0; + -webkit-transform: scale3d(.3, .3, .3); + transform: scale3d(.3, .3, .3); + } + + to { + opacity: 0; + } +} + +.zoomOut { + -webkit-animation-name: zoomOut; + animation-name: zoomOut; +} + +@-webkit-keyframes zoomOutDown { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, 2000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, 2000px, 0); + -webkit-transform-origin: center bottom; + transform-origin: center bottom; + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomOutDown { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, -60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, 2000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, 2000px, 0); + -webkit-transform-origin: center bottom; + transform-origin: center bottom; + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomOutDown { + -webkit-animation-name: zoomOutDown; + animation-name: zoomOutDown; +} + +@-webkit-keyframes zoomOutLeft { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(42px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(42px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: scale(.1) translate3d(-2000px, 0, 0); + transform: scale(.1) translate3d(-2000px, 0, 0); + -webkit-transform-origin: left center; + transform-origin: left center; + } +} + +@keyframes zoomOutLeft { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(42px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(42px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: scale(.1) translate3d(-2000px, 0, 0); + transform: scale(.1) translate3d(-2000px, 0, 0); + -webkit-transform-origin: left center; + transform-origin: left center; + } +} + +.zoomOutLeft { + -webkit-animation-name: zoomOutLeft; + animation-name: zoomOutLeft; +} + +@-webkit-keyframes zoomOutRight { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(-42px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(-42px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: scale(.1) translate3d(2000px, 0, 0); + transform: scale(.1) translate3d(2000px, 0, 0); + -webkit-transform-origin: right center; + transform-origin: right center; + } +} + +@keyframes zoomOutRight { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(-42px, 0, 0); + transform: scale3d(.475, .475, .475) translate3d(-42px, 0, 0); + } + + to { + opacity: 0; + -webkit-transform: scale(.1) translate3d(2000px, 0, 0); + transform: scale(.1) translate3d(2000px, 0, 0); + -webkit-transform-origin: right center; + transform-origin: right center; + } +} + +.zoomOutRight { + -webkit-animation-name: zoomOutRight; + animation-name: zoomOutRight; +} + +@-webkit-keyframes zoomOutUp { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, -2000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, -2000px, 0); + -webkit-transform-origin: center bottom; + transform-origin: center bottom; + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +@keyframes zoomOutUp { + 40% { + opacity: 1; + -webkit-transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + transform: scale3d(.475, .475, .475) translate3d(0, 60px, 0); + -webkit-animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + animation-timing-function: cubic-bezier(0.550, 0.055, 0.675, 0.190); + } + + to { + opacity: 0; + -webkit-transform: scale3d(.1, .1, .1) translate3d(0, -2000px, 0); + transform: scale3d(.1, .1, .1) translate3d(0, -2000px, 0); + -webkit-transform-origin: center bottom; + transform-origin: center bottom; + -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + animation-timing-function: cubic-bezier(0.175, 0.885, 0.320, 1); + } +} + +.zoomOutUp { + -webkit-animation-name: zoomOutUp; + animation-name: zoomOutUp; +} + +@-webkit-keyframes slideInDown { + from { + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +@keyframes slideInDown { + from { + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +.slideInDown { + -webkit-animation-name: slideInDown; + animation-name: slideInDown; +} + +@-webkit-keyframes slideInLeft { + from { + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +@keyframes slideInLeft { + from { + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +.slideInLeft { + -webkit-animation-name: slideInLeft; + animation-name: slideInLeft; +} + +@-webkit-keyframes slideInRight { + from { + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +@keyframes slideInRight { + from { + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +.slideInRight { + -webkit-animation-name: slideInRight; + animation-name: slideInRight; +} + +@-webkit-keyframes slideInUp { + from { + -webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +@keyframes slideInUp { + from { + -webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0); + visibility: visible; + } + + to { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } +} + +.slideInUp { + -webkit-animation-name: slideInUp; + animation-name: slideInUp; +} + +@-webkit-keyframes slideOutDown { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0); + } +} + +@keyframes slideOutDown { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(0, 100%, 0); + transform: translate3d(0, 100%, 0); + } +} + +.slideOutDown { + -webkit-animation-name: slideOutDown; + animation-name: slideOutDown; +} + +@-webkit-keyframes slideOutLeft { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + } +} + +@keyframes slideOutLeft { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); + } +} + +.slideOutLeft { + -webkit-animation-name: slideOutLeft; + animation-name: slideOutLeft; +} + +@-webkit-keyframes slideOutRight { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + } +} + +@keyframes slideOutRight { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); + } +} + +.slideOutRight { + -webkit-animation-name: slideOutRight; + animation-name: slideOutRight; +} + +@-webkit-keyframes slideOutUp { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + } +} + +@keyframes slideOutUp { + from { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); + } + + to { + visibility: hidden; + -webkit-transform: translate3d(0, -100%, 0); + transform: translate3d(0, -100%, 0); + } +} + +.slideOutUp { + -webkit-animation-name: slideOutUp; + animation-name: slideOutUp; +} \ No newline at end of file diff --git a/assets/css/aos.css b/assets/css/aos.css new file mode 100644 index 0000000000..4f62d5dc78 --- /dev/null +++ b/assets/css/aos.css @@ -0,0 +1,2 @@ +[data-aos][data-aos][data-aos-duration="50"],body[data-aos-duration="50"] [data-aos]{transition-duration:50ms}[data-aos][data-aos][data-aos-delay="50"],body[data-aos-delay="50"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="50"].aos-animate,body[data-aos-delay="50"] [data-aos].aos-animate{transition-delay:50ms}[data-aos][data-aos][data-aos-duration="100"],body[data-aos-duration="100"] [data-aos]{transition-duration:.1s}[data-aos][data-aos][data-aos-delay="100"],body[data-aos-delay="100"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="100"].aos-animate,body[data-aos-delay="100"] [data-aos].aos-animate{transition-delay:.1s}[data-aos][data-aos][data-aos-duration="150"],body[data-aos-duration="150"] [data-aos]{transition-duration:.15s}[data-aos][data-aos][data-aos-delay="150"],body[data-aos-delay="150"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="150"].aos-animate,body[data-aos-delay="150"] [data-aos].aos-animate{transition-delay:.15s}[data-aos][data-aos][data-aos-duration="200"],body[data-aos-duration="200"] [data-aos]{transition-duration:.2s}[data-aos][data-aos][data-aos-delay="200"],body[data-aos-delay="200"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="200"].aos-animate,body[data-aos-delay="200"] [data-aos].aos-animate{transition-delay:.2s}[data-aos][data-aos][data-aos-duration="250"],body[data-aos-duration="250"] [data-aos]{transition-duration:.25s}[data-aos][data-aos][data-aos-delay="250"],body[data-aos-delay="250"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="250"].aos-animate,body[data-aos-delay="250"] [data-aos].aos-animate{transition-delay:.25s}[data-aos][data-aos][data-aos-duration="300"],body[data-aos-duration="300"] [data-aos]{transition-duration:.3s}[data-aos][data-aos][data-aos-delay="300"],body[data-aos-delay="300"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="300"].aos-animate,body[data-aos-delay="300"] [data-aos].aos-animate{transition-delay:.3s}[data-aos][data-aos][data-aos-duration="350"],body[data-aos-duration="350"] [data-aos]{transition-duration:.35s}[data-aos][data-aos][data-aos-delay="350"],body[data-aos-delay="350"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="350"].aos-animate,body[data-aos-delay="350"] [data-aos].aos-animate{transition-delay:.35s}[data-aos][data-aos][data-aos-duration="400"],body[data-aos-duration="400"] [data-aos]{transition-duration:.4s}[data-aos][data-aos][data-aos-delay="400"],body[data-aos-delay="400"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="400"].aos-animate,body[data-aos-delay="400"] [data-aos].aos-animate{transition-delay:.4s}[data-aos][data-aos][data-aos-duration="450"],body[data-aos-duration="450"] [data-aos]{transition-duration:.45s}[data-aos][data-aos][data-aos-delay="450"],body[data-aos-delay="450"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="450"].aos-animate,body[data-aos-delay="450"] [data-aos].aos-animate{transition-delay:.45s}[data-aos][data-aos][data-aos-duration="500"],body[data-aos-duration="500"] [data-aos]{transition-duration:.5s}[data-aos][data-aos][data-aos-delay="500"],body[data-aos-delay="500"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="500"].aos-animate,body[data-aos-delay="500"] [data-aos].aos-animate{transition-delay:.5s}[data-aos][data-aos][data-aos-duration="550"],body[data-aos-duration="550"] [data-aos]{transition-duration:.55s}[data-aos][data-aos][data-aos-delay="550"],body[data-aos-delay="550"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="550"].aos-animate,body[data-aos-delay="550"] [data-aos].aos-animate{transition-delay:.55s}[data-aos][data-aos][data-aos-duration="600"],body[data-aos-duration="600"] [data-aos]{transition-duration:.6s}[data-aos][data-aos][data-aos-delay="600"],body[data-aos-delay="600"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="600"].aos-animate,body[data-aos-delay="600"] [data-aos].aos-animate{transition-delay:.6s}[data-aos][data-aos][data-aos-duration="650"],body[data-aos-duration="650"] [data-aos]{transition-duration:.65s}[data-aos][data-aos][data-aos-delay="650"],body[data-aos-delay="650"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="650"].aos-animate,body[data-aos-delay="650"] [data-aos].aos-animate{transition-delay:.65s}[data-aos][data-aos][data-aos-duration="700"],body[data-aos-duration="700"] [data-aos]{transition-duration:.7s}[data-aos][data-aos][data-aos-delay="700"],body[data-aos-delay="700"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="700"].aos-animate,body[data-aos-delay="700"] [data-aos].aos-animate{transition-delay:.7s}[data-aos][data-aos][data-aos-duration="750"],body[data-aos-duration="750"] [data-aos]{transition-duration:.75s}[data-aos][data-aos][data-aos-delay="750"],body[data-aos-delay="750"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="750"].aos-animate,body[data-aos-delay="750"] [data-aos].aos-animate{transition-delay:.75s}[data-aos][data-aos][data-aos-duration="800"],body[data-aos-duration="800"] [data-aos]{transition-duration:.8s}[data-aos][data-aos][data-aos-delay="800"],body[data-aos-delay="800"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="800"].aos-animate,body[data-aos-delay="800"] [data-aos].aos-animate{transition-delay:.8s}[data-aos][data-aos][data-aos-duration="850"],body[data-aos-duration="850"] [data-aos]{transition-duration:.85s}[data-aos][data-aos][data-aos-delay="850"],body[data-aos-delay="850"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="850"].aos-animate,body[data-aos-delay="850"] [data-aos].aos-animate{transition-delay:.85s}[data-aos][data-aos][data-aos-duration="900"],body[data-aos-duration="900"] [data-aos]{transition-duration:.9s}[data-aos][data-aos][data-aos-delay="900"],body[data-aos-delay="900"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="900"].aos-animate,body[data-aos-delay="900"] [data-aos].aos-animate{transition-delay:.9s}[data-aos][data-aos][data-aos-duration="950"],body[data-aos-duration="950"] [data-aos]{transition-duration:.95s}[data-aos][data-aos][data-aos-delay="950"],body[data-aos-delay="950"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="950"].aos-animate,body[data-aos-delay="950"] [data-aos].aos-animate{transition-delay:.95s}[data-aos][data-aos][data-aos-duration="1000"],body[data-aos-duration="1000"] [data-aos]{transition-duration:1s}[data-aos][data-aos][data-aos-delay="1000"],body[data-aos-delay="1000"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1000"].aos-animate,body[data-aos-delay="1000"] [data-aos].aos-animate{transition-delay:1s}[data-aos][data-aos][data-aos-duration="1050"],body[data-aos-duration="1050"] [data-aos]{transition-duration:1.05s}[data-aos][data-aos][data-aos-delay="1050"],body[data-aos-delay="1050"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1050"].aos-animate,body[data-aos-delay="1050"] [data-aos].aos-animate{transition-delay:1.05s}[data-aos][data-aos][data-aos-duration="1100"],body[data-aos-duration="1100"] [data-aos]{transition-duration:1.1s}[data-aos][data-aos][data-aos-delay="1100"],body[data-aos-delay="1100"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1100"].aos-animate,body[data-aos-delay="1100"] [data-aos].aos-animate{transition-delay:1.1s}[data-aos][data-aos][data-aos-duration="1150"],body[data-aos-duration="1150"] [data-aos]{transition-duration:1.15s}[data-aos][data-aos][data-aos-delay="1150"],body[data-aos-delay="1150"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1150"].aos-animate,body[data-aos-delay="1150"] [data-aos].aos-animate{transition-delay:1.15s}[data-aos][data-aos][data-aos-duration="1200"],body[data-aos-duration="1200"] [data-aos]{transition-duration:1.2s}[data-aos][data-aos][data-aos-delay="1200"],body[data-aos-delay="1200"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1200"].aos-animate,body[data-aos-delay="1200"] [data-aos].aos-animate{transition-delay:1.2s}[data-aos][data-aos][data-aos-duration="1250"],body[data-aos-duration="1250"] [data-aos]{transition-duration:1.25s}[data-aos][data-aos][data-aos-delay="1250"],body[data-aos-delay="1250"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1250"].aos-animate,body[data-aos-delay="1250"] [data-aos].aos-animate{transition-delay:1.25s}[data-aos][data-aos][data-aos-duration="1300"],body[data-aos-duration="1300"] [data-aos]{transition-duration:1.3s}[data-aos][data-aos][data-aos-delay="1300"],body[data-aos-delay="1300"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1300"].aos-animate,body[data-aos-delay="1300"] [data-aos].aos-animate{transition-delay:1.3s}[data-aos][data-aos][data-aos-duration="1350"],body[data-aos-duration="1350"] [data-aos]{transition-duration:1.35s}[data-aos][data-aos][data-aos-delay="1350"],body[data-aos-delay="1350"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1350"].aos-animate,body[data-aos-delay="1350"] [data-aos].aos-animate{transition-delay:1.35s}[data-aos][data-aos][data-aos-duration="1400"],body[data-aos-duration="1400"] [data-aos]{transition-duration:1.4s}[data-aos][data-aos][data-aos-delay="1400"],body[data-aos-delay="1400"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1400"].aos-animate,body[data-aos-delay="1400"] [data-aos].aos-animate{transition-delay:1.4s}[data-aos][data-aos][data-aos-duration="1450"],body[data-aos-duration="1450"] [data-aos]{transition-duration:1.45s}[data-aos][data-aos][data-aos-delay="1450"],body[data-aos-delay="1450"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1450"].aos-animate,body[data-aos-delay="1450"] [data-aos].aos-animate{transition-delay:1.45s}[data-aos][data-aos][data-aos-duration="1500"],body[data-aos-duration="1500"] [data-aos]{transition-duration:1.5s}[data-aos][data-aos][data-aos-delay="1500"],body[data-aos-delay="1500"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1500"].aos-animate,body[data-aos-delay="1500"] [data-aos].aos-animate{transition-delay:1.5s}[data-aos][data-aos][data-aos-duration="1550"],body[data-aos-duration="1550"] [data-aos]{transition-duration:1.55s}[data-aos][data-aos][data-aos-delay="1550"],body[data-aos-delay="1550"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1550"].aos-animate,body[data-aos-delay="1550"] [data-aos].aos-animate{transition-delay:1.55s}[data-aos][data-aos][data-aos-duration="1600"],body[data-aos-duration="1600"] [data-aos]{transition-duration:1.6s}[data-aos][data-aos][data-aos-delay="1600"],body[data-aos-delay="1600"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1600"].aos-animate,body[data-aos-delay="1600"] [data-aos].aos-animate{transition-delay:1.6s}[data-aos][data-aos][data-aos-duration="1650"],body[data-aos-duration="1650"] [data-aos]{transition-duration:1.65s}[data-aos][data-aos][data-aos-delay="1650"],body[data-aos-delay="1650"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1650"].aos-animate,body[data-aos-delay="1650"] [data-aos].aos-animate{transition-delay:1.65s}[data-aos][data-aos][data-aos-duration="1700"],body[data-aos-duration="1700"] [data-aos]{transition-duration:1.7s}[data-aos][data-aos][data-aos-delay="1700"],body[data-aos-delay="1700"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1700"].aos-animate,body[data-aos-delay="1700"] [data-aos].aos-animate{transition-delay:1.7s}[data-aos][data-aos][data-aos-duration="1750"],body[data-aos-duration="1750"] [data-aos]{transition-duration:1.75s}[data-aos][data-aos][data-aos-delay="1750"],body[data-aos-delay="1750"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1750"].aos-animate,body[data-aos-delay="1750"] [data-aos].aos-animate{transition-delay:1.75s}[data-aos][data-aos][data-aos-duration="1800"],body[data-aos-duration="1800"] [data-aos]{transition-duration:1.8s}[data-aos][data-aos][data-aos-delay="1800"],body[data-aos-delay="1800"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1800"].aos-animate,body[data-aos-delay="1800"] [data-aos].aos-animate{transition-delay:1.8s}[data-aos][data-aos][data-aos-duration="1850"],body[data-aos-duration="1850"] [data-aos]{transition-duration:1.85s}[data-aos][data-aos][data-aos-delay="1850"],body[data-aos-delay="1850"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1850"].aos-animate,body[data-aos-delay="1850"] [data-aos].aos-animate{transition-delay:1.85s}[data-aos][data-aos][data-aos-duration="1900"],body[data-aos-duration="1900"] [data-aos]{transition-duration:1.9s}[data-aos][data-aos][data-aos-delay="1900"],body[data-aos-delay="1900"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1900"].aos-animate,body[data-aos-delay="1900"] [data-aos].aos-animate{transition-delay:1.9s}[data-aos][data-aos][data-aos-duration="1950"],body[data-aos-duration="1950"] [data-aos]{transition-duration:1.95s}[data-aos][data-aos][data-aos-delay="1950"],body[data-aos-delay="1950"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="1950"].aos-animate,body[data-aos-delay="1950"] [data-aos].aos-animate{transition-delay:1.95s}[data-aos][data-aos][data-aos-duration="2000"],body[data-aos-duration="2000"] [data-aos]{transition-duration:2s}[data-aos][data-aos][data-aos-delay="2000"],body[data-aos-delay="2000"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2000"].aos-animate,body[data-aos-delay="2000"] [data-aos].aos-animate{transition-delay:2s}[data-aos][data-aos][data-aos-duration="2050"],body[data-aos-duration="2050"] [data-aos]{transition-duration:2.05s}[data-aos][data-aos][data-aos-delay="2050"],body[data-aos-delay="2050"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2050"].aos-animate,body[data-aos-delay="2050"] [data-aos].aos-animate{transition-delay:2.05s}[data-aos][data-aos][data-aos-duration="2100"],body[data-aos-duration="2100"] [data-aos]{transition-duration:2.1s}[data-aos][data-aos][data-aos-delay="2100"],body[data-aos-delay="2100"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2100"].aos-animate,body[data-aos-delay="2100"] [data-aos].aos-animate{transition-delay:2.1s}[data-aos][data-aos][data-aos-duration="2150"],body[data-aos-duration="2150"] [data-aos]{transition-duration:2.15s}[data-aos][data-aos][data-aos-delay="2150"],body[data-aos-delay="2150"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2150"].aos-animate,body[data-aos-delay="2150"] [data-aos].aos-animate{transition-delay:2.15s}[data-aos][data-aos][data-aos-duration="2200"],body[data-aos-duration="2200"] [data-aos]{transition-duration:2.2s}[data-aos][data-aos][data-aos-delay="2200"],body[data-aos-delay="2200"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2200"].aos-animate,body[data-aos-delay="2200"] [data-aos].aos-animate{transition-delay:2.2s}[data-aos][data-aos][data-aos-duration="2250"],body[data-aos-duration="2250"] [data-aos]{transition-duration:2.25s}[data-aos][data-aos][data-aos-delay="2250"],body[data-aos-delay="2250"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2250"].aos-animate,body[data-aos-delay="2250"] [data-aos].aos-animate{transition-delay:2.25s}[data-aos][data-aos][data-aos-duration="2300"],body[data-aos-duration="2300"] [data-aos]{transition-duration:2.3s}[data-aos][data-aos][data-aos-delay="2300"],body[data-aos-delay="2300"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2300"].aos-animate,body[data-aos-delay="2300"] [data-aos].aos-animate{transition-delay:2.3s}[data-aos][data-aos][data-aos-duration="2350"],body[data-aos-duration="2350"] [data-aos]{transition-duration:2.35s}[data-aos][data-aos][data-aos-delay="2350"],body[data-aos-delay="2350"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2350"].aos-animate,body[data-aos-delay="2350"] [data-aos].aos-animate{transition-delay:2.35s}[data-aos][data-aos][data-aos-duration="2400"],body[data-aos-duration="2400"] [data-aos]{transition-duration:2.4s}[data-aos][data-aos][data-aos-delay="2400"],body[data-aos-delay="2400"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2400"].aos-animate,body[data-aos-delay="2400"] [data-aos].aos-animate{transition-delay:2.4s}[data-aos][data-aos][data-aos-duration="2450"],body[data-aos-duration="2450"] [data-aos]{transition-duration:2.45s}[data-aos][data-aos][data-aos-delay="2450"],body[data-aos-delay="2450"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2450"].aos-animate,body[data-aos-delay="2450"] [data-aos].aos-animate{transition-delay:2.45s}[data-aos][data-aos][data-aos-duration="2500"],body[data-aos-duration="2500"] [data-aos]{transition-duration:2.5s}[data-aos][data-aos][data-aos-delay="2500"],body[data-aos-delay="2500"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2500"].aos-animate,body[data-aos-delay="2500"] [data-aos].aos-animate{transition-delay:2.5s}[data-aos][data-aos][data-aos-duration="2550"],body[data-aos-duration="2550"] [data-aos]{transition-duration:2.55s}[data-aos][data-aos][data-aos-delay="2550"],body[data-aos-delay="2550"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2550"].aos-animate,body[data-aos-delay="2550"] [data-aos].aos-animate{transition-delay:2.55s}[data-aos][data-aos][data-aos-duration="2600"],body[data-aos-duration="2600"] [data-aos]{transition-duration:2.6s}[data-aos][data-aos][data-aos-delay="2600"],body[data-aos-delay="2600"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2600"].aos-animate,body[data-aos-delay="2600"] [data-aos].aos-animate{transition-delay:2.6s}[data-aos][data-aos][data-aos-duration="2650"],body[data-aos-duration="2650"] [data-aos]{transition-duration:2.65s}[data-aos][data-aos][data-aos-delay="2650"],body[data-aos-delay="2650"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2650"].aos-animate,body[data-aos-delay="2650"] [data-aos].aos-animate{transition-delay:2.65s}[data-aos][data-aos][data-aos-duration="2700"],body[data-aos-duration="2700"] [data-aos]{transition-duration:2.7s}[data-aos][data-aos][data-aos-delay="2700"],body[data-aos-delay="2700"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2700"].aos-animate,body[data-aos-delay="2700"] [data-aos].aos-animate{transition-delay:2.7s}[data-aos][data-aos][data-aos-duration="2750"],body[data-aos-duration="2750"] [data-aos]{transition-duration:2.75s}[data-aos][data-aos][data-aos-delay="2750"],body[data-aos-delay="2750"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2750"].aos-animate,body[data-aos-delay="2750"] [data-aos].aos-animate{transition-delay:2.75s}[data-aos][data-aos][data-aos-duration="2800"],body[data-aos-duration="2800"] [data-aos]{transition-duration:2.8s}[data-aos][data-aos][data-aos-delay="2800"],body[data-aos-delay="2800"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2800"].aos-animate,body[data-aos-delay="2800"] [data-aos].aos-animate{transition-delay:2.8s}[data-aos][data-aos][data-aos-duration="2850"],body[data-aos-duration="2850"] [data-aos]{transition-duration:2.85s}[data-aos][data-aos][data-aos-delay="2850"],body[data-aos-delay="2850"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2850"].aos-animate,body[data-aos-delay="2850"] [data-aos].aos-animate{transition-delay:2.85s}[data-aos][data-aos][data-aos-duration="2900"],body[data-aos-duration="2900"] [data-aos]{transition-duration:2.9s}[data-aos][data-aos][data-aos-delay="2900"],body[data-aos-delay="2900"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2900"].aos-animate,body[data-aos-delay="2900"] [data-aos].aos-animate{transition-delay:2.9s}[data-aos][data-aos][data-aos-duration="2950"],body[data-aos-duration="2950"] [data-aos]{transition-duration:2.95s}[data-aos][data-aos][data-aos-delay="2950"],body[data-aos-delay="2950"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="2950"].aos-animate,body[data-aos-delay="2950"] [data-aos].aos-animate{transition-delay:2.95s}[data-aos][data-aos][data-aos-duration="3000"],body[data-aos-duration="3000"] [data-aos]{transition-duration:3s}[data-aos][data-aos][data-aos-delay="3000"],body[data-aos-delay="3000"] [data-aos]{transition-delay:0}[data-aos][data-aos][data-aos-delay="3000"].aos-animate,body[data-aos-delay="3000"] [data-aos].aos-animate{transition-delay:3s}[data-aos][data-aos][data-aos-easing=linear],body[data-aos-easing=linear] [data-aos]{transition-timing-function:cubic-bezier(.25,.25,.75,.75)}[data-aos][data-aos][data-aos-easing=ease],body[data-aos-easing=ease] [data-aos]{transition-timing-function:ease}[data-aos][data-aos][data-aos-easing=ease-in],body[data-aos-easing=ease-in] [data-aos]{transition-timing-function:ease-in}[data-aos][data-aos][data-aos-easing=ease-out],body[data-aos-easing=ease-out] [data-aos]{transition-timing-function:ease-out}[data-aos][data-aos][data-aos-easing=ease-in-out],body[data-aos-easing=ease-in-out] [data-aos]{transition-timing-function:ease-in-out}[data-aos][data-aos][data-aos-easing=ease-in-back],body[data-aos-easing=ease-in-back] [data-aos]{transition-timing-function:cubic-bezier(.6,-.28,.735,.045)}[data-aos][data-aos][data-aos-easing=ease-out-back],body[data-aos-easing=ease-out-back] [data-aos]{transition-timing-function:cubic-bezier(.175,.885,.32,1.275)}[data-aos][data-aos][data-aos-easing=ease-in-out-back],body[data-aos-easing=ease-in-out-back] [data-aos]{transition-timing-function:cubic-bezier(.68,-.55,.265,1.55)}[data-aos][data-aos][data-aos-easing=ease-in-sine],body[data-aos-easing=ease-in-sine] [data-aos]{transition-timing-function:cubic-bezier(.47,0,.745,.715)}[data-aos][data-aos][data-aos-easing=ease-out-sine],body[data-aos-easing=ease-out-sine] [data-aos]{transition-timing-function:cubic-bezier(.39,.575,.565,1)}[data-aos][data-aos][data-aos-easing=ease-in-out-sine],body[data-aos-easing=ease-in-out-sine] [data-aos]{transition-timing-function:cubic-bezier(.445,.05,.55,.95)}[data-aos][data-aos][data-aos-easing=ease-in-quad],body[data-aos-easing=ease-in-quad] [data-aos]{transition-timing-function:cubic-bezier(.55,.085,.68,.53)}[data-aos][data-aos][data-aos-easing=ease-out-quad],body[data-aos-easing=ease-out-quad] [data-aos]{transition-timing-function:cubic-bezier(.25,.46,.45,.94)}[data-aos][data-aos][data-aos-easing=ease-in-out-quad],body[data-aos-easing=ease-in-out-quad] [data-aos]{transition-timing-function:cubic-bezier(.455,.03,.515,.955)}[data-aos][data-aos][data-aos-easing=ease-in-cubic],body[data-aos-easing=ease-in-cubic] [data-aos]{transition-timing-function:cubic-bezier(.55,.085,.68,.53)}[data-aos][data-aos][data-aos-easing=ease-out-cubic],body[data-aos-easing=ease-out-cubic] [data-aos]{transition-timing-function:cubic-bezier(.25,.46,.45,.94)}[data-aos][data-aos][data-aos-easing=ease-in-out-cubic],body[data-aos-easing=ease-in-out-cubic] [data-aos]{transition-timing-function:cubic-bezier(.455,.03,.515,.955)}[data-aos][data-aos][data-aos-easing=ease-in-quart],body[data-aos-easing=ease-in-quart] [data-aos]{transition-timing-function:cubic-bezier(.55,.085,.68,.53)}[data-aos][data-aos][data-aos-easing=ease-out-quart],body[data-aos-easing=ease-out-quart] [data-aos]{transition-timing-function:cubic-bezier(.25,.46,.45,.94)}[data-aos][data-aos][data-aos-easing=ease-in-out-quart],body[data-aos-easing=ease-in-out-quart] [data-aos]{transition-timing-function:cubic-bezier(.455,.03,.515,.955)}[data-aos^=fade][data-aos^=fade]{opacity:0;transition-property:opacity,transform}[data-aos^=fade][data-aos^=fade].aos-animate{opacity:1;transform:translate(0)}[data-aos=fade-up]{transform:translateY(100px)}[data-aos=fade-down]{transform:translateY(-100px)}[data-aos=fade-right]{transform:translate(-100px)}[data-aos=fade-left]{transform:translate(100px)}[data-aos=fade-up-right]{transform:translate(-100px,100px)}[data-aos=fade-up-left]{transform:translate(100px,100px)}[data-aos=fade-down-right]{transform:translate(-100px,-100px)}[data-aos=fade-down-left]{transform:translate(100px,-100px)}[data-aos^=zoom][data-aos^=zoom]{opacity:0;transition-property:opacity,transform}[data-aos^=zoom][data-aos^=zoom].aos-animate{opacity:1;transform:translate(0) scale(1)}[data-aos=zoom-in]{transform:scale(.6)}[data-aos=zoom-in-up]{transform:translateY(100px) scale(.6)}[data-aos=zoom-in-down]{transform:translateY(-100px) scale(.6)}[data-aos=zoom-in-right]{transform:translate(-100px) scale(.6)}[data-aos=zoom-in-left]{transform:translate(100px) scale(.6)}[data-aos=zoom-out]{transform:scale(1.2)}[data-aos=zoom-out-up]{transform:translateY(100px) scale(1.2)}[data-aos=zoom-out-down]{transform:translateY(-100px) scale(1.2)}[data-aos=zoom-out-right]{transform:translate(-100px) scale(1.2)}[data-aos=zoom-out-left]{transform:translate(100px) scale(1.2)}[data-aos^=slide][data-aos^=slide]{transition-property:transform}[data-aos^=slide][data-aos^=slide].aos-animate{transform:translate(0)}[data-aos=slide-up]{transform:translateY(100%)}[data-aos=slide-down]{transform:translateY(-100%)}[data-aos=slide-right]{transform:translateX(-100%)}[data-aos=slide-left]{transform:translateX(100%)}[data-aos^=flip][data-aos^=flip]{backface-visibility:hidden;transition-property:transform}[data-aos=flip-left]{transform:perspective(2500px) rotateY(-100deg)}[data-aos=flip-left].aos-animate{transform:perspective(2500px) rotateY(0)}[data-aos=flip-right]{transform:perspective(2500px) rotateY(100deg)}[data-aos=flip-right].aos-animate{transform:perspective(2500px) rotateY(0)}[data-aos=flip-up]{transform:perspective(2500px) rotateX(-100deg)}[data-aos=flip-up].aos-animate{transform:perspective(2500px) rotateX(0)}[data-aos=flip-down]{transform:perspective(2500px) rotateX(100deg)}[data-aos=flip-down].aos-animate{transform:perspective(2500px) rotateX(0)} +/*# sourceMappingURL=aos.css.map*/ \ No newline at end of file diff --git a/assets/css/bootstrap-datepicker.css b/assets/css/bootstrap-datepicker.css new file mode 100644 index 0000000000..4083cc7eea --- /dev/null +++ b/assets/css/bootstrap-datepicker.css @@ -0,0 +1,512 @@ +/*! + * Datepicker for Bootstrap + * + * Copyright 2012 Stefan Petre + * Improvements by Andrew Rowls + * Licensed under the Apache License v2.0 + * http://www.apache.org/licenses/LICENSE-2.0 + * + */ +.datepicker { + padding: 4px; + -webkit-border-radius: 4px; + -moz-border-radius: 4px; + border-radius: 4px; + direction: ltr; + /*.dow { + border-top: 1px solid #ddd !important; + }*/ +} +.datepicker-inline { + width: 220px; +} +.datepicker.datepicker-rtl { + direction: rtl; +} +.datepicker.datepicker-rtl table tr td span { + float: right; +} +.datepicker-dropdown { + top: 0; + left: 0; +} +.datepicker-dropdown:before { + content: ''; + display: inline-block; + border-left: 7px solid transparent; + border-right: 7px solid transparent; + border-bottom: 7px solid #ccc; + border-top: 0; + border-bottom-color: rgba(0, 0, 0, 0.2); + position: absolute; +} +.datepicker-dropdown:after { + content: ''; + display: inline-block; + border-left: 6px solid transparent; + border-right: 6px solid transparent; + border-bottom: 6px solid #ffffff; + border-top: 0; + position: absolute; +} +.datepicker-dropdown.datepicker-orient-left:before { + left: 6px; +} +.datepicker-dropdown.datepicker-orient-left:after { + left: 7px; +} +.datepicker-dropdown.datepicker-orient-right:before { + right: 6px; +} +.datepicker-dropdown.datepicker-orient-right:after { + right: 7px; +} +.datepicker-dropdown.datepicker-orient-top:before { + top: -7px; +} +.datepicker-dropdown.datepicker-orient-top:after { + top: -6px; +} +.datepicker-dropdown.datepicker-orient-bottom:before { + bottom: -7px; + border-bottom: 0; + border-top: 7px solid #999; +} +.datepicker-dropdown.datepicker-orient-bottom:after { + bottom: -6px; + border-bottom: 0; + border-top: 6px solid #ffffff; +} +.datepicker > div { + display: none; +} +.datepicker.days div.datepicker-days { + display: block; +} +.datepicker.months div.datepicker-months { + display: block; +} +.datepicker.years div.datepicker-years { + display: block; +} +.datepicker table { + margin: 0; + -webkit-touch-callout: none; + -webkit-user-select: none; + -khtml-user-select: none; + -moz-user-select: none; + -ms-user-select: none; + user-select: none; +} +.datepicker td, +.datepicker th { + text-align: center; + width: 20px; + height: 20px; + -webkit-border-radius: 4px; + -moz-border-radius: 4px; + border-radius: 4px; + border: none; +} +.table-striped .datepicker table tr td, +.table-striped .datepicker table tr th { + background-color: transparent; +} +.datepicker table tr td.day:hover, +.datepicker table tr td.day.focused { + background: #eeeeee; + cursor: pointer; +} +.datepicker table tr td.old, +.datepicker table tr td.new { + color: #999999; +} +.datepicker table tr td.disabled, +.datepicker table tr td.disabled:hover { + background: none; + color: #999999; + cursor: default; +} +.datepicker table tr td.today, +.datepicker table tr td.today:hover, +.datepicker table tr td.today.disabled, +.datepicker table tr td.today.disabled:hover { + background-color: #fde19a; + background-image: -moz-linear-gradient(top, #fdd49a, #fdf59a); + background-image: -ms-linear-gradient(top, #fdd49a, #fdf59a); + background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#fdd49a), to(#fdf59a)); + background-image: -webkit-linear-gradient(top, #fdd49a, #fdf59a); + background-image: -o-linear-gradient(top, #fdd49a, #fdf59a); + background-image: linear-gradient(top, #fdd49a, #fdf59a); + background-repeat: repeat-x; + filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#fdd49a', endColorstr='#fdf59a', GradientType=0); + border-color: #fdf59a #fdf59a #fbed50; + border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25); + filter: progid:DXImageTransform.Microsoft.gradient(enabled=false); + color: #000; +} +.datepicker table tr td.today:hover, +.datepicker table tr td.today:hover:hover, +.datepicker table tr td.today.disabled:hover, +.datepicker table tr td.today.disabled:hover:hover, +.datepicker table tr td.today:active, +.datepicker table tr td.today:hover:active, +.datepicker table tr td.today.disabled:active, +.datepicker table tr td.today.disabled:hover:active, +.datepicker table tr td.today.active, +.datepicker table tr td.today:hover.active, +.datepicker table tr td.today.disabled.active, +.datepicker table tr td.today.disabled:hover.active, +.datepicker table tr td.today.disabled, +.datepicker table tr td.today:hover.disabled, +.datepicker table tr td.today.disabled.disabled, +.datepicker table tr td.today.disabled:hover.disabled, +.datepicker table tr td.today[disabled], +.datepicker table tr td.today:hover[disabled], +.datepicker table tr td.today.disabled[disabled], +.datepicker table tr td.today.disabled:hover[disabled] { + background-color: #fdf59a; +} +.datepicker table tr td.today:active, +.datepicker table tr td.today:hover:active, +.datepicker table tr td.today.disabled:active, +.datepicker table tr td.today.disabled:hover:active, +.datepicker table tr td.today.active, +.datepicker table tr td.today:hover.active, +.datepicker table tr td.today.disabled.active, +.datepicker table tr td.today.disabled:hover.active { + background-color: #fbf069 \9; +} +.datepicker table tr td.today:hover:hover { + color: #000; +} +.datepicker table tr td.today.active:hover { + color: #fff; +} +.datepicker table tr td.range, +.datepicker table tr td.range:hover, +.datepicker table tr td.range.disabled, +.datepicker table tr td.range.disabled:hover { + background: #eeeeee; + -webkit-border-radius: 0; + -moz-border-radius: 0; + border-radius: 0; +} +.datepicker table tr td.range.today, +.datepicker table tr td.range.today:hover, +.datepicker table tr td.range.today.disabled, +.datepicker table tr td.range.today.disabled:hover { + background-color: #f3d17a; + background-image: -moz-linear-gradient(top, #f3c17a, #f3e97a); + background-image: -ms-linear-gradient(top, #f3c17a, #f3e97a); + background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#f3c17a), to(#f3e97a)); + background-image: -webkit-linear-gradient(top, #f3c17a, #f3e97a); + background-image: -o-linear-gradient(top, #f3c17a, #f3e97a); + background-image: linear-gradient(top, #f3c17a, #f3e97a); + background-repeat: repeat-x; + filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#f3c17a', endColorstr='#f3e97a', GradientType=0); + border-color: #f3e97a #f3e97a #edde34; + border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25); + filter: progid:DXImageTransform.Microsoft.gradient(enabled=false); + -webkit-border-radius: 0; + -moz-border-radius: 0; + border-radius: 0; +} +.datepicker table tr td.range.today:hover, +.datepicker table tr td.range.today:hover:hover, +.datepicker table tr td.range.today.disabled:hover, +.datepicker table tr td.range.today.disabled:hover:hover, +.datepicker table tr td.range.today:active, +.datepicker table tr td.range.today:hover:active, +.datepicker table tr td.range.today.disabled:active, +.datepicker table tr td.range.today.disabled:hover:active, +.datepicker table tr td.range.today.active, +.datepicker table tr td.range.today:hover.active, +.datepicker table tr td.range.today.disabled.active, +.datepicker table tr td.range.today.disabled:hover.active, +.datepicker table tr td.range.today.disabled, +.datepicker table tr td.range.today:hover.disabled, +.datepicker table tr td.range.today.disabled.disabled, +.datepicker table tr td.range.today.disabled:hover.disabled, +.datepicker table tr td.range.today[disabled], +.datepicker table tr td.range.today:hover[disabled], +.datepicker table tr td.range.today.disabled[disabled], +.datepicker table tr td.range.today.disabled:hover[disabled] { + background-color: #f3e97a; +} +.datepicker table tr td.range.today:active, +.datepicker table tr td.range.today:hover:active, +.datepicker table tr td.range.today.disabled:active, +.datepicker table tr td.range.today.disabled:hover:active, +.datepicker table tr td.range.today.active, +.datepicker table tr td.range.today:hover.active, +.datepicker table tr td.range.today.disabled.active, +.datepicker table tr td.range.today.disabled:hover.active { + background-color: #efe24b \9; +} +.datepicker table tr td.selected, +.datepicker table tr td.selected:hover, +.datepicker table tr td.selected.disabled, +.datepicker table tr td.selected.disabled:hover { + background-color: #9e9e9e; + background-image: -moz-linear-gradient(top, #b3b3b3, #808080); + background-image: -ms-linear-gradient(top, #b3b3b3, #808080); + background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#b3b3b3), to(#808080)); + background-image: -webkit-linear-gradient(top, #b3b3b3, #808080); + background-image: -o-linear-gradient(top, #b3b3b3, #808080); + background-image: linear-gradient(top, #b3b3b3, #808080); + background-repeat: repeat-x; + filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#b3b3b3', endColorstr='#808080', GradientType=0); + border-color: #808080 #808080 #595959; + border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25); + filter: progid:DXImageTransform.Microsoft.gradient(enabled=false); + color: #fff; + text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25); +} +.datepicker table tr td.selected:hover, +.datepicker table tr td.selected:hover:hover, +.datepicker table tr td.selected.disabled:hover, +.datepicker table tr td.selected.disabled:hover:hover, +.datepicker table tr td.selected:active, +.datepicker table tr td.selected:hover:active, +.datepicker table tr td.selected.disabled:active, +.datepicker table tr td.selected.disabled:hover:active, +.datepicker table tr td.selected.active, +.datepicker table tr td.selected:hover.active, +.datepicker table tr td.selected.disabled.active, +.datepicker table tr td.selected.disabled:hover.active, +.datepicker table tr td.selected.disabled, +.datepicker table tr td.selected:hover.disabled, +.datepicker table tr td.selected.disabled.disabled, +.datepicker table tr td.selected.disabled:hover.disabled, +.datepicker table tr td.selected[disabled], +.datepicker table tr td.selected:hover[disabled], +.datepicker table tr td.selected.disabled[disabled], +.datepicker table tr td.selected.disabled:hover[disabled] { + background-color: #808080; +} +.datepicker table tr td.selected:active, +.datepicker table tr td.selected:hover:active, +.datepicker table tr td.selected.disabled:active, +.datepicker table tr td.selected.disabled:hover:active, +.datepicker table tr td.selected.active, +.datepicker table tr td.selected:hover.active, +.datepicker table tr td.selected.disabled.active, +.datepicker table tr td.selected.disabled:hover.active { + background-color: #666666 \9; +} +.datepicker table tr td.active, +.datepicker table tr td.active:hover, +.datepicker table tr td.active.disabled, +.datepicker table tr td.active.disabled:hover { + background-color: #006dcc; + background-image: -moz-linear-gradient(top, #0088cc, #0044cc); + background-image: -ms-linear-gradient(top, #0088cc, #0044cc); + background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#0088cc), to(#0044cc)); + background-image: -webkit-linear-gradient(top, #0088cc, #0044cc); + background-image: -o-linear-gradient(top, #0088cc, #0044cc); + background-image: linear-gradient(top, #0088cc, #0044cc); + background-repeat: repeat-x; + filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#0088cc', endColorstr='#0044cc', GradientType=0); + border-color: #0044cc #0044cc #002a80; + border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25); + filter: progid:DXImageTransform.Microsoft.gradient(enabled=false); + color: #fff; + text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25); +} +.datepicker table tr td.active:hover, +.datepicker table tr td.active:hover:hover, +.datepicker table tr td.active.disabled:hover, +.datepicker table tr td.active.disabled:hover:hover, +.datepicker table tr td.active:active, +.datepicker table tr td.active:hover:active, +.datepicker table tr td.active.disabled:active, +.datepicker table tr td.active.disabled:hover:active, +.datepicker table tr td.active.active, +.datepicker table tr td.active:hover.active, +.datepicker table tr td.active.disabled.active, +.datepicker table tr td.active.disabled:hover.active, +.datepicker table tr td.active.disabled, +.datepicker table tr td.active:hover.disabled, +.datepicker table tr td.active.disabled.disabled, +.datepicker table tr td.active.disabled:hover.disabled, +.datepicker table tr td.active[disabled], +.datepicker table tr td.active:hover[disabled], +.datepicker table tr td.active.disabled[disabled], +.datepicker table tr td.active.disabled:hover[disabled] { + background-color: #0044cc; +} +.datepicker table tr td.active:active, +.datepicker table tr td.active:hover:active, +.datepicker table tr td.active.disabled:active, +.datepicker table tr td.active.disabled:hover:active, +.datepicker table tr td.active.active, +.datepicker table tr td.active:hover.active, +.datepicker table tr td.active.disabled.active, +.datepicker table tr td.active.disabled:hover.active { + background-color: #003399 \9; +} +.datepicker table tr td span { + display: block; + width: 23%; + height: 54px; + line-height: 54px; + float: left; + margin: 1%; + cursor: pointer; + -webkit-border-radius: 4px; + -moz-border-radius: 4px; + border-radius: 4px; +} +.datepicker table tr td span:hover { + background: #eeeeee; +} +.datepicker table tr td span.disabled, +.datepicker table tr td span.disabled:hover { + background: none; + color: #999999; + cursor: default; +} +.datepicker table tr td span.active, +.datepicker table tr td span.active:hover, +.datepicker table tr td span.active.disabled, +.datepicker table tr td span.active.disabled:hover { + background-color: #006dcc; + background-image: -moz-linear-gradient(top, #0088cc, #0044cc); + background-image: -ms-linear-gradient(top, #0088cc, #0044cc); + background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#0088cc), to(#0044cc)); + background-image: -webkit-linear-gradient(top, #0088cc, #0044cc); + background-image: -o-linear-gradient(top, #0088cc, #0044cc); + background-image: linear-gradient(top, #0088cc, #0044cc); + background-repeat: repeat-x; + filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#0088cc', endColorstr='#0044cc', GradientType=0); + border-color: #0044cc #0044cc #002a80; + border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25); + filter: progid:DXImageTransform.Microsoft.gradient(enabled=false); + color: #fff; + text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25); +} +.datepicker table tr td span.active:hover, +.datepicker table tr td span.active:hover:hover, +.datepicker table tr td span.active.disabled:hover, +.datepicker table tr td span.active.disabled:hover:hover, +.datepicker table tr td span.active:active, +.datepicker table tr td span.active:hover:active, +.datepicker table tr td span.active.disabled:active, +.datepicker table tr td span.active.disabled:hover:active, +.datepicker table tr td span.active.active, +.datepicker table tr td span.active:hover.active, +.datepicker table tr td span.active.disabled.active, +.datepicker table tr td span.active.disabled:hover.active, +.datepicker table tr td span.active.disabled, +.datepicker table tr td span.active:hover.disabled, +.datepicker table tr td span.active.disabled.disabled, +.datepicker table tr td span.active.disabled:hover.disabled, +.datepicker table tr td span.active[disabled], +.datepicker table tr td span.active:hover[disabled], +.datepicker table tr td span.active.disabled[disabled], +.datepicker table tr td span.active.disabled:hover[disabled] { + background-color: #0044cc; +} +.datepicker table tr td span.active:active, +.datepicker table tr td span.active:hover:active, +.datepicker table tr td span.active.disabled:active, +.datepicker table tr td span.active.disabled:hover:active, +.datepicker table tr td span.active.active, +.datepicker table tr td span.active:hover.active, +.datepicker table tr td span.active.disabled.active, +.datepicker table tr td span.active.disabled:hover.active { + background-color: #003399 \9; +} +.datepicker table tr td span.old, +.datepicker table tr td span.new { + color: #999999; +} +.datepicker th.datepicker-switch { + width: 145px; +} +.datepicker thead tr:first-child th, +.datepicker tfoot tr th { + cursor: pointer; +} +.datepicker thead tr:first-child th:hover, +.datepicker tfoot tr th:hover { + background: #eeeeee; +} +.datepicker .cw { + font-size: 10px; + width: 12px; + padding: 0 2px 0 5px; + vertical-align: middle; +} +.datepicker thead tr:first-child th.cw { + cursor: default; + background-color: transparent; +} +.input-append.date .add-on i, +.input-prepend.date .add-on i { + cursor: pointer; + width: 16px; + height: 16px; +} +.input-daterange input { + text-align: center; +} +.input-daterange input:first-child { + -webkit-border-radius: 3px 0 0 3px; + -moz-border-radius: 3px 0 0 3px; + border-radius: 3px 0 0 3px; +} +.input-daterange input:last-child { + -webkit-border-radius: 0 3px 3px 0; + -moz-border-radius: 0 3px 3px 0; + border-radius: 0 3px 3px 0; +} +.input-daterange .add-on { + display: inline-block; + width: auto; + min-width: 16px; + height: 20px; + padding: 4px 5px; + font-weight: normal; + line-height: 20px; + text-align: center; + text-shadow: 0 1px 0 #ffffff; + vertical-align: middle; + background-color: #eeeeee; + border: 1px solid #ccc; + margin-left: -5px; + margin-right: -5px; +} +.datepicker.dropdown-menu { + position: absolute; + top: 100%; + left: 0; + z-index: 1000; + float: left; + display: none; + min-width: 160px; + list-style: none; + background-color: #ffffff; + border: 1px solid #ccc; + border: 1px solid rgba(0, 0, 0, 0.2); + -webkit-border-radius: 5px; + -moz-border-radius: 5px; + border-radius: 5px; + -webkit-box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2); + -moz-box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2); + box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2); + -webkit-background-clip: padding-box; + -moz-background-clip: padding; + background-clip: padding-box; + *border-right-width: 2px; + *border-bottom-width: 2px; + color: #333333; + font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; + font-size: 13px; + line-height: 20px; +} +.datepicker.dropdown-menu th, +.datepicker.dropdown-menu td { + padding: 4px 5px; +} \ No newline at end of file diff --git a/assets/css/bootstrap.min.css b/assets/css/bootstrap.min.css new file mode 100644 index 0000000000..ef399d21ce --- /dev/null +++ b/assets/css/bootstrap.min.css @@ -0,0 +1,7 @@ +/*! + * Bootstrap v4.6.0 (https://getbootstrap.com/) + * Copyright 2011-2021 The Bootstrap Authors + * Copyright 2011-2021 Twitter, Inc. + * Licensed under MIT (https://github.com/twbs/bootstrap/blob/main/LICENSE) + */:root{--blue:#007bff;--indigo:#6610f2;--purple:#6f42c1;--pink:#e83e8c;--red:#dc3545;--orange:#fd7e14;--yellow:#ffc107;--green:#28a745;--teal:#20c997;--cyan:#17a2b8;--white:#fff;--gray:#6c757d;--gray-dark:#343a40;--primary:#007bff;--secondary:#6c757d;--success:#28a745;--info:#17a2b8;--warning:#ffc107;--danger:#dc3545;--light:#f8f9fa;--dark:#343a40;--breakpoint-xs:0;--breakpoint-sm:576px;--breakpoint-md:768px;--breakpoint-lg:992px;--breakpoint-xl:1200px;--font-family-sans-serif:-apple-system,BlinkMacSystemFont,"Segoe UI",Roboto,"Helvetica Neue",Arial,"Noto Sans","Liberation Sans",sans-serif,"Apple Color Emoji","Segoe UI Emoji","Segoe UI Symbol","Noto Color Emoji";--font-family-monospace:SFMono-Regular,Menlo,Monaco,Consolas,"Liberation Mono","Courier New",monospace}*,::after,::before{box-sizing:border-box}html{font-family:sans-serif;line-height:1.15;-webkit-text-size-adjust:100%;-webkit-tap-highlight-color:transparent}article,aside,figcaption,figure,footer,header,hgroup,main,nav,section{display:block}body{margin:0;font-family:-apple-system,BlinkMacSystemFont,"Segoe UI",Roboto,"Helvetica Neue",Arial,"Noto Sans","Liberation Sans",sans-serif,"Apple Color Emoji","Segoe UI Emoji","Segoe UI Symbol","Noto Color Emoji";font-size:1rem;font-weight:400;line-height:1.5;color:#212529;text-align:left;background-color:#fff}[tabindex="-1"]:focus:not(:focus-visible){outline:0!important}hr{box-sizing:content-box;height:0;overflow:visible}h1,h2,h3,h4,h5,h6{margin-top:0;margin-bottom:.5rem}p{margin-top:0;margin-bottom:1rem}abbr[data-original-title],abbr[title]{text-decoration:underline;-webkit-text-decoration:underline dotted;text-decoration:underline dotted;cursor:help;border-bottom:0;-webkit-text-decoration-skip-ink:none;text-decoration-skip-ink:none}address{margin-bottom:1rem;font-style:normal;line-height:inherit}dl,ol,ul{margin-top:0;margin-bottom:1rem}ol ol,ol ul,ul ol,ul ul{margin-bottom:0}dt{font-weight:700}dd{margin-bottom:.5rem;margin-left:0}blockquote{margin:0 0 1rem}b,strong{font-weight:bolder}small{font-size:80%}sub,sup{position:relative;font-size:75%;line-height:0;vertical-align:baseline}sub{bottom:-.25em}sup{top:-.5em}a{color:#007bff;text-decoration:none;background-color:transparent}a:hover{color:#0056b3;text-decoration:underline}a:not([href]):not([class]){color:inherit;text-decoration:none}a:not([href]):not([class]):hover{color:inherit;text-decoration:none}code,kbd,pre,samp{font-family:SFMono-Regular,Menlo,Monaco,Consolas,"Liberation Mono","Courier New",monospace;font-size:1em}pre{margin-top:0;margin-bottom:1rem;overflow:auto;-ms-overflow-style:scrollbar}figure{margin:0 0 1rem}img{vertical-align:middle;border-style:none}svg{overflow:hidden;vertical-align:middle}table{border-collapse:collapse}caption{padding-top:.75rem;padding-bottom:.75rem;color:#6c757d;text-align:left;caption-side:bottom}th{text-align:inherit;text-align:-webkit-match-parent}label{display:inline-block;margin-bottom:.5rem}button{border-radius:0}button:focus:not(:focus-visible){outline:0}button,input,optgroup,select,textarea{margin:0;font-family:inherit;font-size:inherit;line-height:inherit}button,input{overflow:visible}button,select{text-transform:none}[role=button]{cursor:pointer}select{word-wrap:normal}[type=button],[type=reset],[type=submit],button{-webkit-appearance:button}[type=button]:not(:disabled),[type=reset]:not(:disabled),[type=submit]:not(:disabled),button:not(:disabled){cursor:pointer}[type=button]::-moz-focus-inner,[type=reset]::-moz-focus-inner,[type=submit]::-moz-focus-inner,button::-moz-focus-inner{padding:0;border-style:none}input[type=checkbox],input[type=radio]{box-sizing:border-box;padding:0}textarea{overflow:auto;resize:vertical}fieldset{min-width:0;padding:0;margin:0;border:0}legend{display:block;width:100%;max-width:100%;padding:0;margin-bottom:.5rem;font-size:1.5rem;line-height:inherit;color:inherit;white-space:normal}progress{vertical-align:baseline}[type=number]::-webkit-inner-spin-button,[type=number]::-webkit-outer-spin-button{height:auto}[type=search]{outline-offset:-2px;-webkit-appearance:none}[type=search]::-webkit-search-decoration{-webkit-appearance:none}::-webkit-file-upload-button{font:inherit;-webkit-appearance:button}output{display:inline-block}summary{display:list-item;cursor:pointer}template{display:none}[hidden]{display:none!important}.h1,.h2,.h3,.h4,.h5,.h6,h1,h2,h3,h4,h5,h6{margin-bottom:.5rem;font-weight:500;line-height:1.2}.h1,h1{font-size:2.5rem}.h2,h2{font-size:2rem}.h3,h3{font-size:1.75rem}.h4,h4{font-size:1.5rem}.h5,h5{font-size:1.25rem}.h6,h6{font-size:1rem}.lead{font-size:1.25rem;font-weight:300}.display-1{font-size:6rem;font-weight:300;line-height:1.2}.display-2{font-size:5.5rem;font-weight:300;line-height:1.2}.display-3{font-size:4.5rem;font-weight:300;line-height:1.2}.display-4{font-size:3.5rem;font-weight:300;line-height:1.2}hr{margin-top:1rem;margin-bottom:1rem;border:0;border-top:1px solid rgba(0,0,0,.1)}.small,small{font-size:80%;font-weight:400}.mark,mark{padding:.2em;background-color:#fcf8e3}.list-unstyled{padding-left:0;list-style:none}.list-inline{padding-left:0;list-style:none}.list-inline-item{display:inline-block}.list-inline-item:not(:last-child){margin-right:.5rem}.initialism{font-size:90%;text-transform:uppercase}.blockquote{margin-bottom:1rem;font-size:1.25rem}.blockquote-footer{display:block;font-size:80%;color:#6c757d}.blockquote-footer::before{content:"\2014\00A0"}.img-fluid{max-width:100%;height:auto}.img-thumbnail{padding:.25rem;background-color:#fff;border:1px solid #dee2e6;border-radius:.25rem;max-width:100%;height:auto}.figure{display:inline-block}.figure-img{margin-bottom:.5rem;line-height:1}.figure-caption{font-size:90%;color:#6c757d}code{font-size:87.5%;color:#e83e8c;word-wrap:break-word}a>code{color:inherit}kbd{padding:.2rem .4rem;font-size:87.5%;color:#fff;background-color:#212529;border-radius:.2rem}kbd kbd{padding:0;font-size:100%;font-weight:700}pre{display:block;font-size:87.5%;color:#212529}pre code{font-size:inherit;color:inherit;word-break:normal}.pre-scrollable{max-height:340px;overflow-y:scroll}.container,.container-fluid,.container-lg,.container-md,.container-sm,.container-xl{width:100%;padding-right:15px;padding-left:15px;margin-right:auto;margin-left:auto}@media (min-width:576px){.container,.container-sm{max-width:540px}}@media (min-width:768px){.container,.container-md,.container-sm{max-width:720px}}@media (min-width:992px){.container,.container-lg,.container-md,.container-sm{max-width:960px}}@media (min-width:1200px){.container,.container-lg,.container-md,.container-sm,.container-xl{max-width:1140px}}.row{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;margin-right:-15px;margin-left:-15px}.no-gutters{margin-right:0;margin-left:0}.no-gutters>.col,.no-gutters>[class*=col-]{padding-right:0;padding-left:0}.col,.col-1,.col-10,.col-11,.col-12,.col-2,.col-3,.col-4,.col-5,.col-6,.col-7,.col-8,.col-9,.col-auto,.col-lg,.col-lg-1,.col-lg-10,.col-lg-11,.col-lg-12,.col-lg-2,.col-lg-3,.col-lg-4,.col-lg-5,.col-lg-6,.col-lg-7,.col-lg-8,.col-lg-9,.col-lg-auto,.col-md,.col-md-1,.col-md-10,.col-md-11,.col-md-12,.col-md-2,.col-md-3,.col-md-4,.col-md-5,.col-md-6,.col-md-7,.col-md-8,.col-md-9,.col-md-auto,.col-sm,.col-sm-1,.col-sm-10,.col-sm-11,.col-sm-12,.col-sm-2,.col-sm-3,.col-sm-4,.col-sm-5,.col-sm-6,.col-sm-7,.col-sm-8,.col-sm-9,.col-sm-auto,.col-xl,.col-xl-1,.col-xl-10,.col-xl-11,.col-xl-12,.col-xl-2,.col-xl-3,.col-xl-4,.col-xl-5,.col-xl-6,.col-xl-7,.col-xl-8,.col-xl-9,.col-xl-auto{position:relative;width:100%;padding-right:15px;padding-left:15px}.col{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;max-width:100%}.row-cols-1>*{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.row-cols-2>*{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.row-cols-3>*{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.row-cols-4>*{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.row-cols-5>*{-ms-flex:0 0 20%;flex:0 0 20%;max-width:20%}.row-cols-6>*{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-auto{-ms-flex:0 0 auto;flex:0 0 auto;width:auto;max-width:100%}.col-1{-ms-flex:0 0 8.333333%;flex:0 0 8.333333%;max-width:8.333333%}.col-2{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-3{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.col-4{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.col-5{-ms-flex:0 0 41.666667%;flex:0 0 41.666667%;max-width:41.666667%}.col-6{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.col-7{-ms-flex:0 0 58.333333%;flex:0 0 58.333333%;max-width:58.333333%}.col-8{-ms-flex:0 0 66.666667%;flex:0 0 66.666667%;max-width:66.666667%}.col-9{-ms-flex:0 0 75%;flex:0 0 75%;max-width:75%}.col-10{-ms-flex:0 0 83.333333%;flex:0 0 83.333333%;max-width:83.333333%}.col-11{-ms-flex:0 0 91.666667%;flex:0 0 91.666667%;max-width:91.666667%}.col-12{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.order-first{-ms-flex-order:-1;order:-1}.order-last{-ms-flex-order:13;order:13}.order-0{-ms-flex-order:0;order:0}.order-1{-ms-flex-order:1;order:1}.order-2{-ms-flex-order:2;order:2}.order-3{-ms-flex-order:3;order:3}.order-4{-ms-flex-order:4;order:4}.order-5{-ms-flex-order:5;order:5}.order-6{-ms-flex-order:6;order:6}.order-7{-ms-flex-order:7;order:7}.order-8{-ms-flex-order:8;order:8}.order-9{-ms-flex-order:9;order:9}.order-10{-ms-flex-order:10;order:10}.order-11{-ms-flex-order:11;order:11}.order-12{-ms-flex-order:12;order:12}.offset-1{margin-left:8.333333%}.offset-2{margin-left:16.666667%}.offset-3{margin-left:25%}.offset-4{margin-left:33.333333%}.offset-5{margin-left:41.666667%}.offset-6{margin-left:50%}.offset-7{margin-left:58.333333%}.offset-8{margin-left:66.666667%}.offset-9{margin-left:75%}.offset-10{margin-left:83.333333%}.offset-11{margin-left:91.666667%}@media (min-width:576px){.col-sm{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;max-width:100%}.row-cols-sm-1>*{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.row-cols-sm-2>*{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.row-cols-sm-3>*{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.row-cols-sm-4>*{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.row-cols-sm-5>*{-ms-flex:0 0 20%;flex:0 0 20%;max-width:20%}.row-cols-sm-6>*{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-sm-auto{-ms-flex:0 0 auto;flex:0 0 auto;width:auto;max-width:100%}.col-sm-1{-ms-flex:0 0 8.333333%;flex:0 0 8.333333%;max-width:8.333333%}.col-sm-2{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-sm-3{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.col-sm-4{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.col-sm-5{-ms-flex:0 0 41.666667%;flex:0 0 41.666667%;max-width:41.666667%}.col-sm-6{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.col-sm-7{-ms-flex:0 0 58.333333%;flex:0 0 58.333333%;max-width:58.333333%}.col-sm-8{-ms-flex:0 0 66.666667%;flex:0 0 66.666667%;max-width:66.666667%}.col-sm-9{-ms-flex:0 0 75%;flex:0 0 75%;max-width:75%}.col-sm-10{-ms-flex:0 0 83.333333%;flex:0 0 83.333333%;max-width:83.333333%}.col-sm-11{-ms-flex:0 0 91.666667%;flex:0 0 91.666667%;max-width:91.666667%}.col-sm-12{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.order-sm-first{-ms-flex-order:-1;order:-1}.order-sm-last{-ms-flex-order:13;order:13}.order-sm-0{-ms-flex-order:0;order:0}.order-sm-1{-ms-flex-order:1;order:1}.order-sm-2{-ms-flex-order:2;order:2}.order-sm-3{-ms-flex-order:3;order:3}.order-sm-4{-ms-flex-order:4;order:4}.order-sm-5{-ms-flex-order:5;order:5}.order-sm-6{-ms-flex-order:6;order:6}.order-sm-7{-ms-flex-order:7;order:7}.order-sm-8{-ms-flex-order:8;order:8}.order-sm-9{-ms-flex-order:9;order:9}.order-sm-10{-ms-flex-order:10;order:10}.order-sm-11{-ms-flex-order:11;order:11}.order-sm-12{-ms-flex-order:12;order:12}.offset-sm-0{margin-left:0}.offset-sm-1{margin-left:8.333333%}.offset-sm-2{margin-left:16.666667%}.offset-sm-3{margin-left:25%}.offset-sm-4{margin-left:33.333333%}.offset-sm-5{margin-left:41.666667%}.offset-sm-6{margin-left:50%}.offset-sm-7{margin-left:58.333333%}.offset-sm-8{margin-left:66.666667%}.offset-sm-9{margin-left:75%}.offset-sm-10{margin-left:83.333333%}.offset-sm-11{margin-left:91.666667%}}@media (min-width:768px){.col-md{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;max-width:100%}.row-cols-md-1>*{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.row-cols-md-2>*{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.row-cols-md-3>*{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.row-cols-md-4>*{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.row-cols-md-5>*{-ms-flex:0 0 20%;flex:0 0 20%;max-width:20%}.row-cols-md-6>*{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-md-auto{-ms-flex:0 0 auto;flex:0 0 auto;width:auto;max-width:100%}.col-md-1{-ms-flex:0 0 8.333333%;flex:0 0 8.333333%;max-width:8.333333%}.col-md-2{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-md-3{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.col-md-4{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.col-md-5{-ms-flex:0 0 41.666667%;flex:0 0 41.666667%;max-width:41.666667%}.col-md-6{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.col-md-7{-ms-flex:0 0 58.333333%;flex:0 0 58.333333%;max-width:58.333333%}.col-md-8{-ms-flex:0 0 66.666667%;flex:0 0 66.666667%;max-width:66.666667%}.col-md-9{-ms-flex:0 0 75%;flex:0 0 75%;max-width:75%}.col-md-10{-ms-flex:0 0 83.333333%;flex:0 0 83.333333%;max-width:83.333333%}.col-md-11{-ms-flex:0 0 91.666667%;flex:0 0 91.666667%;max-width:91.666667%}.col-md-12{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.order-md-first{-ms-flex-order:-1;order:-1}.order-md-last{-ms-flex-order:13;order:13}.order-md-0{-ms-flex-order:0;order:0}.order-md-1{-ms-flex-order:1;order:1}.order-md-2{-ms-flex-order:2;order:2}.order-md-3{-ms-flex-order:3;order:3}.order-md-4{-ms-flex-order:4;order:4}.order-md-5{-ms-flex-order:5;order:5}.order-md-6{-ms-flex-order:6;order:6}.order-md-7{-ms-flex-order:7;order:7}.order-md-8{-ms-flex-order:8;order:8}.order-md-9{-ms-flex-order:9;order:9}.order-md-10{-ms-flex-order:10;order:10}.order-md-11{-ms-flex-order:11;order:11}.order-md-12{-ms-flex-order:12;order:12}.offset-md-0{margin-left:0}.offset-md-1{margin-left:8.333333%}.offset-md-2{margin-left:16.666667%}.offset-md-3{margin-left:25%}.offset-md-4{margin-left:33.333333%}.offset-md-5{margin-left:41.666667%}.offset-md-6{margin-left:50%}.offset-md-7{margin-left:58.333333%}.offset-md-8{margin-left:66.666667%}.offset-md-9{margin-left:75%}.offset-md-10{margin-left:83.333333%}.offset-md-11{margin-left:91.666667%}}@media (min-width:992px){.col-lg{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;max-width:100%}.row-cols-lg-1>*{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.row-cols-lg-2>*{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.row-cols-lg-3>*{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.row-cols-lg-4>*{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.row-cols-lg-5>*{-ms-flex:0 0 20%;flex:0 0 20%;max-width:20%}.row-cols-lg-6>*{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-lg-auto{-ms-flex:0 0 auto;flex:0 0 auto;width:auto;max-width:100%}.col-lg-1{-ms-flex:0 0 8.333333%;flex:0 0 8.333333%;max-width:8.333333%}.col-lg-2{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-lg-3{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.col-lg-4{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.col-lg-5{-ms-flex:0 0 41.666667%;flex:0 0 41.666667%;max-width:41.666667%}.col-lg-6{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.col-lg-7{-ms-flex:0 0 58.333333%;flex:0 0 58.333333%;max-width:58.333333%}.col-lg-8{-ms-flex:0 0 66.666667%;flex:0 0 66.666667%;max-width:66.666667%}.col-lg-9{-ms-flex:0 0 75%;flex:0 0 75%;max-width:75%}.col-lg-10{-ms-flex:0 0 83.333333%;flex:0 0 83.333333%;max-width:83.333333%}.col-lg-11{-ms-flex:0 0 91.666667%;flex:0 0 91.666667%;max-width:91.666667%}.col-lg-12{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.order-lg-first{-ms-flex-order:-1;order:-1}.order-lg-last{-ms-flex-order:13;order:13}.order-lg-0{-ms-flex-order:0;order:0}.order-lg-1{-ms-flex-order:1;order:1}.order-lg-2{-ms-flex-order:2;order:2}.order-lg-3{-ms-flex-order:3;order:3}.order-lg-4{-ms-flex-order:4;order:4}.order-lg-5{-ms-flex-order:5;order:5}.order-lg-6{-ms-flex-order:6;order:6}.order-lg-7{-ms-flex-order:7;order:7}.order-lg-8{-ms-flex-order:8;order:8}.order-lg-9{-ms-flex-order:9;order:9}.order-lg-10{-ms-flex-order:10;order:10}.order-lg-11{-ms-flex-order:11;order:11}.order-lg-12{-ms-flex-order:12;order:12}.offset-lg-0{margin-left:0}.offset-lg-1{margin-left:8.333333%}.offset-lg-2{margin-left:16.666667%}.offset-lg-3{margin-left:25%}.offset-lg-4{margin-left:33.333333%}.offset-lg-5{margin-left:41.666667%}.offset-lg-6{margin-left:50%}.offset-lg-7{margin-left:58.333333%}.offset-lg-8{margin-left:66.666667%}.offset-lg-9{margin-left:75%}.offset-lg-10{margin-left:83.333333%}.offset-lg-11{margin-left:91.666667%}}@media (min-width:1200px){.col-xl{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;max-width:100%}.row-cols-xl-1>*{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.row-cols-xl-2>*{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.row-cols-xl-3>*{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.row-cols-xl-4>*{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.row-cols-xl-5>*{-ms-flex:0 0 20%;flex:0 0 20%;max-width:20%}.row-cols-xl-6>*{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-xl-auto{-ms-flex:0 0 auto;flex:0 0 auto;width:auto;max-width:100%}.col-xl-1{-ms-flex:0 0 8.333333%;flex:0 0 8.333333%;max-width:8.333333%}.col-xl-2{-ms-flex:0 0 16.666667%;flex:0 0 16.666667%;max-width:16.666667%}.col-xl-3{-ms-flex:0 0 25%;flex:0 0 25%;max-width:25%}.col-xl-4{-ms-flex:0 0 33.333333%;flex:0 0 33.333333%;max-width:33.333333%}.col-xl-5{-ms-flex:0 0 41.666667%;flex:0 0 41.666667%;max-width:41.666667%}.col-xl-6{-ms-flex:0 0 50%;flex:0 0 50%;max-width:50%}.col-xl-7{-ms-flex:0 0 58.333333%;flex:0 0 58.333333%;max-width:58.333333%}.col-xl-8{-ms-flex:0 0 66.666667%;flex:0 0 66.666667%;max-width:66.666667%}.col-xl-9{-ms-flex:0 0 75%;flex:0 0 75%;max-width:75%}.col-xl-10{-ms-flex:0 0 83.333333%;flex:0 0 83.333333%;max-width:83.333333%}.col-xl-11{-ms-flex:0 0 91.666667%;flex:0 0 91.666667%;max-width:91.666667%}.col-xl-12{-ms-flex:0 0 100%;flex:0 0 100%;max-width:100%}.order-xl-first{-ms-flex-order:-1;order:-1}.order-xl-last{-ms-flex-order:13;order:13}.order-xl-0{-ms-flex-order:0;order:0}.order-xl-1{-ms-flex-order:1;order:1}.order-xl-2{-ms-flex-order:2;order:2}.order-xl-3{-ms-flex-order:3;order:3}.order-xl-4{-ms-flex-order:4;order:4}.order-xl-5{-ms-flex-order:5;order:5}.order-xl-6{-ms-flex-order:6;order:6}.order-xl-7{-ms-flex-order:7;order:7}.order-xl-8{-ms-flex-order:8;order:8}.order-xl-9{-ms-flex-order:9;order:9}.order-xl-10{-ms-flex-order:10;order:10}.order-xl-11{-ms-flex-order:11;order:11}.order-xl-12{-ms-flex-order:12;order:12}.offset-xl-0{margin-left:0}.offset-xl-1{margin-left:8.333333%}.offset-xl-2{margin-left:16.666667%}.offset-xl-3{margin-left:25%}.offset-xl-4{margin-left:33.333333%}.offset-xl-5{margin-left:41.666667%}.offset-xl-6{margin-left:50%}.offset-xl-7{margin-left:58.333333%}.offset-xl-8{margin-left:66.666667%}.offset-xl-9{margin-left:75%}.offset-xl-10{margin-left:83.333333%}.offset-xl-11{margin-left:91.666667%}}.table{width:100%;margin-bottom:1rem;color:#212529}.table td,.table th{padding:.75rem;vertical-align:top;border-top:1px solid #dee2e6}.table thead th{vertical-align:bottom;border-bottom:2px solid #dee2e6}.table tbody+tbody{border-top:2px solid #dee2e6}.table-sm td,.table-sm th{padding:.3rem}.table-bordered{border:1px solid #dee2e6}.table-bordered td,.table-bordered th{border:1px solid #dee2e6}.table-bordered thead td,.table-bordered thead th{border-bottom-width:2px}.table-borderless tbody+tbody,.table-borderless td,.table-borderless th,.table-borderless thead th{border:0}.table-striped tbody tr:nth-of-type(odd){background-color:rgba(0,0,0,.05)}.table-hover tbody tr:hover{color:#212529;background-color:rgba(0,0,0,.075)}.table-primary,.table-primary>td,.table-primary>th{background-color:#b8daff}.table-primary tbody+tbody,.table-primary td,.table-primary th,.table-primary thead th{border-color:#7abaff}.table-hover .table-primary:hover{background-color:#9fcdff}.table-hover .table-primary:hover>td,.table-hover .table-primary:hover>th{background-color:#9fcdff}.table-secondary,.table-secondary>td,.table-secondary>th{background-color:#d6d8db}.table-secondary tbody+tbody,.table-secondary td,.table-secondary th,.table-secondary thead th{border-color:#b3b7bb}.table-hover .table-secondary:hover{background-color:#c8cbcf}.table-hover .table-secondary:hover>td,.table-hover .table-secondary:hover>th{background-color:#c8cbcf}.table-success,.table-success>td,.table-success>th{background-color:#c3e6cb}.table-success tbody+tbody,.table-success td,.table-success th,.table-success thead th{border-color:#8fd19e}.table-hover .table-success:hover{background-color:#b1dfbb}.table-hover .table-success:hover>td,.table-hover .table-success:hover>th{background-color:#b1dfbb}.table-info,.table-info>td,.table-info>th{background-color:#bee5eb}.table-info tbody+tbody,.table-info td,.table-info th,.table-info thead th{border-color:#86cfda}.table-hover .table-info:hover{background-color:#abdde5}.table-hover .table-info:hover>td,.table-hover .table-info:hover>th{background-color:#abdde5}.table-warning,.table-warning>td,.table-warning>th{background-color:#ffeeba}.table-warning tbody+tbody,.table-warning td,.table-warning th,.table-warning thead th{border-color:#ffdf7e}.table-hover .table-warning:hover{background-color:#ffe8a1}.table-hover .table-warning:hover>td,.table-hover .table-warning:hover>th{background-color:#ffe8a1}.table-danger,.table-danger>td,.table-danger>th{background-color:#f5c6cb}.table-danger tbody+tbody,.table-danger td,.table-danger th,.table-danger thead th{border-color:#ed969e}.table-hover .table-danger:hover{background-color:#f1b0b7}.table-hover .table-danger:hover>td,.table-hover .table-danger:hover>th{background-color:#f1b0b7}.table-light,.table-light>td,.table-light>th{background-color:#fdfdfe}.table-light tbody+tbody,.table-light td,.table-light th,.table-light thead th{border-color:#fbfcfc}.table-hover .table-light:hover{background-color:#ececf6}.table-hover .table-light:hover>td,.table-hover .table-light:hover>th{background-color:#ececf6}.table-dark,.table-dark>td,.table-dark>th{background-color:#c6c8ca}.table-dark tbody+tbody,.table-dark td,.table-dark th,.table-dark thead th{border-color:#95999c}.table-hover .table-dark:hover{background-color:#b9bbbe}.table-hover .table-dark:hover>td,.table-hover .table-dark:hover>th{background-color:#b9bbbe}.table-active,.table-active>td,.table-active>th{background-color:rgba(0,0,0,.075)}.table-hover .table-active:hover{background-color:rgba(0,0,0,.075)}.table-hover .table-active:hover>td,.table-hover .table-active:hover>th{background-color:rgba(0,0,0,.075)}.table .thead-dark th{color:#fff;background-color:#343a40;border-color:#454d55}.table .thead-light th{color:#495057;background-color:#e9ecef;border-color:#dee2e6}.table-dark{color:#fff;background-color:#343a40}.table-dark td,.table-dark th,.table-dark thead th{border-color:#454d55}.table-dark.table-bordered{border:0}.table-dark.table-striped tbody tr:nth-of-type(odd){background-color:rgba(255,255,255,.05)}.table-dark.table-hover tbody tr:hover{color:#fff;background-color:rgba(255,255,255,.075)}@media (max-width:575.98px){.table-responsive-sm{display:block;width:100%;overflow-x:auto;-webkit-overflow-scrolling:touch}.table-responsive-sm>.table-bordered{border:0}}@media (max-width:767.98px){.table-responsive-md{display:block;width:100%;overflow-x:auto;-webkit-overflow-scrolling:touch}.table-responsive-md>.table-bordered{border:0}}@media (max-width:991.98px){.table-responsive-lg{display:block;width:100%;overflow-x:auto;-webkit-overflow-scrolling:touch}.table-responsive-lg>.table-bordered{border:0}}@media (max-width:1199.98px){.table-responsive-xl{display:block;width:100%;overflow-x:auto;-webkit-overflow-scrolling:touch}.table-responsive-xl>.table-bordered{border:0}}.table-responsive{display:block;width:100%;overflow-x:auto;-webkit-overflow-scrolling:touch}.table-responsive>.table-bordered{border:0}.form-control{display:block;width:100%;height:calc(1.5em + .75rem + 2px);padding:.375rem .75rem;font-size:1rem;font-weight:400;line-height:1.5;color:#495057;background-color:#fff;background-clip:padding-box;border:1px solid #ced4da;border-radius:.25rem;transition:border-color .15s ease-in-out,box-shadow .15s ease-in-out}@media (prefers-reduced-motion:reduce){.form-control{transition:none}}.form-control::-ms-expand{background-color:transparent;border:0}.form-control:-moz-focusring{color:transparent;text-shadow:0 0 0 #495057}.form-control:focus{color:#495057;background-color:#fff;border-color:#80bdff;outline:0;box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.form-control::-webkit-input-placeholder{color:#6c757d;opacity:1}.form-control::-moz-placeholder{color:#6c757d;opacity:1}.form-control:-ms-input-placeholder{color:#6c757d;opacity:1}.form-control::-ms-input-placeholder{color:#6c757d;opacity:1}.form-control::placeholder{color:#6c757d;opacity:1}.form-control:disabled,.form-control[readonly]{background-color:#e9ecef;opacity:1}input[type=date].form-control,input[type=datetime-local].form-control,input[type=month].form-control,input[type=time].form-control{-webkit-appearance:none;-moz-appearance:none;appearance:none}select.form-control:focus::-ms-value{color:#495057;background-color:#fff}.form-control-file,.form-control-range{display:block;width:100%}.col-form-label{padding-top:calc(.375rem + 1px);padding-bottom:calc(.375rem + 1px);margin-bottom:0;font-size:inherit;line-height:1.5}.col-form-label-lg{padding-top:calc(.5rem + 1px);padding-bottom:calc(.5rem + 1px);font-size:1.25rem;line-height:1.5}.col-form-label-sm{padding-top:calc(.25rem + 1px);padding-bottom:calc(.25rem + 1px);font-size:.875rem;line-height:1.5}.form-control-plaintext{display:block;width:100%;padding:.375rem 0;margin-bottom:0;font-size:1rem;line-height:1.5;color:#212529;background-color:transparent;border:solid transparent;border-width:1px 0}.form-control-plaintext.form-control-lg,.form-control-plaintext.form-control-sm{padding-right:0;padding-left:0}.form-control-sm{height:calc(1.5em + .5rem + 2px);padding:.25rem .5rem;font-size:.875rem;line-height:1.5;border-radius:.2rem}.form-control-lg{height:calc(1.5em + 1rem + 2px);padding:.5rem 1rem;font-size:1.25rem;line-height:1.5;border-radius:.3rem}select.form-control[multiple],select.form-control[size]{height:auto}textarea.form-control{height:auto}.form-group{margin-bottom:1rem}.form-text{display:block;margin-top:.25rem}.form-row{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;margin-right:-5px;margin-left:-5px}.form-row>.col,.form-row>[class*=col-]{padding-right:5px;padding-left:5px}.form-check{position:relative;display:block;padding-left:1.25rem}.form-check-input{position:absolute;margin-top:.3rem;margin-left:-1.25rem}.form-check-input:disabled~.form-check-label,.form-check-input[disabled]~.form-check-label{color:#6c757d}.form-check-label{margin-bottom:0}.form-check-inline{display:-ms-inline-flexbox;display:inline-flex;-ms-flex-align:center;align-items:center;padding-left:0;margin-right:.75rem}.form-check-inline .form-check-input{position:static;margin-top:0;margin-right:.3125rem;margin-left:0}.valid-feedback{display:none;width:100%;margin-top:.25rem;font-size:80%;color:#28a745}.valid-tooltip{position:absolute;top:100%;left:0;z-index:5;display:none;max-width:100%;padding:.25rem .5rem;margin-top:.1rem;font-size:.875rem;line-height:1.5;color:#fff;background-color:rgba(40,167,69,.9);border-radius:.25rem}.form-row>.col>.valid-tooltip,.form-row>[class*=col-]>.valid-tooltip{left:5px}.is-valid~.valid-feedback,.is-valid~.valid-tooltip,.was-validated :valid~.valid-feedback,.was-validated :valid~.valid-tooltip{display:block}.form-control.is-valid,.was-validated .form-control:valid{border-color:#28a745;padding-right:calc(1.5em + .75rem);background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='8' height='8' viewBox='0 0 8 8'%3e%3cpath fill='%2328a745' d='M2.3 6.73L.6 4.53c-.4-1.04.46-1.4 1.1-.8l1.1 1.4 3.4-3.8c.6-.63 1.6-.27 1.2.7l-4 4.6c-.43.5-.8.4-1.1.1z'/%3e%3c/svg%3e");background-repeat:no-repeat;background-position:right calc(.375em + .1875rem) center;background-size:calc(.75em + .375rem) calc(.75em + .375rem)}.form-control.is-valid:focus,.was-validated .form-control:valid:focus{border-color:#28a745;box-shadow:0 0 0 .2rem rgba(40,167,69,.25)}.was-validated textarea.form-control:valid,textarea.form-control.is-valid{padding-right:calc(1.5em + .75rem);background-position:top calc(.375em + .1875rem) right calc(.375em + .1875rem)}.custom-select.is-valid,.was-validated .custom-select:valid{border-color:#28a745;padding-right:calc(.75em + 2.3125rem);background:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='4' height='5' viewBox='0 0 4 5'%3e%3cpath fill='%23343a40' d='M2 0L0 2h4zm0 5L0 3h4z'/%3e%3c/svg%3e") right .75rem center/8px 10px no-repeat,#fff url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='8' height='8' viewBox='0 0 8 8'%3e%3cpath fill='%2328a745' d='M2.3 6.73L.6 4.53c-.4-1.04.46-1.4 1.1-.8l1.1 1.4 3.4-3.8c.6-.63 1.6-.27 1.2.7l-4 4.6c-.43.5-.8.4-1.1.1z'/%3e%3c/svg%3e") center right 1.75rem/calc(.75em + .375rem) calc(.75em + .375rem) no-repeat}.custom-select.is-valid:focus,.was-validated .custom-select:valid:focus{border-color:#28a745;box-shadow:0 0 0 .2rem rgba(40,167,69,.25)}.form-check-input.is-valid~.form-check-label,.was-validated .form-check-input:valid~.form-check-label{color:#28a745}.form-check-input.is-valid~.valid-feedback,.form-check-input.is-valid~.valid-tooltip,.was-validated .form-check-input:valid~.valid-feedback,.was-validated .form-check-input:valid~.valid-tooltip{display:block}.custom-control-input.is-valid~.custom-control-label,.was-validated .custom-control-input:valid~.custom-control-label{color:#28a745}.custom-control-input.is-valid~.custom-control-label::before,.was-validated .custom-control-input:valid~.custom-control-label::before{border-color:#28a745}.custom-control-input.is-valid:checked~.custom-control-label::before,.was-validated .custom-control-input:valid:checked~.custom-control-label::before{border-color:#34ce57;background-color:#34ce57}.custom-control-input.is-valid:focus~.custom-control-label::before,.was-validated .custom-control-input:valid:focus~.custom-control-label::before{box-shadow:0 0 0 .2rem rgba(40,167,69,.25)}.custom-control-input.is-valid:focus:not(:checked)~.custom-control-label::before,.was-validated .custom-control-input:valid:focus:not(:checked)~.custom-control-label::before{border-color:#28a745}.custom-file-input.is-valid~.custom-file-label,.was-validated .custom-file-input:valid~.custom-file-label{border-color:#28a745}.custom-file-input.is-valid:focus~.custom-file-label,.was-validated .custom-file-input:valid:focus~.custom-file-label{border-color:#28a745;box-shadow:0 0 0 .2rem rgba(40,167,69,.25)}.invalid-feedback{display:none;width:100%;margin-top:.25rem;font-size:80%;color:#dc3545}.invalid-tooltip{position:absolute;top:100%;left:0;z-index:5;display:none;max-width:100%;padding:.25rem .5rem;margin-top:.1rem;font-size:.875rem;line-height:1.5;color:#fff;background-color:rgba(220,53,69,.9);border-radius:.25rem}.form-row>.col>.invalid-tooltip,.form-row>[class*=col-]>.invalid-tooltip{left:5px}.is-invalid~.invalid-feedback,.is-invalid~.invalid-tooltip,.was-validated :invalid~.invalid-feedback,.was-validated :invalid~.invalid-tooltip{display:block}.form-control.is-invalid,.was-validated .form-control:invalid{border-color:#dc3545;padding-right:calc(1.5em + .75rem);background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='12' height='12' fill='none' stroke='%23dc3545' viewBox='0 0 12 12'%3e%3ccircle cx='6' cy='6' r='4.5'/%3e%3cpath stroke-linejoin='round' d='M5.8 3.6h.4L6 6.5z'/%3e%3ccircle cx='6' cy='8.2' r='.6' fill='%23dc3545' stroke='none'/%3e%3c/svg%3e");background-repeat:no-repeat;background-position:right calc(.375em + .1875rem) center;background-size:calc(.75em + .375rem) calc(.75em + .375rem)}.form-control.is-invalid:focus,.was-validated .form-control:invalid:focus{border-color:#dc3545;box-shadow:0 0 0 .2rem rgba(220,53,69,.25)}.was-validated textarea.form-control:invalid,textarea.form-control.is-invalid{padding-right:calc(1.5em + .75rem);background-position:top calc(.375em + .1875rem) right calc(.375em + .1875rem)}.custom-select.is-invalid,.was-validated .custom-select:invalid{border-color:#dc3545;padding-right:calc(.75em + 2.3125rem);background:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='4' height='5' viewBox='0 0 4 5'%3e%3cpath fill='%23343a40' d='M2 0L0 2h4zm0 5L0 3h4z'/%3e%3c/svg%3e") right .75rem center/8px 10px no-repeat,#fff url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='12' height='12' fill='none' stroke='%23dc3545' viewBox='0 0 12 12'%3e%3ccircle cx='6' cy='6' r='4.5'/%3e%3cpath stroke-linejoin='round' d='M5.8 3.6h.4L6 6.5z'/%3e%3ccircle cx='6' cy='8.2' r='.6' fill='%23dc3545' stroke='none'/%3e%3c/svg%3e") center right 1.75rem/calc(.75em + .375rem) calc(.75em + .375rem) no-repeat}.custom-select.is-invalid:focus,.was-validated .custom-select:invalid:focus{border-color:#dc3545;box-shadow:0 0 0 .2rem rgba(220,53,69,.25)}.form-check-input.is-invalid~.form-check-label,.was-validated .form-check-input:invalid~.form-check-label{color:#dc3545}.form-check-input.is-invalid~.invalid-feedback,.form-check-input.is-invalid~.invalid-tooltip,.was-validated .form-check-input:invalid~.invalid-feedback,.was-validated .form-check-input:invalid~.invalid-tooltip{display:block}.custom-control-input.is-invalid~.custom-control-label,.was-validated .custom-control-input:invalid~.custom-control-label{color:#dc3545}.custom-control-input.is-invalid~.custom-control-label::before,.was-validated .custom-control-input:invalid~.custom-control-label::before{border-color:#dc3545}.custom-control-input.is-invalid:checked~.custom-control-label::before,.was-validated .custom-control-input:invalid:checked~.custom-control-label::before{border-color:#e4606d;background-color:#e4606d}.custom-control-input.is-invalid:focus~.custom-control-label::before,.was-validated .custom-control-input:invalid:focus~.custom-control-label::before{box-shadow:0 0 0 .2rem rgba(220,53,69,.25)}.custom-control-input.is-invalid:focus:not(:checked)~.custom-control-label::before,.was-validated .custom-control-input:invalid:focus:not(:checked)~.custom-control-label::before{border-color:#dc3545}.custom-file-input.is-invalid~.custom-file-label,.was-validated .custom-file-input:invalid~.custom-file-label{border-color:#dc3545}.custom-file-input.is-invalid:focus~.custom-file-label,.was-validated .custom-file-input:invalid:focus~.custom-file-label{border-color:#dc3545;box-shadow:0 0 0 .2rem rgba(220,53,69,.25)}.form-inline{display:-ms-flexbox;display:flex;-ms-flex-flow:row wrap;flex-flow:row wrap;-ms-flex-align:center;align-items:center}.form-inline .form-check{width:100%}@media (min-width:576px){.form-inline label{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;-ms-flex-pack:center;justify-content:center;margin-bottom:0}.form-inline .form-group{display:-ms-flexbox;display:flex;-ms-flex:0 0 auto;flex:0 0 auto;-ms-flex-flow:row wrap;flex-flow:row wrap;-ms-flex-align:center;align-items:center;margin-bottom:0}.form-inline .form-control{display:inline-block;width:auto;vertical-align:middle}.form-inline .form-control-plaintext{display:inline-block}.form-inline .custom-select,.form-inline .input-group{width:auto}.form-inline .form-check{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;-ms-flex-pack:center;justify-content:center;width:auto;padding-left:0}.form-inline .form-check-input{position:relative;-ms-flex-negative:0;flex-shrink:0;margin-top:0;margin-right:.25rem;margin-left:0}.form-inline .custom-control{-ms-flex-align:center;align-items:center;-ms-flex-pack:center;justify-content:center}.form-inline .custom-control-label{margin-bottom:0}}.btn{display:inline-block;font-weight:400;color:#212529;text-align:center;vertical-align:middle;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none;background-color:transparent;border:1px solid transparent;padding:.375rem .75rem;font-size:1rem;line-height:1.5;border-radius:.25rem;transition:color .15s ease-in-out,background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out}@media (prefers-reduced-motion:reduce){.btn{transition:none}}.btn:hover{color:#212529;text-decoration:none}.btn.focus,.btn:focus{outline:0;box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.btn.disabled,.btn:disabled{opacity:.65}.btn:not(:disabled):not(.disabled){cursor:pointer}a.btn.disabled,fieldset:disabled a.btn{pointer-events:none}.btn-primary{color:#fff;background-color:#007bff;border-color:#007bff}.btn-primary:hover{color:#fff;background-color:#0069d9;border-color:#0062cc}.btn-primary.focus,.btn-primary:focus{color:#fff;background-color:#0069d9;border-color:#0062cc;box-shadow:0 0 0 .2rem rgba(38,143,255,.5)}.btn-primary.disabled,.btn-primary:disabled{color:#fff;background-color:#007bff;border-color:#007bff}.btn-primary:not(:disabled):not(.disabled).active,.btn-primary:not(:disabled):not(.disabled):active,.show>.btn-primary.dropdown-toggle{color:#fff;background-color:#0062cc;border-color:#005cbf}.btn-primary:not(:disabled):not(.disabled).active:focus,.btn-primary:not(:disabled):not(.disabled):active:focus,.show>.btn-primary.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(38,143,255,.5)}.btn-secondary{color:#fff;background-color:#6c757d;border-color:#6c757d}.btn-secondary:hover{color:#fff;background-color:#5a6268;border-color:#545b62}.btn-secondary.focus,.btn-secondary:focus{color:#fff;background-color:#5a6268;border-color:#545b62;box-shadow:0 0 0 .2rem rgba(130,138,145,.5)}.btn-secondary.disabled,.btn-secondary:disabled{color:#fff;background-color:#6c757d;border-color:#6c757d}.btn-secondary:not(:disabled):not(.disabled).active,.btn-secondary:not(:disabled):not(.disabled):active,.show>.btn-secondary.dropdown-toggle{color:#fff;background-color:#545b62;border-color:#4e555b}.btn-secondary:not(:disabled):not(.disabled).active:focus,.btn-secondary:not(:disabled):not(.disabled):active:focus,.show>.btn-secondary.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(130,138,145,.5)}.btn-success{color:#fff;background-color:#28a745;border-color:#28a745}.btn-success:hover{color:#fff;background-color:#218838;border-color:#1e7e34}.btn-success.focus,.btn-success:focus{color:#fff;background-color:#218838;border-color:#1e7e34;box-shadow:0 0 0 .2rem rgba(72,180,97,.5)}.btn-success.disabled,.btn-success:disabled{color:#fff;background-color:#28a745;border-color:#28a745}.btn-success:not(:disabled):not(.disabled).active,.btn-success:not(:disabled):not(.disabled):active,.show>.btn-success.dropdown-toggle{color:#fff;background-color:#1e7e34;border-color:#1c7430}.btn-success:not(:disabled):not(.disabled).active:focus,.btn-success:not(:disabled):not(.disabled):active:focus,.show>.btn-success.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(72,180,97,.5)}.btn-info{color:#fff;background-color:#17a2b8;border-color:#17a2b8}.btn-info:hover{color:#fff;background-color:#138496;border-color:#117a8b}.btn-info.focus,.btn-info:focus{color:#fff;background-color:#138496;border-color:#117a8b;box-shadow:0 0 0 .2rem rgba(58,176,195,.5)}.btn-info.disabled,.btn-info:disabled{color:#fff;background-color:#17a2b8;border-color:#17a2b8}.btn-info:not(:disabled):not(.disabled).active,.btn-info:not(:disabled):not(.disabled):active,.show>.btn-info.dropdown-toggle{color:#fff;background-color:#117a8b;border-color:#10707f}.btn-info:not(:disabled):not(.disabled).active:focus,.btn-info:not(:disabled):not(.disabled):active:focus,.show>.btn-info.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(58,176,195,.5)}.btn-warning{color:#212529;background-color:#ffc107;border-color:#ffc107}.btn-warning:hover{color:#212529;background-color:#e0a800;border-color:#d39e00}.btn-warning.focus,.btn-warning:focus{color:#212529;background-color:#e0a800;border-color:#d39e00;box-shadow:0 0 0 .2rem rgba(222,170,12,.5)}.btn-warning.disabled,.btn-warning:disabled{color:#212529;background-color:#ffc107;border-color:#ffc107}.btn-warning:not(:disabled):not(.disabled).active,.btn-warning:not(:disabled):not(.disabled):active,.show>.btn-warning.dropdown-toggle{color:#212529;background-color:#d39e00;border-color:#c69500}.btn-warning:not(:disabled):not(.disabled).active:focus,.btn-warning:not(:disabled):not(.disabled):active:focus,.show>.btn-warning.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(222,170,12,.5)}.btn-danger{color:#fff;background-color:#dc3545;border-color:#dc3545}.btn-danger:hover{color:#fff;background-color:#c82333;border-color:#bd2130}.btn-danger.focus,.btn-danger:focus{color:#fff;background-color:#c82333;border-color:#bd2130;box-shadow:0 0 0 .2rem rgba(225,83,97,.5)}.btn-danger.disabled,.btn-danger:disabled{color:#fff;background-color:#dc3545;border-color:#dc3545}.btn-danger:not(:disabled):not(.disabled).active,.btn-danger:not(:disabled):not(.disabled):active,.show>.btn-danger.dropdown-toggle{color:#fff;background-color:#bd2130;border-color:#b21f2d}.btn-danger:not(:disabled):not(.disabled).active:focus,.btn-danger:not(:disabled):not(.disabled):active:focus,.show>.btn-danger.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(225,83,97,.5)}.btn-light{color:#212529;background-color:#f8f9fa;border-color:#f8f9fa}.btn-light:hover{color:#212529;background-color:#e2e6ea;border-color:#dae0e5}.btn-light.focus,.btn-light:focus{color:#212529;background-color:#e2e6ea;border-color:#dae0e5;box-shadow:0 0 0 .2rem rgba(216,217,219,.5)}.btn-light.disabled,.btn-light:disabled{color:#212529;background-color:#f8f9fa;border-color:#f8f9fa}.btn-light:not(:disabled):not(.disabled).active,.btn-light:not(:disabled):not(.disabled):active,.show>.btn-light.dropdown-toggle{color:#212529;background-color:#dae0e5;border-color:#d3d9df}.btn-light:not(:disabled):not(.disabled).active:focus,.btn-light:not(:disabled):not(.disabled):active:focus,.show>.btn-light.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(216,217,219,.5)}.btn-dark{color:#fff;background-color:#343a40;border-color:#343a40}.btn-dark:hover{color:#fff;background-color:#23272b;border-color:#1d2124}.btn-dark.focus,.btn-dark:focus{color:#fff;background-color:#23272b;border-color:#1d2124;box-shadow:0 0 0 .2rem rgba(82,88,93,.5)}.btn-dark.disabled,.btn-dark:disabled{color:#fff;background-color:#343a40;border-color:#343a40}.btn-dark:not(:disabled):not(.disabled).active,.btn-dark:not(:disabled):not(.disabled):active,.show>.btn-dark.dropdown-toggle{color:#fff;background-color:#1d2124;border-color:#171a1d}.btn-dark:not(:disabled):not(.disabled).active:focus,.btn-dark:not(:disabled):not(.disabled):active:focus,.show>.btn-dark.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(82,88,93,.5)}.btn-outline-primary{color:#007bff;border-color:#007bff}.btn-outline-primary:hover{color:#fff;background-color:#007bff;border-color:#007bff}.btn-outline-primary.focus,.btn-outline-primary:focus{box-shadow:0 0 0 .2rem rgba(0,123,255,.5)}.btn-outline-primary.disabled,.btn-outline-primary:disabled{color:#007bff;background-color:transparent}.btn-outline-primary:not(:disabled):not(.disabled).active,.btn-outline-primary:not(:disabled):not(.disabled):active,.show>.btn-outline-primary.dropdown-toggle{color:#fff;background-color:#007bff;border-color:#007bff}.btn-outline-primary:not(:disabled):not(.disabled).active:focus,.btn-outline-primary:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-primary.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(0,123,255,.5)}.btn-outline-secondary{color:#6c757d;border-color:#6c757d}.btn-outline-secondary:hover{color:#fff;background-color:#6c757d;border-color:#6c757d}.btn-outline-secondary.focus,.btn-outline-secondary:focus{box-shadow:0 0 0 .2rem rgba(108,117,125,.5)}.btn-outline-secondary.disabled,.btn-outline-secondary:disabled{color:#6c757d;background-color:transparent}.btn-outline-secondary:not(:disabled):not(.disabled).active,.btn-outline-secondary:not(:disabled):not(.disabled):active,.show>.btn-outline-secondary.dropdown-toggle{color:#fff;background-color:#6c757d;border-color:#6c757d}.btn-outline-secondary:not(:disabled):not(.disabled).active:focus,.btn-outline-secondary:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-secondary.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(108,117,125,.5)}.btn-outline-success{color:#28a745;border-color:#28a745}.btn-outline-success:hover{color:#fff;background-color:#28a745;border-color:#28a745}.btn-outline-success.focus,.btn-outline-success:focus{box-shadow:0 0 0 .2rem rgba(40,167,69,.5)}.btn-outline-success.disabled,.btn-outline-success:disabled{color:#28a745;background-color:transparent}.btn-outline-success:not(:disabled):not(.disabled).active,.btn-outline-success:not(:disabled):not(.disabled):active,.show>.btn-outline-success.dropdown-toggle{color:#fff;background-color:#28a745;border-color:#28a745}.btn-outline-success:not(:disabled):not(.disabled).active:focus,.btn-outline-success:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-success.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(40,167,69,.5)}.btn-outline-info{color:#17a2b8;border-color:#17a2b8}.btn-outline-info:hover{color:#fff;background-color:#17a2b8;border-color:#17a2b8}.btn-outline-info.focus,.btn-outline-info:focus{box-shadow:0 0 0 .2rem rgba(23,162,184,.5)}.btn-outline-info.disabled,.btn-outline-info:disabled{color:#17a2b8;background-color:transparent}.btn-outline-info:not(:disabled):not(.disabled).active,.btn-outline-info:not(:disabled):not(.disabled):active,.show>.btn-outline-info.dropdown-toggle{color:#fff;background-color:#17a2b8;border-color:#17a2b8}.btn-outline-info:not(:disabled):not(.disabled).active:focus,.btn-outline-info:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-info.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(23,162,184,.5)}.btn-outline-warning{color:#ffc107;border-color:#ffc107}.btn-outline-warning:hover{color:#212529;background-color:#ffc107;border-color:#ffc107}.btn-outline-warning.focus,.btn-outline-warning:focus{box-shadow:0 0 0 .2rem rgba(255,193,7,.5)}.btn-outline-warning.disabled,.btn-outline-warning:disabled{color:#ffc107;background-color:transparent}.btn-outline-warning:not(:disabled):not(.disabled).active,.btn-outline-warning:not(:disabled):not(.disabled):active,.show>.btn-outline-warning.dropdown-toggle{color:#212529;background-color:#ffc107;border-color:#ffc107}.btn-outline-warning:not(:disabled):not(.disabled).active:focus,.btn-outline-warning:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-warning.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(255,193,7,.5)}.btn-outline-danger{color:#dc3545;border-color:#dc3545}.btn-outline-danger:hover{color:#fff;background-color:#dc3545;border-color:#dc3545}.btn-outline-danger.focus,.btn-outline-danger:focus{box-shadow:0 0 0 .2rem rgba(220,53,69,.5)}.btn-outline-danger.disabled,.btn-outline-danger:disabled{color:#dc3545;background-color:transparent}.btn-outline-danger:not(:disabled):not(.disabled).active,.btn-outline-danger:not(:disabled):not(.disabled):active,.show>.btn-outline-danger.dropdown-toggle{color:#fff;background-color:#dc3545;border-color:#dc3545}.btn-outline-danger:not(:disabled):not(.disabled).active:focus,.btn-outline-danger:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-danger.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(220,53,69,.5)}.btn-outline-light{color:#f8f9fa;border-color:#f8f9fa}.btn-outline-light:hover{color:#212529;background-color:#f8f9fa;border-color:#f8f9fa}.btn-outline-light.focus,.btn-outline-light:focus{box-shadow:0 0 0 .2rem rgba(248,249,250,.5)}.btn-outline-light.disabled,.btn-outline-light:disabled{color:#f8f9fa;background-color:transparent}.btn-outline-light:not(:disabled):not(.disabled).active,.btn-outline-light:not(:disabled):not(.disabled):active,.show>.btn-outline-light.dropdown-toggle{color:#212529;background-color:#f8f9fa;border-color:#f8f9fa}.btn-outline-light:not(:disabled):not(.disabled).active:focus,.btn-outline-light:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-light.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(248,249,250,.5)}.btn-outline-dark{color:#343a40;border-color:#343a40}.btn-outline-dark:hover{color:#fff;background-color:#343a40;border-color:#343a40}.btn-outline-dark.focus,.btn-outline-dark:focus{box-shadow:0 0 0 .2rem rgba(52,58,64,.5)}.btn-outline-dark.disabled,.btn-outline-dark:disabled{color:#343a40;background-color:transparent}.btn-outline-dark:not(:disabled):not(.disabled).active,.btn-outline-dark:not(:disabled):not(.disabled):active,.show>.btn-outline-dark.dropdown-toggle{color:#fff;background-color:#343a40;border-color:#343a40}.btn-outline-dark:not(:disabled):not(.disabled).active:focus,.btn-outline-dark:not(:disabled):not(.disabled):active:focus,.show>.btn-outline-dark.dropdown-toggle:focus{box-shadow:0 0 0 .2rem rgba(52,58,64,.5)}.btn-link{font-weight:400;color:#007bff;text-decoration:none}.btn-link:hover{color:#0056b3;text-decoration:underline}.btn-link.focus,.btn-link:focus{text-decoration:underline}.btn-link.disabled,.btn-link:disabled{color:#6c757d;pointer-events:none}.btn-group-lg>.btn,.btn-lg{padding:.5rem 1rem;font-size:1.25rem;line-height:1.5;border-radius:.3rem}.btn-group-sm>.btn,.btn-sm{padding:.25rem .5rem;font-size:.875rem;line-height:1.5;border-radius:.2rem}.btn-block{display:block;width:100%}.btn-block+.btn-block{margin-top:.5rem}input[type=button].btn-block,input[type=reset].btn-block,input[type=submit].btn-block{width:100%}.fade{transition:opacity .15s linear}@media (prefers-reduced-motion:reduce){.fade{transition:none}}.fade:not(.show){opacity:0}.collapse:not(.show){display:none}.collapsing{position:relative;height:0;overflow:hidden;transition:height .35s ease}@media (prefers-reduced-motion:reduce){.collapsing{transition:none}}.dropdown,.dropleft,.dropright,.dropup{position:relative}.dropdown-toggle{white-space:nowrap}.dropdown-toggle::after{display:inline-block;margin-left:.255em;vertical-align:.255em;content:"";border-top:.3em solid;border-right:.3em solid transparent;border-bottom:0;border-left:.3em solid transparent}.dropdown-toggle:empty::after{margin-left:0}.dropdown-menu{position:absolute;top:100%;left:0;z-index:1000;display:none;float:left;min-width:10rem;padding:.5rem 0;margin:.125rem 0 0;font-size:1rem;color:#212529;text-align:left;list-style:none;background-color:#fff;background-clip:padding-box;border:1px solid rgba(0,0,0,.15);border-radius:.25rem}.dropdown-menu-left{right:auto;left:0}.dropdown-menu-right{right:0;left:auto}@media (min-width:576px){.dropdown-menu-sm-left{right:auto;left:0}.dropdown-menu-sm-right{right:0;left:auto}}@media (min-width:768px){.dropdown-menu-md-left{right:auto;left:0}.dropdown-menu-md-right{right:0;left:auto}}@media (min-width:992px){.dropdown-menu-lg-left{right:auto;left:0}.dropdown-menu-lg-right{right:0;left:auto}}@media (min-width:1200px){.dropdown-menu-xl-left{right:auto;left:0}.dropdown-menu-xl-right{right:0;left:auto}}.dropup .dropdown-menu{top:auto;bottom:100%;margin-top:0;margin-bottom:.125rem}.dropup .dropdown-toggle::after{display:inline-block;margin-left:.255em;vertical-align:.255em;content:"";border-top:0;border-right:.3em solid transparent;border-bottom:.3em solid;border-left:.3em solid transparent}.dropup .dropdown-toggle:empty::after{margin-left:0}.dropright .dropdown-menu{top:0;right:auto;left:100%;margin-top:0;margin-left:.125rem}.dropright .dropdown-toggle::after{display:inline-block;margin-left:.255em;vertical-align:.255em;content:"";border-top:.3em solid transparent;border-right:0;border-bottom:.3em solid transparent;border-left:.3em solid}.dropright .dropdown-toggle:empty::after{margin-left:0}.dropright .dropdown-toggle::after{vertical-align:0}.dropleft .dropdown-menu{top:0;right:100%;left:auto;margin-top:0;margin-right:.125rem}.dropleft .dropdown-toggle::after{display:inline-block;margin-left:.255em;vertical-align:.255em;content:""}.dropleft .dropdown-toggle::after{display:none}.dropleft .dropdown-toggle::before{display:inline-block;margin-right:.255em;vertical-align:.255em;content:"";border-top:.3em solid transparent;border-right:.3em solid;border-bottom:.3em solid transparent}.dropleft .dropdown-toggle:empty::after{margin-left:0}.dropleft .dropdown-toggle::before{vertical-align:0}.dropdown-menu[x-placement^=bottom],.dropdown-menu[x-placement^=left],.dropdown-menu[x-placement^=right],.dropdown-menu[x-placement^=top]{right:auto;bottom:auto}.dropdown-divider{height:0;margin:.5rem 0;overflow:hidden;border-top:1px solid #e9ecef}.dropdown-item{display:block;width:100%;padding:.25rem 1.5rem;clear:both;font-weight:400;color:#212529;text-align:inherit;white-space:nowrap;background-color:transparent;border:0}.dropdown-item:focus,.dropdown-item:hover{color:#16181b;text-decoration:none;background-color:#e9ecef}.dropdown-item.active,.dropdown-item:active{color:#fff;text-decoration:none;background-color:#007bff}.dropdown-item.disabled,.dropdown-item:disabled{color:#adb5bd;pointer-events:none;background-color:transparent}.dropdown-menu.show{display:block}.dropdown-header{display:block;padding:.5rem 1.5rem;margin-bottom:0;font-size:.875rem;color:#6c757d;white-space:nowrap}.dropdown-item-text{display:block;padding:.25rem 1.5rem;color:#212529}.btn-group,.btn-group-vertical{position:relative;display:-ms-inline-flexbox;display:inline-flex;vertical-align:middle}.btn-group-vertical>.btn,.btn-group>.btn{position:relative;-ms-flex:1 1 auto;flex:1 1 auto}.btn-group-vertical>.btn:hover,.btn-group>.btn:hover{z-index:1}.btn-group-vertical>.btn.active,.btn-group-vertical>.btn:active,.btn-group-vertical>.btn:focus,.btn-group>.btn.active,.btn-group>.btn:active,.btn-group>.btn:focus{z-index:1}.btn-toolbar{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;-ms-flex-pack:start;justify-content:flex-start}.btn-toolbar .input-group{width:auto}.btn-group>.btn-group:not(:first-child),.btn-group>.btn:not(:first-child){margin-left:-1px}.btn-group>.btn-group:not(:last-child)>.btn,.btn-group>.btn:not(:last-child):not(.dropdown-toggle){border-top-right-radius:0;border-bottom-right-radius:0}.btn-group>.btn-group:not(:first-child)>.btn,.btn-group>.btn:not(:first-child){border-top-left-radius:0;border-bottom-left-radius:0}.dropdown-toggle-split{padding-right:.5625rem;padding-left:.5625rem}.dropdown-toggle-split::after,.dropright .dropdown-toggle-split::after,.dropup .dropdown-toggle-split::after{margin-left:0}.dropleft .dropdown-toggle-split::before{margin-right:0}.btn-group-sm>.btn+.dropdown-toggle-split,.btn-sm+.dropdown-toggle-split{padding-right:.375rem;padding-left:.375rem}.btn-group-lg>.btn+.dropdown-toggle-split,.btn-lg+.dropdown-toggle-split{padding-right:.75rem;padding-left:.75rem}.btn-group-vertical{-ms-flex-direction:column;flex-direction:column;-ms-flex-align:start;align-items:flex-start;-ms-flex-pack:center;justify-content:center}.btn-group-vertical>.btn,.btn-group-vertical>.btn-group{width:100%}.btn-group-vertical>.btn-group:not(:first-child),.btn-group-vertical>.btn:not(:first-child){margin-top:-1px}.btn-group-vertical>.btn-group:not(:last-child)>.btn,.btn-group-vertical>.btn:not(:last-child):not(.dropdown-toggle){border-bottom-right-radius:0;border-bottom-left-radius:0}.btn-group-vertical>.btn-group:not(:first-child)>.btn,.btn-group-vertical>.btn:not(:first-child){border-top-left-radius:0;border-top-right-radius:0}.btn-group-toggle>.btn,.btn-group-toggle>.btn-group>.btn{margin-bottom:0}.btn-group-toggle>.btn input[type=checkbox],.btn-group-toggle>.btn input[type=radio],.btn-group-toggle>.btn-group>.btn input[type=checkbox],.btn-group-toggle>.btn-group>.btn input[type=radio]{position:absolute;clip:rect(0,0,0,0);pointer-events:none}.input-group{position:relative;display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;-ms-flex-align:stretch;align-items:stretch;width:100%}.input-group>.custom-file,.input-group>.custom-select,.input-group>.form-control,.input-group>.form-control-plaintext{position:relative;-ms-flex:1 1 auto;flex:1 1 auto;width:1%;min-width:0;margin-bottom:0}.input-group>.custom-file+.custom-file,.input-group>.custom-file+.custom-select,.input-group>.custom-file+.form-control,.input-group>.custom-select+.custom-file,.input-group>.custom-select+.custom-select,.input-group>.custom-select+.form-control,.input-group>.form-control+.custom-file,.input-group>.form-control+.custom-select,.input-group>.form-control+.form-control,.input-group>.form-control-plaintext+.custom-file,.input-group>.form-control-plaintext+.custom-select,.input-group>.form-control-plaintext+.form-control{margin-left:-1px}.input-group>.custom-file .custom-file-input:focus~.custom-file-label,.input-group>.custom-select:focus,.input-group>.form-control:focus{z-index:3}.input-group>.custom-file .custom-file-input:focus{z-index:4}.input-group>.custom-select:not(:first-child),.input-group>.form-control:not(:first-child){border-top-left-radius:0;border-bottom-left-radius:0}.input-group>.custom-file{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center}.input-group>.custom-file:not(:first-child) .custom-file-label,.input-group>.custom-file:not(:last-child) .custom-file-label{border-top-left-radius:0;border-bottom-left-radius:0}.input-group:not(.has-validation)>.custom-file:not(:last-child) .custom-file-label::after,.input-group:not(.has-validation)>.custom-select:not(:last-child),.input-group:not(.has-validation)>.form-control:not(:last-child){border-top-right-radius:0;border-bottom-right-radius:0}.input-group.has-validation>.custom-file:nth-last-child(n+3) .custom-file-label::after,.input-group.has-validation>.custom-select:nth-last-child(n+3),.input-group.has-validation>.form-control:nth-last-child(n+3){border-top-right-radius:0;border-bottom-right-radius:0}.input-group-append,.input-group-prepend{display:-ms-flexbox;display:flex}.input-group-append .btn,.input-group-prepend .btn{position:relative;z-index:2}.input-group-append .btn:focus,.input-group-prepend .btn:focus{z-index:3}.input-group-append .btn+.btn,.input-group-append .btn+.input-group-text,.input-group-append .input-group-text+.btn,.input-group-append .input-group-text+.input-group-text,.input-group-prepend .btn+.btn,.input-group-prepend .btn+.input-group-text,.input-group-prepend .input-group-text+.btn,.input-group-prepend .input-group-text+.input-group-text{margin-left:-1px}.input-group-prepend{margin-right:-1px}.input-group-append{margin-left:-1px}.input-group-text{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;padding:.375rem .75rem;margin-bottom:0;font-size:1rem;font-weight:400;line-height:1.5;color:#495057;text-align:center;white-space:nowrap;background-color:#e9ecef;border:1px solid #ced4da;border-radius:.25rem}.input-group-text input[type=checkbox],.input-group-text input[type=radio]{margin-top:0}.input-group-lg>.custom-select,.input-group-lg>.form-control:not(textarea){height:calc(1.5em + 1rem + 2px)}.input-group-lg>.custom-select,.input-group-lg>.form-control,.input-group-lg>.input-group-append>.btn,.input-group-lg>.input-group-append>.input-group-text,.input-group-lg>.input-group-prepend>.btn,.input-group-lg>.input-group-prepend>.input-group-text{padding:.5rem 1rem;font-size:1.25rem;line-height:1.5;border-radius:.3rem}.input-group-sm>.custom-select,.input-group-sm>.form-control:not(textarea){height:calc(1.5em + .5rem + 2px)}.input-group-sm>.custom-select,.input-group-sm>.form-control,.input-group-sm>.input-group-append>.btn,.input-group-sm>.input-group-append>.input-group-text,.input-group-sm>.input-group-prepend>.btn,.input-group-sm>.input-group-prepend>.input-group-text{padding:.25rem .5rem;font-size:.875rem;line-height:1.5;border-radius:.2rem}.input-group-lg>.custom-select,.input-group-sm>.custom-select{padding-right:1.75rem}.input-group.has-validation>.input-group-append:nth-last-child(n+3)>.btn,.input-group.has-validation>.input-group-append:nth-last-child(n+3)>.input-group-text,.input-group:not(.has-validation)>.input-group-append:not(:last-child)>.btn,.input-group:not(.has-validation)>.input-group-append:not(:last-child)>.input-group-text,.input-group>.input-group-append:last-child>.btn:not(:last-child):not(.dropdown-toggle),.input-group>.input-group-append:last-child>.input-group-text:not(:last-child),.input-group>.input-group-prepend>.btn,.input-group>.input-group-prepend>.input-group-text{border-top-right-radius:0;border-bottom-right-radius:0}.input-group>.input-group-append>.btn,.input-group>.input-group-append>.input-group-text,.input-group>.input-group-prepend:first-child>.btn:not(:first-child),.input-group>.input-group-prepend:first-child>.input-group-text:not(:first-child),.input-group>.input-group-prepend:not(:first-child)>.btn,.input-group>.input-group-prepend:not(:first-child)>.input-group-text{border-top-left-radius:0;border-bottom-left-radius:0}.custom-control{position:relative;z-index:1;display:block;min-height:1.5rem;padding-left:1.5rem;-webkit-print-color-adjust:exact;color-adjust:exact}.custom-control-inline{display:-ms-inline-flexbox;display:inline-flex;margin-right:1rem}.custom-control-input{position:absolute;left:0;z-index:-1;width:1rem;height:1.25rem;opacity:0}.custom-control-input:checked~.custom-control-label::before{color:#fff;border-color:#007bff;background-color:#007bff}.custom-control-input:focus~.custom-control-label::before{box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.custom-control-input:focus:not(:checked)~.custom-control-label::before{border-color:#80bdff}.custom-control-input:not(:disabled):active~.custom-control-label::before{color:#fff;background-color:#b3d7ff;border-color:#b3d7ff}.custom-control-input:disabled~.custom-control-label,.custom-control-input[disabled]~.custom-control-label{color:#6c757d}.custom-control-input:disabled~.custom-control-label::before,.custom-control-input[disabled]~.custom-control-label::before{background-color:#e9ecef}.custom-control-label{position:relative;margin-bottom:0;vertical-align:top}.custom-control-label::before{position:absolute;top:.25rem;left:-1.5rem;display:block;width:1rem;height:1rem;pointer-events:none;content:"";background-color:#fff;border:#adb5bd solid 1px}.custom-control-label::after{position:absolute;top:.25rem;left:-1.5rem;display:block;width:1rem;height:1rem;content:"";background:50%/50% 50% no-repeat}.custom-checkbox .custom-control-label::before{border-radius:.25rem}.custom-checkbox .custom-control-input:checked~.custom-control-label::after{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='8' height='8' viewBox='0 0 8 8'%3e%3cpath fill='%23fff' d='M6.564.75l-3.59 3.612-1.538-1.55L0 4.26l2.974 2.99L8 2.193z'/%3e%3c/svg%3e")}.custom-checkbox .custom-control-input:indeterminate~.custom-control-label::before{border-color:#007bff;background-color:#007bff}.custom-checkbox .custom-control-input:indeterminate~.custom-control-label::after{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='4' height='4' viewBox='0 0 4 4'%3e%3cpath stroke='%23fff' d='M0 2h4'/%3e%3c/svg%3e")}.custom-checkbox .custom-control-input:disabled:checked~.custom-control-label::before{background-color:rgba(0,123,255,.5)}.custom-checkbox .custom-control-input:disabled:indeterminate~.custom-control-label::before{background-color:rgba(0,123,255,.5)}.custom-radio .custom-control-label::before{border-radius:50%}.custom-radio .custom-control-input:checked~.custom-control-label::after{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='12' height='12' viewBox='-4 -4 8 8'%3e%3ccircle r='3' fill='%23fff'/%3e%3c/svg%3e")}.custom-radio .custom-control-input:disabled:checked~.custom-control-label::before{background-color:rgba(0,123,255,.5)}.custom-switch{padding-left:2.25rem}.custom-switch .custom-control-label::before{left:-2.25rem;width:1.75rem;pointer-events:all;border-radius:.5rem}.custom-switch .custom-control-label::after{top:calc(.25rem + 2px);left:calc(-2.25rem + 2px);width:calc(1rem - 4px);height:calc(1rem - 4px);background-color:#adb5bd;border-radius:.5rem;transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out,-webkit-transform .15s ease-in-out;transition:transform .15s ease-in-out,background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;transition:transform .15s ease-in-out,background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out,-webkit-transform .15s ease-in-out}@media (prefers-reduced-motion:reduce){.custom-switch .custom-control-label::after{transition:none}}.custom-switch .custom-control-input:checked~.custom-control-label::after{background-color:#fff;-webkit-transform:translateX(.75rem);transform:translateX(.75rem)}.custom-switch .custom-control-input:disabled:checked~.custom-control-label::before{background-color:rgba(0,123,255,.5)}.custom-select{display:inline-block;width:100%;height:calc(1.5em + .75rem + 2px);padding:.375rem 1.75rem .375rem .75rem;font-size:1rem;font-weight:400;line-height:1.5;color:#495057;vertical-align:middle;background:#fff url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='4' height='5' viewBox='0 0 4 5'%3e%3cpath fill='%23343a40' d='M2 0L0 2h4zm0 5L0 3h4z'/%3e%3c/svg%3e") right .75rem center/8px 10px no-repeat;border:1px solid #ced4da;border-radius:.25rem;-webkit-appearance:none;-moz-appearance:none;appearance:none}.custom-select:focus{border-color:#80bdff;outline:0;box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.custom-select:focus::-ms-value{color:#495057;background-color:#fff}.custom-select[multiple],.custom-select[size]:not([size="1"]){height:auto;padding-right:.75rem;background-image:none}.custom-select:disabled{color:#6c757d;background-color:#e9ecef}.custom-select::-ms-expand{display:none}.custom-select:-moz-focusring{color:transparent;text-shadow:0 0 0 #495057}.custom-select-sm{height:calc(1.5em + .5rem + 2px);padding-top:.25rem;padding-bottom:.25rem;padding-left:.5rem;font-size:.875rem}.custom-select-lg{height:calc(1.5em + 1rem + 2px);padding-top:.5rem;padding-bottom:.5rem;padding-left:1rem;font-size:1.25rem}.custom-file{position:relative;display:inline-block;width:100%;height:calc(1.5em + .75rem + 2px);margin-bottom:0}.custom-file-input{position:relative;z-index:2;width:100%;height:calc(1.5em + .75rem + 2px);margin:0;overflow:hidden;opacity:0}.custom-file-input:focus~.custom-file-label{border-color:#80bdff;box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.custom-file-input:disabled~.custom-file-label,.custom-file-input[disabled]~.custom-file-label{background-color:#e9ecef}.custom-file-input:lang(en)~.custom-file-label::after{content:"Browse"}.custom-file-input~.custom-file-label[data-browse]::after{content:attr(data-browse)}.custom-file-label{position:absolute;top:0;right:0;left:0;z-index:1;height:calc(1.5em + .75rem + 2px);padding:.375rem .75rem;overflow:hidden;font-weight:400;line-height:1.5;color:#495057;background-color:#fff;border:1px solid #ced4da;border-radius:.25rem}.custom-file-label::after{position:absolute;top:0;right:0;bottom:0;z-index:3;display:block;height:calc(1.5em + .75rem);padding:.375rem .75rem;line-height:1.5;color:#495057;content:"Browse";background-color:#e9ecef;border-left:inherit;border-radius:0 .25rem .25rem 0}.custom-range{width:100%;height:1.4rem;padding:0;background-color:transparent;-webkit-appearance:none;-moz-appearance:none;appearance:none}.custom-range:focus{outline:0}.custom-range:focus::-webkit-slider-thumb{box-shadow:0 0 0 1px #fff,0 0 0 .2rem rgba(0,123,255,.25)}.custom-range:focus::-moz-range-thumb{box-shadow:0 0 0 1px #fff,0 0 0 .2rem rgba(0,123,255,.25)}.custom-range:focus::-ms-thumb{box-shadow:0 0 0 1px #fff,0 0 0 .2rem rgba(0,123,255,.25)}.custom-range::-moz-focus-outer{border:0}.custom-range::-webkit-slider-thumb{width:1rem;height:1rem;margin-top:-.25rem;background-color:#007bff;border:0;border-radius:1rem;-webkit-transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;-webkit-appearance:none;appearance:none}@media (prefers-reduced-motion:reduce){.custom-range::-webkit-slider-thumb{-webkit-transition:none;transition:none}}.custom-range::-webkit-slider-thumb:active{background-color:#b3d7ff}.custom-range::-webkit-slider-runnable-track{width:100%;height:.5rem;color:transparent;cursor:pointer;background-color:#dee2e6;border-color:transparent;border-radius:1rem}.custom-range::-moz-range-thumb{width:1rem;height:1rem;background-color:#007bff;border:0;border-radius:1rem;-moz-transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;-moz-appearance:none;appearance:none}@media (prefers-reduced-motion:reduce){.custom-range::-moz-range-thumb{-moz-transition:none;transition:none}}.custom-range::-moz-range-thumb:active{background-color:#b3d7ff}.custom-range::-moz-range-track{width:100%;height:.5rem;color:transparent;cursor:pointer;background-color:#dee2e6;border-color:transparent;border-radius:1rem}.custom-range::-ms-thumb{width:1rem;height:1rem;margin-top:0;margin-right:.2rem;margin-left:.2rem;background-color:#007bff;border:0;border-radius:1rem;-ms-transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out;appearance:none}@media (prefers-reduced-motion:reduce){.custom-range::-ms-thumb{-ms-transition:none;transition:none}}.custom-range::-ms-thumb:active{background-color:#b3d7ff}.custom-range::-ms-track{width:100%;height:.5rem;color:transparent;cursor:pointer;background-color:transparent;border-color:transparent;border-width:.5rem}.custom-range::-ms-fill-lower{background-color:#dee2e6;border-radius:1rem}.custom-range::-ms-fill-upper{margin-right:15px;background-color:#dee2e6;border-radius:1rem}.custom-range:disabled::-webkit-slider-thumb{background-color:#adb5bd}.custom-range:disabled::-webkit-slider-runnable-track{cursor:default}.custom-range:disabled::-moz-range-thumb{background-color:#adb5bd}.custom-range:disabled::-moz-range-track{cursor:default}.custom-range:disabled::-ms-thumb{background-color:#adb5bd}.custom-control-label::before,.custom-file-label,.custom-select{transition:background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out}@media (prefers-reduced-motion:reduce){.custom-control-label::before,.custom-file-label,.custom-select{transition:none}}.nav{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;padding-left:0;margin-bottom:0;list-style:none}.nav-link{display:block;padding:.5rem 1rem}.nav-link:focus,.nav-link:hover{text-decoration:none}.nav-link.disabled{color:#6c757d;pointer-events:none;cursor:default}.nav-tabs{border-bottom:1px solid #dee2e6}.nav-tabs .nav-link{margin-bottom:-1px;border:1px solid transparent;border-top-left-radius:.25rem;border-top-right-radius:.25rem}.nav-tabs .nav-link:focus,.nav-tabs .nav-link:hover{border-color:#e9ecef #e9ecef #dee2e6}.nav-tabs .nav-link.disabled{color:#6c757d;background-color:transparent;border-color:transparent}.nav-tabs .nav-item.show .nav-link,.nav-tabs .nav-link.active{color:#495057;background-color:#fff;border-color:#dee2e6 #dee2e6 #fff}.nav-tabs .dropdown-menu{margin-top:-1px;border-top-left-radius:0;border-top-right-radius:0}.nav-pills .nav-link{border-radius:.25rem}.nav-pills .nav-link.active,.nav-pills .show>.nav-link{color:#fff;background-color:#007bff}.nav-fill .nav-item,.nav-fill>.nav-link{-ms-flex:1 1 auto;flex:1 1 auto;text-align:center}.nav-justified .nav-item,.nav-justified>.nav-link{-ms-flex-preferred-size:0;flex-basis:0;-ms-flex-positive:1;flex-grow:1;text-align:center}.tab-content>.tab-pane{display:none}.tab-content>.active{display:block}.navbar{position:relative;display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;-ms-flex-align:center;align-items:center;-ms-flex-pack:justify;justify-content:space-between;padding:.5rem 1rem}.navbar .container,.navbar .container-fluid,.navbar .container-lg,.navbar .container-md,.navbar .container-sm,.navbar .container-xl{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;-ms-flex-align:center;align-items:center;-ms-flex-pack:justify;justify-content:space-between}.navbar-brand{display:inline-block;padding-top:.3125rem;padding-bottom:.3125rem;margin-right:1rem;font-size:1.25rem;line-height:inherit;white-space:nowrap}.navbar-brand:focus,.navbar-brand:hover{text-decoration:none}.navbar-nav{display:-ms-flexbox;display:flex;-ms-flex-direction:column;flex-direction:column;padding-left:0;margin-bottom:0;list-style:none}.navbar-nav .nav-link{padding-right:0;padding-left:0}.navbar-nav .dropdown-menu{position:static;float:none}.navbar-text{display:inline-block;padding-top:.5rem;padding-bottom:.5rem}.navbar-collapse{-ms-flex-preferred-size:100%;flex-basis:100%;-ms-flex-positive:1;flex-grow:1;-ms-flex-align:center;align-items:center}.navbar-toggler{padding:.25rem .75rem;font-size:1.25rem;line-height:1;background-color:transparent;border:1px solid transparent;border-radius:.25rem}.navbar-toggler:focus,.navbar-toggler:hover{text-decoration:none}.navbar-toggler-icon{display:inline-block;width:1.5em;height:1.5em;vertical-align:middle;content:"";background:50%/100% 100% no-repeat}.navbar-nav-scroll{max-height:75vh;overflow-y:auto}@media (max-width:575.98px){.navbar-expand-sm>.container,.navbar-expand-sm>.container-fluid,.navbar-expand-sm>.container-lg,.navbar-expand-sm>.container-md,.navbar-expand-sm>.container-sm,.navbar-expand-sm>.container-xl{padding-right:0;padding-left:0}}@media (min-width:576px){.navbar-expand-sm{-ms-flex-flow:row nowrap;flex-flow:row nowrap;-ms-flex-pack:start;justify-content:flex-start}.navbar-expand-sm .navbar-nav{-ms-flex-direction:row;flex-direction:row}.navbar-expand-sm .navbar-nav .dropdown-menu{position:absolute}.navbar-expand-sm .navbar-nav .nav-link{padding-right:.5rem;padding-left:.5rem}.navbar-expand-sm>.container,.navbar-expand-sm>.container-fluid,.navbar-expand-sm>.container-lg,.navbar-expand-sm>.container-md,.navbar-expand-sm>.container-sm,.navbar-expand-sm>.container-xl{-ms-flex-wrap:nowrap;flex-wrap:nowrap}.navbar-expand-sm .navbar-nav-scroll{overflow:visible}.navbar-expand-sm .navbar-collapse{display:-ms-flexbox!important;display:flex!important;-ms-flex-preferred-size:auto;flex-basis:auto}.navbar-expand-sm .navbar-toggler{display:none}}@media (max-width:767.98px){.navbar-expand-md>.container,.navbar-expand-md>.container-fluid,.navbar-expand-md>.container-lg,.navbar-expand-md>.container-md,.navbar-expand-md>.container-sm,.navbar-expand-md>.container-xl{padding-right:0;padding-left:0}}@media (min-width:768px){.navbar-expand-md{-ms-flex-flow:row nowrap;flex-flow:row nowrap;-ms-flex-pack:start;justify-content:flex-start}.navbar-expand-md .navbar-nav{-ms-flex-direction:row;flex-direction:row}.navbar-expand-md .navbar-nav .dropdown-menu{position:absolute}.navbar-expand-md .navbar-nav .nav-link{padding-right:.5rem;padding-left:.5rem}.navbar-expand-md>.container,.navbar-expand-md>.container-fluid,.navbar-expand-md>.container-lg,.navbar-expand-md>.container-md,.navbar-expand-md>.container-sm,.navbar-expand-md>.container-xl{-ms-flex-wrap:nowrap;flex-wrap:nowrap}.navbar-expand-md .navbar-nav-scroll{overflow:visible}.navbar-expand-md .navbar-collapse{display:-ms-flexbox!important;display:flex!important;-ms-flex-preferred-size:auto;flex-basis:auto}.navbar-expand-md .navbar-toggler{display:none}}@media (max-width:991.98px){.navbar-expand-lg>.container,.navbar-expand-lg>.container-fluid,.navbar-expand-lg>.container-lg,.navbar-expand-lg>.container-md,.navbar-expand-lg>.container-sm,.navbar-expand-lg>.container-xl{padding-right:0;padding-left:0}}@media (min-width:992px){.navbar-expand-lg{-ms-flex-flow:row nowrap;flex-flow:row nowrap;-ms-flex-pack:start;justify-content:flex-start}.navbar-expand-lg .navbar-nav{-ms-flex-direction:row;flex-direction:row}.navbar-expand-lg .navbar-nav .dropdown-menu{position:absolute}.navbar-expand-lg .navbar-nav .nav-link{padding-right:.5rem;padding-left:.5rem}.navbar-expand-lg>.container,.navbar-expand-lg>.container-fluid,.navbar-expand-lg>.container-lg,.navbar-expand-lg>.container-md,.navbar-expand-lg>.container-sm,.navbar-expand-lg>.container-xl{-ms-flex-wrap:nowrap;flex-wrap:nowrap}.navbar-expand-lg .navbar-nav-scroll{overflow:visible}.navbar-expand-lg .navbar-collapse{display:-ms-flexbox!important;display:flex!important;-ms-flex-preferred-size:auto;flex-basis:auto}.navbar-expand-lg .navbar-toggler{display:none}}@media (max-width:1199.98px){.navbar-expand-xl>.container,.navbar-expand-xl>.container-fluid,.navbar-expand-xl>.container-lg,.navbar-expand-xl>.container-md,.navbar-expand-xl>.container-sm,.navbar-expand-xl>.container-xl{padding-right:0;padding-left:0}}@media (min-width:1200px){.navbar-expand-xl{-ms-flex-flow:row nowrap;flex-flow:row nowrap;-ms-flex-pack:start;justify-content:flex-start}.navbar-expand-xl .navbar-nav{-ms-flex-direction:row;flex-direction:row}.navbar-expand-xl .navbar-nav .dropdown-menu{position:absolute}.navbar-expand-xl .navbar-nav .nav-link{padding-right:.5rem;padding-left:.5rem}.navbar-expand-xl>.container,.navbar-expand-xl>.container-fluid,.navbar-expand-xl>.container-lg,.navbar-expand-xl>.container-md,.navbar-expand-xl>.container-sm,.navbar-expand-xl>.container-xl{-ms-flex-wrap:nowrap;flex-wrap:nowrap}.navbar-expand-xl .navbar-nav-scroll{overflow:visible}.navbar-expand-xl .navbar-collapse{display:-ms-flexbox!important;display:flex!important;-ms-flex-preferred-size:auto;flex-basis:auto}.navbar-expand-xl .navbar-toggler{display:none}}.navbar-expand{-ms-flex-flow:row nowrap;flex-flow:row nowrap;-ms-flex-pack:start;justify-content:flex-start}.navbar-expand>.container,.navbar-expand>.container-fluid,.navbar-expand>.container-lg,.navbar-expand>.container-md,.navbar-expand>.container-sm,.navbar-expand>.container-xl{padding-right:0;padding-left:0}.navbar-expand .navbar-nav{-ms-flex-direction:row;flex-direction:row}.navbar-expand .navbar-nav .dropdown-menu{position:absolute}.navbar-expand .navbar-nav .nav-link{padding-right:.5rem;padding-left:.5rem}.navbar-expand>.container,.navbar-expand>.container-fluid,.navbar-expand>.container-lg,.navbar-expand>.container-md,.navbar-expand>.container-sm,.navbar-expand>.container-xl{-ms-flex-wrap:nowrap;flex-wrap:nowrap}.navbar-expand .navbar-nav-scroll{overflow:visible}.navbar-expand .navbar-collapse{display:-ms-flexbox!important;display:flex!important;-ms-flex-preferred-size:auto;flex-basis:auto}.navbar-expand .navbar-toggler{display:none}.navbar-light .navbar-brand{color:rgba(0,0,0,.9)}.navbar-light .navbar-brand:focus,.navbar-light .navbar-brand:hover{color:rgba(0,0,0,.9)}.navbar-light .navbar-nav .nav-link{color:rgba(0,0,0,.5)}.navbar-light .navbar-nav .nav-link:focus,.navbar-light .navbar-nav .nav-link:hover{color:rgba(0,0,0,.7)}.navbar-light .navbar-nav .nav-link.disabled{color:rgba(0,0,0,.3)}.navbar-light .navbar-nav .active>.nav-link,.navbar-light .navbar-nav .nav-link.active,.navbar-light .navbar-nav .nav-link.show,.navbar-light .navbar-nav .show>.nav-link{color:rgba(0,0,0,.9)}.navbar-light .navbar-toggler{color:rgba(0,0,0,.5);border-color:rgba(0,0,0,.1)}.navbar-light .navbar-toggler-icon{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='30' height='30' viewBox='0 0 30 30'%3e%3cpath stroke='rgba%280, 0, 0, 0.5%29' stroke-linecap='round' stroke-miterlimit='10' stroke-width='2' d='M4 7h22M4 15h22M4 23h22'/%3e%3c/svg%3e")}.navbar-light .navbar-text{color:rgba(0,0,0,.5)}.navbar-light .navbar-text a{color:rgba(0,0,0,.9)}.navbar-light .navbar-text a:focus,.navbar-light .navbar-text a:hover{color:rgba(0,0,0,.9)}.navbar-dark .navbar-brand{color:#fff}.navbar-dark .navbar-brand:focus,.navbar-dark .navbar-brand:hover{color:#fff}.navbar-dark .navbar-nav .nav-link{color:rgba(255,255,255,.5)}.navbar-dark .navbar-nav .nav-link:focus,.navbar-dark .navbar-nav .nav-link:hover{color:rgba(255,255,255,.75)}.navbar-dark .navbar-nav .nav-link.disabled{color:rgba(255,255,255,.25)}.navbar-dark .navbar-nav .active>.nav-link,.navbar-dark .navbar-nav .nav-link.active,.navbar-dark .navbar-nav .nav-link.show,.navbar-dark .navbar-nav .show>.nav-link{color:#fff}.navbar-dark .navbar-toggler{color:rgba(255,255,255,.5);border-color:rgba(255,255,255,.1)}.navbar-dark .navbar-toggler-icon{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' width='30' height='30' viewBox='0 0 30 30'%3e%3cpath stroke='rgba%28255, 255, 255, 0.5%29' stroke-linecap='round' stroke-miterlimit='10' stroke-width='2' d='M4 7h22M4 15h22M4 23h22'/%3e%3c/svg%3e")}.navbar-dark .navbar-text{color:rgba(255,255,255,.5)}.navbar-dark .navbar-text a{color:#fff}.navbar-dark .navbar-text a:focus,.navbar-dark .navbar-text a:hover{color:#fff}.card{position:relative;display:-ms-flexbox;display:flex;-ms-flex-direction:column;flex-direction:column;min-width:0;word-wrap:break-word;background-color:#fff;background-clip:border-box;border:1px solid rgba(0,0,0,.125);border-radius:.25rem}.card>hr{margin-right:0;margin-left:0}.card>.list-group{border-top:inherit;border-bottom:inherit}.card>.list-group:first-child{border-top-width:0;border-top-left-radius:calc(.25rem - 1px);border-top-right-radius:calc(.25rem - 1px)}.card>.list-group:last-child{border-bottom-width:0;border-bottom-right-radius:calc(.25rem - 1px);border-bottom-left-radius:calc(.25rem - 1px)}.card>.card-header+.list-group,.card>.list-group+.card-footer{border-top:0}.card-body{-ms-flex:1 1 auto;flex:1 1 auto;min-height:1px;padding:1.25rem}.card-title{margin-bottom:.75rem}.card-subtitle{margin-top:-.375rem;margin-bottom:0}.card-text:last-child{margin-bottom:0}.card-link:hover{text-decoration:none}.card-link+.card-link{margin-left:1.25rem}.card-header{padding:.75rem 1.25rem;margin-bottom:0;background-color:rgba(0,0,0,.03);border-bottom:1px solid rgba(0,0,0,.125)}.card-header:first-child{border-radius:calc(.25rem - 1px) calc(.25rem - 1px) 0 0}.card-footer{padding:.75rem 1.25rem;background-color:rgba(0,0,0,.03);border-top:1px solid rgba(0,0,0,.125)}.card-footer:last-child{border-radius:0 0 calc(.25rem - 1px) calc(.25rem - 1px)}.card-header-tabs{margin-right:-.625rem;margin-bottom:-.75rem;margin-left:-.625rem;border-bottom:0}.card-header-pills{margin-right:-.625rem;margin-left:-.625rem}.card-img-overlay{position:absolute;top:0;right:0;bottom:0;left:0;padding:1.25rem;border-radius:calc(.25rem - 1px)}.card-img,.card-img-bottom,.card-img-top{-ms-flex-negative:0;flex-shrink:0;width:100%}.card-img,.card-img-top{border-top-left-radius:calc(.25rem - 1px);border-top-right-radius:calc(.25rem - 1px)}.card-img,.card-img-bottom{border-bottom-right-radius:calc(.25rem - 1px);border-bottom-left-radius:calc(.25rem - 1px)}.card-deck .card{margin-bottom:15px}@media (min-width:576px){.card-deck{display:-ms-flexbox;display:flex;-ms-flex-flow:row wrap;flex-flow:row wrap;margin-right:-15px;margin-left:-15px}.card-deck .card{-ms-flex:1 0 0%;flex:1 0 0%;margin-right:15px;margin-bottom:0;margin-left:15px}}.card-group>.card{margin-bottom:15px}@media (min-width:576px){.card-group{display:-ms-flexbox;display:flex;-ms-flex-flow:row wrap;flex-flow:row wrap}.card-group>.card{-ms-flex:1 0 0%;flex:1 0 0%;margin-bottom:0}.card-group>.card+.card{margin-left:0;border-left:0}.card-group>.card:not(:last-child){border-top-right-radius:0;border-bottom-right-radius:0}.card-group>.card:not(:last-child) .card-header,.card-group>.card:not(:last-child) .card-img-top{border-top-right-radius:0}.card-group>.card:not(:last-child) .card-footer,.card-group>.card:not(:last-child) .card-img-bottom{border-bottom-right-radius:0}.card-group>.card:not(:first-child){border-top-left-radius:0;border-bottom-left-radius:0}.card-group>.card:not(:first-child) .card-header,.card-group>.card:not(:first-child) .card-img-top{border-top-left-radius:0}.card-group>.card:not(:first-child) .card-footer,.card-group>.card:not(:first-child) .card-img-bottom{border-bottom-left-radius:0}}.card-columns .card{margin-bottom:.75rem}@media (min-width:576px){.card-columns{-webkit-column-count:3;-moz-column-count:3;column-count:3;-webkit-column-gap:1.25rem;-moz-column-gap:1.25rem;column-gap:1.25rem;orphans:1;widows:1}.card-columns .card{display:inline-block;width:100%}}.accordion{overflow-anchor:none}.accordion>.card{overflow:hidden}.accordion>.card:not(:last-of-type){border-bottom:0;border-bottom-right-radius:0;border-bottom-left-radius:0}.accordion>.card:not(:first-of-type){border-top-left-radius:0;border-top-right-radius:0}.accordion>.card>.card-header{border-radius:0;margin-bottom:-1px}.breadcrumb{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;padding:.75rem 1rem;margin-bottom:1rem;list-style:none;background-color:#e9ecef;border-radius:.25rem}.breadcrumb-item+.breadcrumb-item{padding-left:.5rem}.breadcrumb-item+.breadcrumb-item::before{float:left;padding-right:.5rem;color:#6c757d;content:"/"}.breadcrumb-item+.breadcrumb-item:hover::before{text-decoration:underline}.breadcrumb-item+.breadcrumb-item:hover::before{text-decoration:none}.breadcrumb-item.active{color:#6c757d}.pagination{display:-ms-flexbox;display:flex;padding-left:0;list-style:none;border-radius:.25rem}.page-link{position:relative;display:block;padding:.5rem .75rem;margin-left:-1px;line-height:1.25;color:#007bff;background-color:#fff;border:1px solid #dee2e6}.page-link:hover{z-index:2;color:#0056b3;text-decoration:none;background-color:#e9ecef;border-color:#dee2e6}.page-link:focus{z-index:3;outline:0;box-shadow:0 0 0 .2rem rgba(0,123,255,.25)}.page-item:first-child .page-link{margin-left:0;border-top-left-radius:.25rem;border-bottom-left-radius:.25rem}.page-item:last-child .page-link{border-top-right-radius:.25rem;border-bottom-right-radius:.25rem}.page-item.active .page-link{z-index:3;color:#fff;background-color:#007bff;border-color:#007bff}.page-item.disabled .page-link{color:#6c757d;pointer-events:none;cursor:auto;background-color:#fff;border-color:#dee2e6}.pagination-lg .page-link{padding:.75rem 1.5rem;font-size:1.25rem;line-height:1.5}.pagination-lg .page-item:first-child .page-link{border-top-left-radius:.3rem;border-bottom-left-radius:.3rem}.pagination-lg .page-item:last-child .page-link{border-top-right-radius:.3rem;border-bottom-right-radius:.3rem}.pagination-sm .page-link{padding:.25rem .5rem;font-size:.875rem;line-height:1.5}.pagination-sm .page-item:first-child .page-link{border-top-left-radius:.2rem;border-bottom-left-radius:.2rem}.pagination-sm .page-item:last-child .page-link{border-top-right-radius:.2rem;border-bottom-right-radius:.2rem}.badge{display:inline-block;padding:.25em .4em;font-size:75%;font-weight:700;line-height:1;text-align:center;white-space:nowrap;vertical-align:baseline;border-radius:.25rem;transition:color .15s ease-in-out,background-color .15s ease-in-out,border-color .15s ease-in-out,box-shadow .15s ease-in-out}@media (prefers-reduced-motion:reduce){.badge{transition:none}}a.badge:focus,a.badge:hover{text-decoration:none}.badge:empty{display:none}.btn .badge{position:relative;top:-1px}.badge-pill{padding-right:.6em;padding-left:.6em;border-radius:10rem}.badge-primary{color:#fff;background-color:#007bff}a.badge-primary:focus,a.badge-primary:hover{color:#fff;background-color:#0062cc}a.badge-primary.focus,a.badge-primary:focus{outline:0;box-shadow:0 0 0 .2rem rgba(0,123,255,.5)}.badge-secondary{color:#fff;background-color:#6c757d}a.badge-secondary:focus,a.badge-secondary:hover{color:#fff;background-color:#545b62}a.badge-secondary.focus,a.badge-secondary:focus{outline:0;box-shadow:0 0 0 .2rem rgba(108,117,125,.5)}.badge-success{color:#fff;background-color:#28a745}a.badge-success:focus,a.badge-success:hover{color:#fff;background-color:#1e7e34}a.badge-success.focus,a.badge-success:focus{outline:0;box-shadow:0 0 0 .2rem rgba(40,167,69,.5)}.badge-info{color:#fff;background-color:#17a2b8}a.badge-info:focus,a.badge-info:hover{color:#fff;background-color:#117a8b}a.badge-info.focus,a.badge-info:focus{outline:0;box-shadow:0 0 0 .2rem rgba(23,162,184,.5)}.badge-warning{color:#212529;background-color:#ffc107}a.badge-warning:focus,a.badge-warning:hover{color:#212529;background-color:#d39e00}a.badge-warning.focus,a.badge-warning:focus{outline:0;box-shadow:0 0 0 .2rem rgba(255,193,7,.5)}.badge-danger{color:#fff;background-color:#dc3545}a.badge-danger:focus,a.badge-danger:hover{color:#fff;background-color:#bd2130}a.badge-danger.focus,a.badge-danger:focus{outline:0;box-shadow:0 0 0 .2rem rgba(220,53,69,.5)}.badge-light{color:#212529;background-color:#f8f9fa}a.badge-light:focus,a.badge-light:hover{color:#212529;background-color:#dae0e5}a.badge-light.focus,a.badge-light:focus{outline:0;box-shadow:0 0 0 .2rem rgba(248,249,250,.5)}.badge-dark{color:#fff;background-color:#343a40}a.badge-dark:focus,a.badge-dark:hover{color:#fff;background-color:#1d2124}a.badge-dark.focus,a.badge-dark:focus{outline:0;box-shadow:0 0 0 .2rem rgba(52,58,64,.5)}.jumbotron{padding:2rem 1rem;margin-bottom:2rem;background-color:#e9ecef;border-radius:.3rem}@media (min-width:576px){.jumbotron{padding:4rem 2rem}}.jumbotron-fluid{padding-right:0;padding-left:0;border-radius:0}.alert{position:relative;padding:.75rem 1.25rem;margin-bottom:1rem;border:1px solid transparent;border-radius:.25rem}.alert-heading{color:inherit}.alert-link{font-weight:700}.alert-dismissible{padding-right:4rem}.alert-dismissible .close{position:absolute;top:0;right:0;z-index:2;padding:.75rem 1.25rem;color:inherit}.alert-primary{color:#004085;background-color:#cce5ff;border-color:#b8daff}.alert-primary hr{border-top-color:#9fcdff}.alert-primary .alert-link{color:#002752}.alert-secondary{color:#383d41;background-color:#e2e3e5;border-color:#d6d8db}.alert-secondary hr{border-top-color:#c8cbcf}.alert-secondary .alert-link{color:#202326}.alert-success{color:#155724;background-color:#d4edda;border-color:#c3e6cb}.alert-success hr{border-top-color:#b1dfbb}.alert-success .alert-link{color:#0b2e13}.alert-info{color:#0c5460;background-color:#d1ecf1;border-color:#bee5eb}.alert-info hr{border-top-color:#abdde5}.alert-info .alert-link{color:#062c33}.alert-warning{color:#856404;background-color:#fff3cd;border-color:#ffeeba}.alert-warning hr{border-top-color:#ffe8a1}.alert-warning .alert-link{color:#533f03}.alert-danger{color:#721c24;background-color:#f8d7da;border-color:#f5c6cb}.alert-danger hr{border-top-color:#f1b0b7}.alert-danger .alert-link{color:#491217}.alert-light{color:#818182;background-color:#fefefe;border-color:#fdfdfe}.alert-light hr{border-top-color:#ececf6}.alert-light .alert-link{color:#686868}.alert-dark{color:#1b1e21;background-color:#d6d8d9;border-color:#c6c8ca}.alert-dark hr{border-top-color:#b9bbbe}.alert-dark .alert-link{color:#040505}@-webkit-keyframes progress-bar-stripes{from{background-position:1rem 0}to{background-position:0 0}}@keyframes progress-bar-stripes{from{background-position:1rem 0}to{background-position:0 0}}.progress{display:-ms-flexbox;display:flex;height:1rem;overflow:hidden;line-height:0;font-size:.75rem;background-color:#e9ecef;border-radius:.25rem}.progress-bar{display:-ms-flexbox;display:flex;-ms-flex-direction:column;flex-direction:column;-ms-flex-pack:center;justify-content:center;overflow:hidden;color:#fff;text-align:center;white-space:nowrap;background-color:#007bff;transition:width .6s ease}@media (prefers-reduced-motion:reduce){.progress-bar{transition:none}}.progress-bar-striped{background-image:linear-gradient(45deg,rgba(255,255,255,.15) 25%,transparent 25%,transparent 50%,rgba(255,255,255,.15) 50%,rgba(255,255,255,.15) 75%,transparent 75%,transparent);background-size:1rem 1rem}.progress-bar-animated{-webkit-animation:1s linear infinite progress-bar-stripes;animation:1s linear infinite progress-bar-stripes}@media (prefers-reduced-motion:reduce){.progress-bar-animated{-webkit-animation:none;animation:none}}.media{display:-ms-flexbox;display:flex;-ms-flex-align:start;align-items:flex-start}.media-body{-ms-flex:1;flex:1}.list-group{display:-ms-flexbox;display:flex;-ms-flex-direction:column;flex-direction:column;padding-left:0;margin-bottom:0;border-radius:.25rem}.list-group-item-action{width:100%;color:#495057;text-align:inherit}.list-group-item-action:focus,.list-group-item-action:hover{z-index:1;color:#495057;text-decoration:none;background-color:#f8f9fa}.list-group-item-action:active{color:#212529;background-color:#e9ecef}.list-group-item{position:relative;display:block;padding:.75rem 1.25rem;background-color:#fff;border:1px solid rgba(0,0,0,.125)}.list-group-item:first-child{border-top-left-radius:inherit;border-top-right-radius:inherit}.list-group-item:last-child{border-bottom-right-radius:inherit;border-bottom-left-radius:inherit}.list-group-item.disabled,.list-group-item:disabled{color:#6c757d;pointer-events:none;background-color:#fff}.list-group-item.active{z-index:2;color:#fff;background-color:#007bff;border-color:#007bff}.list-group-item+.list-group-item{border-top-width:0}.list-group-item+.list-group-item.active{margin-top:-1px;border-top-width:1px}.list-group-horizontal{-ms-flex-direction:row;flex-direction:row}.list-group-horizontal>.list-group-item:first-child{border-bottom-left-radius:.25rem;border-top-right-radius:0}.list-group-horizontal>.list-group-item:last-child{border-top-right-radius:.25rem;border-bottom-left-radius:0}.list-group-horizontal>.list-group-item.active{margin-top:0}.list-group-horizontal>.list-group-item+.list-group-item{border-top-width:1px;border-left-width:0}.list-group-horizontal>.list-group-item+.list-group-item.active{margin-left:-1px;border-left-width:1px}@media (min-width:576px){.list-group-horizontal-sm{-ms-flex-direction:row;flex-direction:row}.list-group-horizontal-sm>.list-group-item:first-child{border-bottom-left-radius:.25rem;border-top-right-radius:0}.list-group-horizontal-sm>.list-group-item:last-child{border-top-right-radius:.25rem;border-bottom-left-radius:0}.list-group-horizontal-sm>.list-group-item.active{margin-top:0}.list-group-horizontal-sm>.list-group-item+.list-group-item{border-top-width:1px;border-left-width:0}.list-group-horizontal-sm>.list-group-item+.list-group-item.active{margin-left:-1px;border-left-width:1px}}@media (min-width:768px){.list-group-horizontal-md{-ms-flex-direction:row;flex-direction:row}.list-group-horizontal-md>.list-group-item:first-child{border-bottom-left-radius:.25rem;border-top-right-radius:0}.list-group-horizontal-md>.list-group-item:last-child{border-top-right-radius:.25rem;border-bottom-left-radius:0}.list-group-horizontal-md>.list-group-item.active{margin-top:0}.list-group-horizontal-md>.list-group-item+.list-group-item{border-top-width:1px;border-left-width:0}.list-group-horizontal-md>.list-group-item+.list-group-item.active{margin-left:-1px;border-left-width:1px}}@media (min-width:992px){.list-group-horizontal-lg{-ms-flex-direction:row;flex-direction:row}.list-group-horizontal-lg>.list-group-item:first-child{border-bottom-left-radius:.25rem;border-top-right-radius:0}.list-group-horizontal-lg>.list-group-item:last-child{border-top-right-radius:.25rem;border-bottom-left-radius:0}.list-group-horizontal-lg>.list-group-item.active{margin-top:0}.list-group-horizontal-lg>.list-group-item+.list-group-item{border-top-width:1px;border-left-width:0}.list-group-horizontal-lg>.list-group-item+.list-group-item.active{margin-left:-1px;border-left-width:1px}}@media (min-width:1200px){.list-group-horizontal-xl{-ms-flex-direction:row;flex-direction:row}.list-group-horizontal-xl>.list-group-item:first-child{border-bottom-left-radius:.25rem;border-top-right-radius:0}.list-group-horizontal-xl>.list-group-item:last-child{border-top-right-radius:.25rem;border-bottom-left-radius:0}.list-group-horizontal-xl>.list-group-item.active{margin-top:0}.list-group-horizontal-xl>.list-group-item+.list-group-item{border-top-width:1px;border-left-width:0}.list-group-horizontal-xl>.list-group-item+.list-group-item.active{margin-left:-1px;border-left-width:1px}}.list-group-flush{border-radius:0}.list-group-flush>.list-group-item{border-width:0 0 1px}.list-group-flush>.list-group-item:last-child{border-bottom-width:0}.list-group-item-primary{color:#004085;background-color:#b8daff}.list-group-item-primary.list-group-item-action:focus,.list-group-item-primary.list-group-item-action:hover{color:#004085;background-color:#9fcdff}.list-group-item-primary.list-group-item-action.active{color:#fff;background-color:#004085;border-color:#004085}.list-group-item-secondary{color:#383d41;background-color:#d6d8db}.list-group-item-secondary.list-group-item-action:focus,.list-group-item-secondary.list-group-item-action:hover{color:#383d41;background-color:#c8cbcf}.list-group-item-secondary.list-group-item-action.active{color:#fff;background-color:#383d41;border-color:#383d41}.list-group-item-success{color:#155724;background-color:#c3e6cb}.list-group-item-success.list-group-item-action:focus,.list-group-item-success.list-group-item-action:hover{color:#155724;background-color:#b1dfbb}.list-group-item-success.list-group-item-action.active{color:#fff;background-color:#155724;border-color:#155724}.list-group-item-info{color:#0c5460;background-color:#bee5eb}.list-group-item-info.list-group-item-action:focus,.list-group-item-info.list-group-item-action:hover{color:#0c5460;background-color:#abdde5}.list-group-item-info.list-group-item-action.active{color:#fff;background-color:#0c5460;border-color:#0c5460}.list-group-item-warning{color:#856404;background-color:#ffeeba}.list-group-item-warning.list-group-item-action:focus,.list-group-item-warning.list-group-item-action:hover{color:#856404;background-color:#ffe8a1}.list-group-item-warning.list-group-item-action.active{color:#fff;background-color:#856404;border-color:#856404}.list-group-item-danger{color:#721c24;background-color:#f5c6cb}.list-group-item-danger.list-group-item-action:focus,.list-group-item-danger.list-group-item-action:hover{color:#721c24;background-color:#f1b0b7}.list-group-item-danger.list-group-item-action.active{color:#fff;background-color:#721c24;border-color:#721c24}.list-group-item-light{color:#818182;background-color:#fdfdfe}.list-group-item-light.list-group-item-action:focus,.list-group-item-light.list-group-item-action:hover{color:#818182;background-color:#ececf6}.list-group-item-light.list-group-item-action.active{color:#fff;background-color:#818182;border-color:#818182}.list-group-item-dark{color:#1b1e21;background-color:#c6c8ca}.list-group-item-dark.list-group-item-action:focus,.list-group-item-dark.list-group-item-action:hover{color:#1b1e21;background-color:#b9bbbe}.list-group-item-dark.list-group-item-action.active{color:#fff;background-color:#1b1e21;border-color:#1b1e21}.close{float:right;font-size:1.5rem;font-weight:700;line-height:1;color:#000;text-shadow:0 1px 0 #fff;opacity:.5}.close:hover{color:#000;text-decoration:none}.close:not(:disabled):not(.disabled):focus,.close:not(:disabled):not(.disabled):hover{opacity:.75}button.close{padding:0;background-color:transparent;border:0}a.close.disabled{pointer-events:none}.toast{-ms-flex-preferred-size:350px;flex-basis:350px;max-width:350px;font-size:.875rem;background-color:rgba(255,255,255,.85);background-clip:padding-box;border:1px solid rgba(0,0,0,.1);box-shadow:0 .25rem .75rem rgba(0,0,0,.1);opacity:0;border-radius:.25rem}.toast:not(:last-child){margin-bottom:.75rem}.toast.showing{opacity:1}.toast.show{display:block;opacity:1}.toast.hide{display:none}.toast-header{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;padding:.25rem .75rem;color:#6c757d;background-color:rgba(255,255,255,.85);background-clip:padding-box;border-bottom:1px solid rgba(0,0,0,.05);border-top-left-radius:calc(.25rem - 1px);border-top-right-radius:calc(.25rem - 1px)}.toast-body{padding:.75rem}.modal-open{overflow:hidden}.modal-open .modal{overflow-x:hidden;overflow-y:auto}.modal{position:fixed;top:0;left:0;z-index:1050;display:none;width:100%;height:100%;overflow:hidden;outline:0}.modal-dialog{position:relative;width:auto;margin:.5rem;pointer-events:none}.modal.fade .modal-dialog{transition:-webkit-transform .3s ease-out;transition:transform .3s ease-out;transition:transform .3s ease-out,-webkit-transform .3s ease-out;-webkit-transform:translate(0,-50px);transform:translate(0,-50px)}@media (prefers-reduced-motion:reduce){.modal.fade .modal-dialog{transition:none}}.modal.show .modal-dialog{-webkit-transform:none;transform:none}.modal.modal-static .modal-dialog{-webkit-transform:scale(1.02);transform:scale(1.02)}.modal-dialog-scrollable{display:-ms-flexbox;display:flex;max-height:calc(100% - 1rem)}.modal-dialog-scrollable .modal-content{max-height:calc(100vh - 1rem);overflow:hidden}.modal-dialog-scrollable .modal-footer,.modal-dialog-scrollable .modal-header{-ms-flex-negative:0;flex-shrink:0}.modal-dialog-scrollable .modal-body{overflow-y:auto}.modal-dialog-centered{display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;min-height:calc(100% - 1rem)}.modal-dialog-centered::before{display:block;height:calc(100vh - 1rem);height:-webkit-min-content;height:-moz-min-content;height:min-content;content:""}.modal-dialog-centered.modal-dialog-scrollable{-ms-flex-direction:column;flex-direction:column;-ms-flex-pack:center;justify-content:center;height:100%}.modal-dialog-centered.modal-dialog-scrollable .modal-content{max-height:none}.modal-dialog-centered.modal-dialog-scrollable::before{content:none}.modal-content{position:relative;display:-ms-flexbox;display:flex;-ms-flex-direction:column;flex-direction:column;width:100%;pointer-events:auto;background-color:#fff;background-clip:padding-box;border:1px solid rgba(0,0,0,.2);border-radius:.3rem;outline:0}.modal-backdrop{position:fixed;top:0;left:0;z-index:1040;width:100vw;height:100vh;background-color:#000}.modal-backdrop.fade{opacity:0}.modal-backdrop.show{opacity:.5}.modal-header{display:-ms-flexbox;display:flex;-ms-flex-align:start;align-items:flex-start;-ms-flex-pack:justify;justify-content:space-between;padding:1rem 1rem;border-bottom:1px solid #dee2e6;border-top-left-radius:calc(.3rem - 1px);border-top-right-radius:calc(.3rem - 1px)}.modal-header .close{padding:1rem 1rem;margin:-1rem -1rem -1rem auto}.modal-title{margin-bottom:0;line-height:1.5}.modal-body{position:relative;-ms-flex:1 1 auto;flex:1 1 auto;padding:1rem}.modal-footer{display:-ms-flexbox;display:flex;-ms-flex-wrap:wrap;flex-wrap:wrap;-ms-flex-align:center;align-items:center;-ms-flex-pack:end;justify-content:flex-end;padding:.75rem;border-top:1px solid #dee2e6;border-bottom-right-radius:calc(.3rem - 1px);border-bottom-left-radius:calc(.3rem - 1px)}.modal-footer>*{margin:.25rem}.modal-scrollbar-measure{position:absolute;top:-9999px;width:50px;height:50px;overflow:scroll}@media (min-width:576px){.modal-dialog{max-width:500px;margin:1.75rem auto}.modal-dialog-scrollable{max-height:calc(100% - 3.5rem)}.modal-dialog-scrollable .modal-content{max-height:calc(100vh - 3.5rem)}.modal-dialog-centered{min-height:calc(100% - 3.5rem)}.modal-dialog-centered::before{height:calc(100vh - 3.5rem);height:-webkit-min-content;height:-moz-min-content;height:min-content}.modal-sm{max-width:300px}}@media (min-width:992px){.modal-lg,.modal-xl{max-width:800px}}@media (min-width:1200px){.modal-xl{max-width:1140px}}.tooltip{position:absolute;z-index:1070;display:block;margin:0;font-family:-apple-system,BlinkMacSystemFont,"Segoe UI",Roboto,"Helvetica Neue",Arial,"Noto Sans","Liberation Sans",sans-serif,"Apple Color Emoji","Segoe UI Emoji","Segoe UI Symbol","Noto Color Emoji";font-style:normal;font-weight:400;line-height:1.5;text-align:left;text-align:start;text-decoration:none;text-shadow:none;text-transform:none;letter-spacing:normal;word-break:normal;word-spacing:normal;white-space:normal;line-break:auto;font-size:.875rem;word-wrap:break-word;opacity:0}.tooltip.show{opacity:.9}.tooltip .arrow{position:absolute;display:block;width:.8rem;height:.4rem}.tooltip .arrow::before{position:absolute;content:"";border-color:transparent;border-style:solid}.bs-tooltip-auto[x-placement^=top],.bs-tooltip-top{padding:.4rem 0}.bs-tooltip-auto[x-placement^=top] .arrow,.bs-tooltip-top .arrow{bottom:0}.bs-tooltip-auto[x-placement^=top] .arrow::before,.bs-tooltip-top .arrow::before{top:0;border-width:.4rem .4rem 0;border-top-color:#000}.bs-tooltip-auto[x-placement^=right],.bs-tooltip-right{padding:0 .4rem}.bs-tooltip-auto[x-placement^=right] .arrow,.bs-tooltip-right .arrow{left:0;width:.4rem;height:.8rem}.bs-tooltip-auto[x-placement^=right] .arrow::before,.bs-tooltip-right .arrow::before{right:0;border-width:.4rem .4rem .4rem 0;border-right-color:#000}.bs-tooltip-auto[x-placement^=bottom],.bs-tooltip-bottom{padding:.4rem 0}.bs-tooltip-auto[x-placement^=bottom] .arrow,.bs-tooltip-bottom .arrow{top:0}.bs-tooltip-auto[x-placement^=bottom] .arrow::before,.bs-tooltip-bottom .arrow::before{bottom:0;border-width:0 .4rem .4rem;border-bottom-color:#000}.bs-tooltip-auto[x-placement^=left],.bs-tooltip-left{padding:0 .4rem}.bs-tooltip-auto[x-placement^=left] .arrow,.bs-tooltip-left .arrow{right:0;width:.4rem;height:.8rem}.bs-tooltip-auto[x-placement^=left] .arrow::before,.bs-tooltip-left .arrow::before{left:0;border-width:.4rem 0 .4rem .4rem;border-left-color:#000}.tooltip-inner{max-width:200px;padding:.25rem .5rem;color:#fff;text-align:center;background-color:#000;border-radius:.25rem}.popover{position:absolute;top:0;left:0;z-index:1060;display:block;max-width:276px;font-family:-apple-system,BlinkMacSystemFont,"Segoe UI",Roboto,"Helvetica Neue",Arial,"Noto Sans","Liberation Sans",sans-serif,"Apple Color Emoji","Segoe UI Emoji","Segoe UI Symbol","Noto Color Emoji";font-style:normal;font-weight:400;line-height:1.5;text-align:left;text-align:start;text-decoration:none;text-shadow:none;text-transform:none;letter-spacing:normal;word-break:normal;word-spacing:normal;white-space:normal;line-break:auto;font-size:.875rem;word-wrap:break-word;background-color:#fff;background-clip:padding-box;border:1px solid rgba(0,0,0,.2);border-radius:.3rem}.popover .arrow{position:absolute;display:block;width:1rem;height:.5rem;margin:0 .3rem}.popover .arrow::after,.popover .arrow::before{position:absolute;display:block;content:"";border-color:transparent;border-style:solid}.bs-popover-auto[x-placement^=top],.bs-popover-top{margin-bottom:.5rem}.bs-popover-auto[x-placement^=top]>.arrow,.bs-popover-top>.arrow{bottom:calc(-.5rem - 1px)}.bs-popover-auto[x-placement^=top]>.arrow::before,.bs-popover-top>.arrow::before{bottom:0;border-width:.5rem .5rem 0;border-top-color:rgba(0,0,0,.25)}.bs-popover-auto[x-placement^=top]>.arrow::after,.bs-popover-top>.arrow::after{bottom:1px;border-width:.5rem .5rem 0;border-top-color:#fff}.bs-popover-auto[x-placement^=right],.bs-popover-right{margin-left:.5rem}.bs-popover-auto[x-placement^=right]>.arrow,.bs-popover-right>.arrow{left:calc(-.5rem - 1px);width:.5rem;height:1rem;margin:.3rem 0}.bs-popover-auto[x-placement^=right]>.arrow::before,.bs-popover-right>.arrow::before{left:0;border-width:.5rem .5rem .5rem 0;border-right-color:rgba(0,0,0,.25)}.bs-popover-auto[x-placement^=right]>.arrow::after,.bs-popover-right>.arrow::after{left:1px;border-width:.5rem .5rem .5rem 0;border-right-color:#fff}.bs-popover-auto[x-placement^=bottom],.bs-popover-bottom{margin-top:.5rem}.bs-popover-auto[x-placement^=bottom]>.arrow,.bs-popover-bottom>.arrow{top:calc(-.5rem - 1px)}.bs-popover-auto[x-placement^=bottom]>.arrow::before,.bs-popover-bottom>.arrow::before{top:0;border-width:0 .5rem .5rem .5rem;border-bottom-color:rgba(0,0,0,.25)}.bs-popover-auto[x-placement^=bottom]>.arrow::after,.bs-popover-bottom>.arrow::after{top:1px;border-width:0 .5rem .5rem .5rem;border-bottom-color:#fff}.bs-popover-auto[x-placement^=bottom] .popover-header::before,.bs-popover-bottom .popover-header::before{position:absolute;top:0;left:50%;display:block;width:1rem;margin-left:-.5rem;content:"";border-bottom:1px solid #f7f7f7}.bs-popover-auto[x-placement^=left],.bs-popover-left{margin-right:.5rem}.bs-popover-auto[x-placement^=left]>.arrow,.bs-popover-left>.arrow{right:calc(-.5rem - 1px);width:.5rem;height:1rem;margin:.3rem 0}.bs-popover-auto[x-placement^=left]>.arrow::before,.bs-popover-left>.arrow::before{right:0;border-width:.5rem 0 .5rem .5rem;border-left-color:rgba(0,0,0,.25)}.bs-popover-auto[x-placement^=left]>.arrow::after,.bs-popover-left>.arrow::after{right:1px;border-width:.5rem 0 .5rem .5rem;border-left-color:#fff}.popover-header{padding:.5rem .75rem;margin-bottom:0;font-size:1rem;background-color:#f7f7f7;border-bottom:1px solid #ebebeb;border-top-left-radius:calc(.3rem - 1px);border-top-right-radius:calc(.3rem - 1px)}.popover-header:empty{display:none}.popover-body{padding:.5rem .75rem;color:#212529}.carousel{position:relative}.carousel.pointer-event{-ms-touch-action:pan-y;touch-action:pan-y}.carousel-inner{position:relative;width:100%;overflow:hidden}.carousel-inner::after{display:block;clear:both;content:""}.carousel-item{position:relative;display:none;float:left;width:100%;margin-right:-100%;-webkit-backface-visibility:hidden;backface-visibility:hidden;transition:-webkit-transform .6s ease-in-out;transition:transform .6s ease-in-out;transition:transform .6s ease-in-out,-webkit-transform .6s ease-in-out}@media (prefers-reduced-motion:reduce){.carousel-item{transition:none}}.carousel-item-next,.carousel-item-prev,.carousel-item.active{display:block}.active.carousel-item-right,.carousel-item-next:not(.carousel-item-left){-webkit-transform:translateX(100%);transform:translateX(100%)}.active.carousel-item-left,.carousel-item-prev:not(.carousel-item-right){-webkit-transform:translateX(-100%);transform:translateX(-100%)}.carousel-fade .carousel-item{opacity:0;transition-property:opacity;-webkit-transform:none;transform:none}.carousel-fade .carousel-item-next.carousel-item-left,.carousel-fade .carousel-item-prev.carousel-item-right,.carousel-fade .carousel-item.active{z-index:1;opacity:1}.carousel-fade .active.carousel-item-left,.carousel-fade .active.carousel-item-right{z-index:0;opacity:0;transition:opacity 0s .6s}@media (prefers-reduced-motion:reduce){.carousel-fade .active.carousel-item-left,.carousel-fade .active.carousel-item-right{transition:none}}.carousel-control-next,.carousel-control-prev{position:absolute;top:0;bottom:0;z-index:1;display:-ms-flexbox;display:flex;-ms-flex-align:center;align-items:center;-ms-flex-pack:center;justify-content:center;width:15%;color:#fff;text-align:center;opacity:.5;transition:opacity .15s ease}@media (prefers-reduced-motion:reduce){.carousel-control-next,.carousel-control-prev{transition:none}}.carousel-control-next:focus,.carousel-control-next:hover,.carousel-control-prev:focus,.carousel-control-prev:hover{color:#fff;text-decoration:none;outline:0;opacity:.9}.carousel-control-prev{left:0}.carousel-control-next{right:0}.carousel-control-next-icon,.carousel-control-prev-icon{display:inline-block;width:20px;height:20px;background:50%/100% 100% no-repeat}.carousel-control-prev-icon{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' fill='%23fff' width='8' height='8' viewBox='0 0 8 8'%3e%3cpath d='M5.25 0l-4 4 4 4 1.5-1.5L4.25 4l2.5-2.5L5.25 0z'/%3e%3c/svg%3e")}.carousel-control-next-icon{background-image:url("data:image/svg+xml,%3csvg xmlns='http://www.w3.org/2000/svg' fill='%23fff' width='8' height='8' viewBox='0 0 8 8'%3e%3cpath d='M2.75 0l-1.5 1.5L3.75 4l-2.5 2.5L2.75 8l4-4-4-4z'/%3e%3c/svg%3e")}.carousel-indicators{position:absolute;right:0;bottom:0;left:0;z-index:15;display:-ms-flexbox;display:flex;-ms-flex-pack:center;justify-content:center;padding-left:0;margin-right:15%;margin-left:15%;list-style:none}.carousel-indicators li{box-sizing:content-box;-ms-flex:0 1 auto;flex:0 1 auto;width:30px;height:3px;margin-right:3px;margin-left:3px;text-indent:-999px;cursor:pointer;background-color:#fff;background-clip:padding-box;border-top:10px solid transparent;border-bottom:10px solid transparent;opacity:.5;transition:opacity .6s ease}@media (prefers-reduced-motion:reduce){.carousel-indicators li{transition:none}}.carousel-indicators .active{opacity:1}.carousel-caption{position:absolute;right:15%;bottom:20px;left:15%;z-index:10;padding-top:20px;padding-bottom:20px;color:#fff;text-align:center}@-webkit-keyframes spinner-border{to{-webkit-transform:rotate(360deg);transform:rotate(360deg)}}@keyframes spinner-border{to{-webkit-transform:rotate(360deg);transform:rotate(360deg)}}.spinner-border{display:inline-block;width:2rem;height:2rem;vertical-align:text-bottom;border:.25em solid currentColor;border-right-color:transparent;border-radius:50%;-webkit-animation:.75s linear infinite spinner-border;animation:.75s linear infinite spinner-border}.spinner-border-sm{width:1rem;height:1rem;border-width:.2em}@-webkit-keyframes spinner-grow{0%{-webkit-transform:scale(0);transform:scale(0)}50%{opacity:1;-webkit-transform:none;transform:none}}@keyframes spinner-grow{0%{-webkit-transform:scale(0);transform:scale(0)}50%{opacity:1;-webkit-transform:none;transform:none}}.spinner-grow{display:inline-block;width:2rem;height:2rem;vertical-align:text-bottom;background-color:currentColor;border-radius:50%;opacity:0;-webkit-animation:.75s linear infinite spinner-grow;animation:.75s linear infinite spinner-grow}.spinner-grow-sm{width:1rem;height:1rem}@media (prefers-reduced-motion:reduce){.spinner-border,.spinner-grow{-webkit-animation-duration:1.5s;animation-duration:1.5s}}.align-baseline{vertical-align:baseline!important}.align-top{vertical-align:top!important}.align-middle{vertical-align:middle!important}.align-bottom{vertical-align:bottom!important}.align-text-bottom{vertical-align:text-bottom!important}.align-text-top{vertical-align:text-top!important}.bg-primary{background-color:#007bff!important}a.bg-primary:focus,a.bg-primary:hover,button.bg-primary:focus,button.bg-primary:hover{background-color:#0062cc!important}.bg-secondary{background-color:#6c757d!important}a.bg-secondary:focus,a.bg-secondary:hover,button.bg-secondary:focus,button.bg-secondary:hover{background-color:#545b62!important}.bg-success{background-color:#28a745!important}a.bg-success:focus,a.bg-success:hover,button.bg-success:focus,button.bg-success:hover{background-color:#1e7e34!important}.bg-info{background-color:#17a2b8!important}a.bg-info:focus,a.bg-info:hover,button.bg-info:focus,button.bg-info:hover{background-color:#117a8b!important}.bg-warning{background-color:#ffc107!important}a.bg-warning:focus,a.bg-warning:hover,button.bg-warning:focus,button.bg-warning:hover{background-color:#d39e00!important}.bg-danger{background-color:#dc3545!important}a.bg-danger:focus,a.bg-danger:hover,button.bg-danger:focus,button.bg-danger:hover{background-color:#bd2130!important}.bg-light{background-color:#f8f9fa!important}a.bg-light:focus,a.bg-light:hover,button.bg-light:focus,button.bg-light:hover{background-color:#dae0e5!important}.bg-dark{background-color:#343a40!important}a.bg-dark:focus,a.bg-dark:hover,button.bg-dark:focus,button.bg-dark:hover{background-color:#1d2124!important}.bg-white{background-color:#fff!important}.bg-transparent{background-color:transparent!important}.border{border:1px solid #dee2e6!important}.border-top{border-top:1px solid #dee2e6!important}.border-right{border-right:1px solid #dee2e6!important}.border-bottom{border-bottom:1px solid #dee2e6!important}.border-left{border-left:1px solid #dee2e6!important}.border-0{border:0!important}.border-top-0{border-top:0!important}.border-right-0{border-right:0!important}.border-bottom-0{border-bottom:0!important}.border-left-0{border-left:0!important}.border-primary{border-color:#007bff!important}.border-secondary{border-color:#6c757d!important}.border-success{border-color:#28a745!important}.border-info{border-color:#17a2b8!important}.border-warning{border-color:#ffc107!important}.border-danger{border-color:#dc3545!important}.border-light{border-color:#f8f9fa!important}.border-dark{border-color:#343a40!important}.border-white{border-color:#fff!important}.rounded-sm{border-radius:.2rem!important}.rounded{border-radius:.25rem!important}.rounded-top{border-top-left-radius:.25rem!important;border-top-right-radius:.25rem!important}.rounded-right{border-top-right-radius:.25rem!important;border-bottom-right-radius:.25rem!important}.rounded-bottom{border-bottom-right-radius:.25rem!important;border-bottom-left-radius:.25rem!important}.rounded-left{border-top-left-radius:.25rem!important;border-bottom-left-radius:.25rem!important}.rounded-lg{border-radius:.3rem!important}.rounded-circle{border-radius:50%!important}.rounded-pill{border-radius:50rem!important}.rounded-0{border-radius:0!important}.clearfix::after{display:block;clear:both;content:""}.d-none{display:none!important}.d-inline{display:inline!important}.d-inline-block{display:inline-block!important}.d-block{display:block!important}.d-table{display:table!important}.d-table-row{display:table-row!important}.d-table-cell{display:table-cell!important}.d-flex{display:-ms-flexbox!important;display:flex!important}.d-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}@media (min-width:576px){.d-sm-none{display:none!important}.d-sm-inline{display:inline!important}.d-sm-inline-block{display:inline-block!important}.d-sm-block{display:block!important}.d-sm-table{display:table!important}.d-sm-table-row{display:table-row!important}.d-sm-table-cell{display:table-cell!important}.d-sm-flex{display:-ms-flexbox!important;display:flex!important}.d-sm-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}}@media (min-width:768px){.d-md-none{display:none!important}.d-md-inline{display:inline!important}.d-md-inline-block{display:inline-block!important}.d-md-block{display:block!important}.d-md-table{display:table!important}.d-md-table-row{display:table-row!important}.d-md-table-cell{display:table-cell!important}.d-md-flex{display:-ms-flexbox!important;display:flex!important}.d-md-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}}@media (min-width:992px){.d-lg-none{display:none!important}.d-lg-inline{display:inline!important}.d-lg-inline-block{display:inline-block!important}.d-lg-block{display:block!important}.d-lg-table{display:table!important}.d-lg-table-row{display:table-row!important}.d-lg-table-cell{display:table-cell!important}.d-lg-flex{display:-ms-flexbox!important;display:flex!important}.d-lg-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}}@media (min-width:1200px){.d-xl-none{display:none!important}.d-xl-inline{display:inline!important}.d-xl-inline-block{display:inline-block!important}.d-xl-block{display:block!important}.d-xl-table{display:table!important}.d-xl-table-row{display:table-row!important}.d-xl-table-cell{display:table-cell!important}.d-xl-flex{display:-ms-flexbox!important;display:flex!important}.d-xl-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}}@media print{.d-print-none{display:none!important}.d-print-inline{display:inline!important}.d-print-inline-block{display:inline-block!important}.d-print-block{display:block!important}.d-print-table{display:table!important}.d-print-table-row{display:table-row!important}.d-print-table-cell{display:table-cell!important}.d-print-flex{display:-ms-flexbox!important;display:flex!important}.d-print-inline-flex{display:-ms-inline-flexbox!important;display:inline-flex!important}}.embed-responsive{position:relative;display:block;width:100%;padding:0;overflow:hidden}.embed-responsive::before{display:block;content:""}.embed-responsive .embed-responsive-item,.embed-responsive embed,.embed-responsive iframe,.embed-responsive object,.embed-responsive video{position:absolute;top:0;bottom:0;left:0;width:100%;height:100%;border:0}.embed-responsive-21by9::before{padding-top:42.857143%}.embed-responsive-16by9::before{padding-top:56.25%}.embed-responsive-4by3::before{padding-top:75%}.embed-responsive-1by1::before{padding-top:100%}.flex-row{-ms-flex-direction:row!important;flex-direction:row!important}.flex-column{-ms-flex-direction:column!important;flex-direction:column!important}.flex-row-reverse{-ms-flex-direction:row-reverse!important;flex-direction:row-reverse!important}.flex-column-reverse{-ms-flex-direction:column-reverse!important;flex-direction:column-reverse!important}.flex-wrap{-ms-flex-wrap:wrap!important;flex-wrap:wrap!important}.flex-nowrap{-ms-flex-wrap:nowrap!important;flex-wrap:nowrap!important}.flex-wrap-reverse{-ms-flex-wrap:wrap-reverse!important;flex-wrap:wrap-reverse!important}.flex-fill{-ms-flex:1 1 auto!important;flex:1 1 auto!important}.flex-grow-0{-ms-flex-positive:0!important;flex-grow:0!important}.flex-grow-1{-ms-flex-positive:1!important;flex-grow:1!important}.flex-shrink-0{-ms-flex-negative:0!important;flex-shrink:0!important}.flex-shrink-1{-ms-flex-negative:1!important;flex-shrink:1!important}.justify-content-start{-ms-flex-pack:start!important;justify-content:flex-start!important}.justify-content-end{-ms-flex-pack:end!important;justify-content:flex-end!important}.justify-content-center{-ms-flex-pack:center!important;justify-content:center!important}.justify-content-between{-ms-flex-pack:justify!important;justify-content:space-between!important}.justify-content-around{-ms-flex-pack:distribute!important;justify-content:space-around!important}.align-items-start{-ms-flex-align:start!important;align-items:flex-start!important}.align-items-end{-ms-flex-align:end!important;align-items:flex-end!important}.align-items-center{-ms-flex-align:center!important;align-items:center!important}.align-items-baseline{-ms-flex-align:baseline!important;align-items:baseline!important}.align-items-stretch{-ms-flex-align:stretch!important;align-items:stretch!important}.align-content-start{-ms-flex-line-pack:start!important;align-content:flex-start!important}.align-content-end{-ms-flex-line-pack:end!important;align-content:flex-end!important}.align-content-center{-ms-flex-line-pack:center!important;align-content:center!important}.align-content-between{-ms-flex-line-pack:justify!important;align-content:space-between!important}.align-content-around{-ms-flex-line-pack:distribute!important;align-content:space-around!important}.align-content-stretch{-ms-flex-line-pack:stretch!important;align-content:stretch!important}.align-self-auto{-ms-flex-item-align:auto!important;align-self:auto!important}.align-self-start{-ms-flex-item-align:start!important;align-self:flex-start!important}.align-self-end{-ms-flex-item-align:end!important;align-self:flex-end!important}.align-self-center{-ms-flex-item-align:center!important;align-self:center!important}.align-self-baseline{-ms-flex-item-align:baseline!important;align-self:baseline!important}.align-self-stretch{-ms-flex-item-align:stretch!important;align-self:stretch!important}@media (min-width:576px){.flex-sm-row{-ms-flex-direction:row!important;flex-direction:row!important}.flex-sm-column{-ms-flex-direction:column!important;flex-direction:column!important}.flex-sm-row-reverse{-ms-flex-direction:row-reverse!important;flex-direction:row-reverse!important}.flex-sm-column-reverse{-ms-flex-direction:column-reverse!important;flex-direction:column-reverse!important}.flex-sm-wrap{-ms-flex-wrap:wrap!important;flex-wrap:wrap!important}.flex-sm-nowrap{-ms-flex-wrap:nowrap!important;flex-wrap:nowrap!important}.flex-sm-wrap-reverse{-ms-flex-wrap:wrap-reverse!important;flex-wrap:wrap-reverse!important}.flex-sm-fill{-ms-flex:1 1 auto!important;flex:1 1 auto!important}.flex-sm-grow-0{-ms-flex-positive:0!important;flex-grow:0!important}.flex-sm-grow-1{-ms-flex-positive:1!important;flex-grow:1!important}.flex-sm-shrink-0{-ms-flex-negative:0!important;flex-shrink:0!important}.flex-sm-shrink-1{-ms-flex-negative:1!important;flex-shrink:1!important}.justify-content-sm-start{-ms-flex-pack:start!important;justify-content:flex-start!important}.justify-content-sm-end{-ms-flex-pack:end!important;justify-content:flex-end!important}.justify-content-sm-center{-ms-flex-pack:center!important;justify-content:center!important}.justify-content-sm-between{-ms-flex-pack:justify!important;justify-content:space-between!important}.justify-content-sm-around{-ms-flex-pack:distribute!important;justify-content:space-around!important}.align-items-sm-start{-ms-flex-align:start!important;align-items:flex-start!important}.align-items-sm-end{-ms-flex-align:end!important;align-items:flex-end!important}.align-items-sm-center{-ms-flex-align:center!important;align-items:center!important}.align-items-sm-baseline{-ms-flex-align:baseline!important;align-items:baseline!important}.align-items-sm-stretch{-ms-flex-align:stretch!important;align-items:stretch!important}.align-content-sm-start{-ms-flex-line-pack:start!important;align-content:flex-start!important}.align-content-sm-end{-ms-flex-line-pack:end!important;align-content:flex-end!important}.align-content-sm-center{-ms-flex-line-pack:center!important;align-content:center!important}.align-content-sm-between{-ms-flex-line-pack:justify!important;align-content:space-between!important}.align-content-sm-around{-ms-flex-line-pack:distribute!important;align-content:space-around!important}.align-content-sm-stretch{-ms-flex-line-pack:stretch!important;align-content:stretch!important}.align-self-sm-auto{-ms-flex-item-align:auto!important;align-self:auto!important}.align-self-sm-start{-ms-flex-item-align:start!important;align-self:flex-start!important}.align-self-sm-end{-ms-flex-item-align:end!important;align-self:flex-end!important}.align-self-sm-center{-ms-flex-item-align:center!important;align-self:center!important}.align-self-sm-baseline{-ms-flex-item-align:baseline!important;align-self:baseline!important}.align-self-sm-stretch{-ms-flex-item-align:stretch!important;align-self:stretch!important}}@media (min-width:768px){.flex-md-row{-ms-flex-direction:row!important;flex-direction:row!important}.flex-md-column{-ms-flex-direction:column!important;flex-direction:column!important}.flex-md-row-reverse{-ms-flex-direction:row-reverse!important;flex-direction:row-reverse!important}.flex-md-column-reverse{-ms-flex-direction:column-reverse!important;flex-direction:column-reverse!important}.flex-md-wrap{-ms-flex-wrap:wrap!important;flex-wrap:wrap!important}.flex-md-nowrap{-ms-flex-wrap:nowrap!important;flex-wrap:nowrap!important}.flex-md-wrap-reverse{-ms-flex-wrap:wrap-reverse!important;flex-wrap:wrap-reverse!important}.flex-md-fill{-ms-flex:1 1 auto!important;flex:1 1 auto!important}.flex-md-grow-0{-ms-flex-positive:0!important;flex-grow:0!important}.flex-md-grow-1{-ms-flex-positive:1!important;flex-grow:1!important}.flex-md-shrink-0{-ms-flex-negative:0!important;flex-shrink:0!important}.flex-md-shrink-1{-ms-flex-negative:1!important;flex-shrink:1!important}.justify-content-md-start{-ms-flex-pack:start!important;justify-content:flex-start!important}.justify-content-md-end{-ms-flex-pack:end!important;justify-content:flex-end!important}.justify-content-md-center{-ms-flex-pack:center!important;justify-content:center!important}.justify-content-md-between{-ms-flex-pack:justify!important;justify-content:space-between!important}.justify-content-md-around{-ms-flex-pack:distribute!important;justify-content:space-around!important}.align-items-md-start{-ms-flex-align:start!important;align-items:flex-start!important}.align-items-md-end{-ms-flex-align:end!important;align-items:flex-end!important}.align-items-md-center{-ms-flex-align:center!important;align-items:center!important}.align-items-md-baseline{-ms-flex-align:baseline!important;align-items:baseline!important}.align-items-md-stretch{-ms-flex-align:stretch!important;align-items:stretch!important}.align-content-md-start{-ms-flex-line-pack:start!important;align-content:flex-start!important}.align-content-md-end{-ms-flex-line-pack:end!important;align-content:flex-end!important}.align-content-md-center{-ms-flex-line-pack:center!important;align-content:center!important}.align-content-md-between{-ms-flex-line-pack:justify!important;align-content:space-between!important}.align-content-md-around{-ms-flex-line-pack:distribute!important;align-content:space-around!important}.align-content-md-stretch{-ms-flex-line-pack:stretch!important;align-content:stretch!important}.align-self-md-auto{-ms-flex-item-align:auto!important;align-self:auto!important}.align-self-md-start{-ms-flex-item-align:start!important;align-self:flex-start!important}.align-self-md-end{-ms-flex-item-align:end!important;align-self:flex-end!important}.align-self-md-center{-ms-flex-item-align:center!important;align-self:center!important}.align-self-md-baseline{-ms-flex-item-align:baseline!important;align-self:baseline!important}.align-self-md-stretch{-ms-flex-item-align:stretch!important;align-self:stretch!important}}@media (min-width:992px){.flex-lg-row{-ms-flex-direction:row!important;flex-direction:row!important}.flex-lg-column{-ms-flex-direction:column!important;flex-direction:column!important}.flex-lg-row-reverse{-ms-flex-direction:row-reverse!important;flex-direction:row-reverse!important}.flex-lg-column-reverse{-ms-flex-direction:column-reverse!important;flex-direction:column-reverse!important}.flex-lg-wrap{-ms-flex-wrap:wrap!important;flex-wrap:wrap!important}.flex-lg-nowrap{-ms-flex-wrap:nowrap!important;flex-wrap:nowrap!important}.flex-lg-wrap-reverse{-ms-flex-wrap:wrap-reverse!important;flex-wrap:wrap-reverse!important}.flex-lg-fill{-ms-flex:1 1 auto!important;flex:1 1 auto!important}.flex-lg-grow-0{-ms-flex-positive:0!important;flex-grow:0!important}.flex-lg-grow-1{-ms-flex-positive:1!important;flex-grow:1!important}.flex-lg-shrink-0{-ms-flex-negative:0!important;flex-shrink:0!important}.flex-lg-shrink-1{-ms-flex-negative:1!important;flex-shrink:1!important}.justify-content-lg-start{-ms-flex-pack:start!important;justify-content:flex-start!important}.justify-content-lg-end{-ms-flex-pack:end!important;justify-content:flex-end!important}.justify-content-lg-center{-ms-flex-pack:center!important;justify-content:center!important}.justify-content-lg-between{-ms-flex-pack:justify!important;justify-content:space-between!important}.justify-content-lg-around{-ms-flex-pack:distribute!important;justify-content:space-around!important}.align-items-lg-start{-ms-flex-align:start!important;align-items:flex-start!important}.align-items-lg-end{-ms-flex-align:end!important;align-items:flex-end!important}.align-items-lg-center{-ms-flex-align:center!important;align-items:center!important}.align-items-lg-baseline{-ms-flex-align:baseline!important;align-items:baseline!important}.align-items-lg-stretch{-ms-flex-align:stretch!important;align-items:stretch!important}.align-content-lg-start{-ms-flex-line-pack:start!important;align-content:flex-start!important}.align-content-lg-end{-ms-flex-line-pack:end!important;align-content:flex-end!important}.align-content-lg-center{-ms-flex-line-pack:center!important;align-content:center!important}.align-content-lg-between{-ms-flex-line-pack:justify!important;align-content:space-between!important}.align-content-lg-around{-ms-flex-line-pack:distribute!important;align-content:space-around!important}.align-content-lg-stretch{-ms-flex-line-pack:stretch!important;align-content:stretch!important}.align-self-lg-auto{-ms-flex-item-align:auto!important;align-self:auto!important}.align-self-lg-start{-ms-flex-item-align:start!important;align-self:flex-start!important}.align-self-lg-end{-ms-flex-item-align:end!important;align-self:flex-end!important}.align-self-lg-center{-ms-flex-item-align:center!important;align-self:center!important}.align-self-lg-baseline{-ms-flex-item-align:baseline!important;align-self:baseline!important}.align-self-lg-stretch{-ms-flex-item-align:stretch!important;align-self:stretch!important}}@media (min-width:1200px){.flex-xl-row{-ms-flex-direction:row!important;flex-direction:row!important}.flex-xl-column{-ms-flex-direction:column!important;flex-direction:column!important}.flex-xl-row-reverse{-ms-flex-direction:row-reverse!important;flex-direction:row-reverse!important}.flex-xl-column-reverse{-ms-flex-direction:column-reverse!important;flex-direction:column-reverse!important}.flex-xl-wrap{-ms-flex-wrap:wrap!important;flex-wrap:wrap!important}.flex-xl-nowrap{-ms-flex-wrap:nowrap!important;flex-wrap:nowrap!important}.flex-xl-wrap-reverse{-ms-flex-wrap:wrap-reverse!important;flex-wrap:wrap-reverse!important}.flex-xl-fill{-ms-flex:1 1 auto!important;flex:1 1 auto!important}.flex-xl-grow-0{-ms-flex-positive:0!important;flex-grow:0!important}.flex-xl-grow-1{-ms-flex-positive:1!important;flex-grow:1!important}.flex-xl-shrink-0{-ms-flex-negative:0!important;flex-shrink:0!important}.flex-xl-shrink-1{-ms-flex-negative:1!important;flex-shrink:1!important}.justify-content-xl-start{-ms-flex-pack:start!important;justify-content:flex-start!important}.justify-content-xl-end{-ms-flex-pack:end!important;justify-content:flex-end!important}.justify-content-xl-center{-ms-flex-pack:center!important;justify-content:center!important}.justify-content-xl-between{-ms-flex-pack:justify!important;justify-content:space-between!important}.justify-content-xl-around{-ms-flex-pack:distribute!important;justify-content:space-around!important}.align-items-xl-start{-ms-flex-align:start!important;align-items:flex-start!important}.align-items-xl-end{-ms-flex-align:end!important;align-items:flex-end!important}.align-items-xl-center{-ms-flex-align:center!important;align-items:center!important}.align-items-xl-baseline{-ms-flex-align:baseline!important;align-items:baseline!important}.align-items-xl-stretch{-ms-flex-align:stretch!important;align-items:stretch!important}.align-content-xl-start{-ms-flex-line-pack:start!important;align-content:flex-start!important}.align-content-xl-end{-ms-flex-line-pack:end!important;align-content:flex-end!important}.align-content-xl-center{-ms-flex-line-pack:center!important;align-content:center!important}.align-content-xl-between{-ms-flex-line-pack:justify!important;align-content:space-between!important}.align-content-xl-around{-ms-flex-line-pack:distribute!important;align-content:space-around!important}.align-content-xl-stretch{-ms-flex-line-pack:stretch!important;align-content:stretch!important}.align-self-xl-auto{-ms-flex-item-align:auto!important;align-self:auto!important}.align-self-xl-start{-ms-flex-item-align:start!important;align-self:flex-start!important}.align-self-xl-end{-ms-flex-item-align:end!important;align-self:flex-end!important}.align-self-xl-center{-ms-flex-item-align:center!important;align-self:center!important}.align-self-xl-baseline{-ms-flex-item-align:baseline!important;align-self:baseline!important}.align-self-xl-stretch{-ms-flex-item-align:stretch!important;align-self:stretch!important}}.float-left{float:left!important}.float-right{float:right!important}.float-none{float:none!important}@media (min-width:576px){.float-sm-left{float:left!important}.float-sm-right{float:right!important}.float-sm-none{float:none!important}}@media (min-width:768px){.float-md-left{float:left!important}.float-md-right{float:right!important}.float-md-none{float:none!important}}@media (min-width:992px){.float-lg-left{float:left!important}.float-lg-right{float:right!important}.float-lg-none{float:none!important}}@media (min-width:1200px){.float-xl-left{float:left!important}.float-xl-right{float:right!important}.float-xl-none{float:none!important}}.user-select-all{-webkit-user-select:all!important;-moz-user-select:all!important;user-select:all!important}.user-select-auto{-webkit-user-select:auto!important;-moz-user-select:auto!important;-ms-user-select:auto!important;user-select:auto!important}.user-select-none{-webkit-user-select:none!important;-moz-user-select:none!important;-ms-user-select:none!important;user-select:none!important}.overflow-auto{overflow:auto!important}.overflow-hidden{overflow:hidden!important}.position-static{position:static!important}.position-relative{position:relative!important}.position-absolute{position:absolute!important}.position-fixed{position:fixed!important}.position-sticky{position:-webkit-sticky!important;position:sticky!important}.fixed-top{position:fixed;top:0;right:0;left:0;z-index:1030}.fixed-bottom{position:fixed;right:0;bottom:0;left:0;z-index:1030}@supports ((position:-webkit-sticky) or (position:sticky)){.sticky-top{position:-webkit-sticky;position:sticky;top:0;z-index:1020}}.sr-only{position:absolute;width:1px;height:1px;padding:0;margin:-1px;overflow:hidden;clip:rect(0,0,0,0);white-space:nowrap;border:0}.sr-only-focusable:active,.sr-only-focusable:focus{position:static;width:auto;height:auto;overflow:visible;clip:auto;white-space:normal}.shadow-sm{box-shadow:0 .125rem .25rem rgba(0,0,0,.075)!important}.shadow{box-shadow:0 .5rem 1rem rgba(0,0,0,.15)!important}.shadow-lg{box-shadow:0 1rem 3rem rgba(0,0,0,.175)!important}.shadow-none{box-shadow:none!important}.w-25{width:25%!important}.w-50{width:50%!important}.w-75{width:75%!important}.w-100{width:100%!important}.w-auto{width:auto!important}.h-25{height:25%!important}.h-50{height:50%!important}.h-75{height:75%!important}.h-100{height:100%!important}.h-auto{height:auto!important}.mw-100{max-width:100%!important}.mh-100{max-height:100%!important}.min-vw-100{min-width:100vw!important}.min-vh-100{min-height:100vh!important}.vw-100{width:100vw!important}.vh-100{height:100vh!important}.m-0{margin:0!important}.mt-0,.my-0{margin-top:0!important}.mr-0,.mx-0{margin-right:0!important}.mb-0,.my-0{margin-bottom:0!important}.ml-0,.mx-0{margin-left:0!important}.m-1{margin:.25rem!important}.mt-1,.my-1{margin-top:.25rem!important}.mr-1,.mx-1{margin-right:.25rem!important}.mb-1,.my-1{margin-bottom:.25rem!important}.ml-1,.mx-1{margin-left:.25rem!important}.m-2{margin:.5rem!important}.mt-2,.my-2{margin-top:.5rem!important}.mr-2,.mx-2{margin-right:.5rem!important}.mb-2,.my-2{margin-bottom:.5rem!important}.ml-2,.mx-2{margin-left:.5rem!important}.m-3{margin:1rem!important}.mt-3,.my-3{margin-top:1rem!important}.mr-3,.mx-3{margin-right:1rem!important}.mb-3,.my-3{margin-bottom:1rem!important}.ml-3,.mx-3{margin-left:1rem!important}.m-4{margin:1.5rem!important}.mt-4,.my-4{margin-top:1.5rem!important}.mr-4,.mx-4{margin-right:1.5rem!important}.mb-4,.my-4{margin-bottom:1.5rem!important}.ml-4,.mx-4{margin-left:1.5rem!important}.m-5{margin:3rem!important}.mt-5,.my-5{margin-top:3rem!important}.mr-5,.mx-5{margin-right:3rem!important}.mb-5,.my-5{margin-bottom:3rem!important}.ml-5,.mx-5{margin-left:3rem!important}.p-0{padding:0!important}.pt-0,.py-0{padding-top:0!important}.pr-0,.px-0{padding-right:0!important}.pb-0,.py-0{padding-bottom:0!important}.pl-0,.px-0{padding-left:0!important}.p-1{padding:.25rem!important}.pt-1,.py-1{padding-top:.25rem!important}.pr-1,.px-1{padding-right:.25rem!important}.pb-1,.py-1{padding-bottom:.25rem!important}.pl-1,.px-1{padding-left:.25rem!important}.p-2{padding:.5rem!important}.pt-2,.py-2{padding-top:.5rem!important}.pr-2,.px-2{padding-right:.5rem!important}.pb-2,.py-2{padding-bottom:.5rem!important}.pl-2,.px-2{padding-left:.5rem!important}.p-3{padding:1rem!important}.pt-3,.py-3{padding-top:1rem!important}.pr-3,.px-3{padding-right:1rem!important}.pb-3,.py-3{padding-bottom:1rem!important}.pl-3,.px-3{padding-left:1rem!important}.p-4{padding:1.5rem!important}.pt-4,.py-4{padding-top:1.5rem!important}.pr-4,.px-4{padding-right:1.5rem!important}.pb-4,.py-4{padding-bottom:1.5rem!important}.pl-4,.px-4{padding-left:1.5rem!important}.p-5{padding:3rem!important}.pt-5,.py-5{padding-top:3rem!important}.pr-5,.px-5{padding-right:3rem!important}.pb-5,.py-5{padding-bottom:3rem!important}.pl-5,.px-5{padding-left:3rem!important}.m-n1{margin:-.25rem!important}.mt-n1,.my-n1{margin-top:-.25rem!important}.mr-n1,.mx-n1{margin-right:-.25rem!important}.mb-n1,.my-n1{margin-bottom:-.25rem!important}.ml-n1,.mx-n1{margin-left:-.25rem!important}.m-n2{margin:-.5rem!important}.mt-n2,.my-n2{margin-top:-.5rem!important}.mr-n2,.mx-n2{margin-right:-.5rem!important}.mb-n2,.my-n2{margin-bottom:-.5rem!important}.ml-n2,.mx-n2{margin-left:-.5rem!important}.m-n3{margin:-1rem!important}.mt-n3,.my-n3{margin-top:-1rem!important}.mr-n3,.mx-n3{margin-right:-1rem!important}.mb-n3,.my-n3{margin-bottom:-1rem!important}.ml-n3,.mx-n3{margin-left:-1rem!important}.m-n4{margin:-1.5rem!important}.mt-n4,.my-n4{margin-top:-1.5rem!important}.mr-n4,.mx-n4{margin-right:-1.5rem!important}.mb-n4,.my-n4{margin-bottom:-1.5rem!important}.ml-n4,.mx-n4{margin-left:-1.5rem!important}.m-n5{margin:-3rem!important}.mt-n5,.my-n5{margin-top:-3rem!important}.mr-n5,.mx-n5{margin-right:-3rem!important}.mb-n5,.my-n5{margin-bottom:-3rem!important}.ml-n5,.mx-n5{margin-left:-3rem!important}.m-auto{margin:auto!important}.mt-auto,.my-auto{margin-top:auto!important}.mr-auto,.mx-auto{margin-right:auto!important}.mb-auto,.my-auto{margin-bottom:auto!important}.ml-auto,.mx-auto{margin-left:auto!important}@media (min-width:576px){.m-sm-0{margin:0!important}.mt-sm-0,.my-sm-0{margin-top:0!important}.mr-sm-0,.mx-sm-0{margin-right:0!important}.mb-sm-0,.my-sm-0{margin-bottom:0!important}.ml-sm-0,.mx-sm-0{margin-left:0!important}.m-sm-1{margin:.25rem!important}.mt-sm-1,.my-sm-1{margin-top:.25rem!important}.mr-sm-1,.mx-sm-1{margin-right:.25rem!important}.mb-sm-1,.my-sm-1{margin-bottom:.25rem!important}.ml-sm-1,.mx-sm-1{margin-left:.25rem!important}.m-sm-2{margin:.5rem!important}.mt-sm-2,.my-sm-2{margin-top:.5rem!important}.mr-sm-2,.mx-sm-2{margin-right:.5rem!important}.mb-sm-2,.my-sm-2{margin-bottom:.5rem!important}.ml-sm-2,.mx-sm-2{margin-left:.5rem!important}.m-sm-3{margin:1rem!important}.mt-sm-3,.my-sm-3{margin-top:1rem!important}.mr-sm-3,.mx-sm-3{margin-right:1rem!important}.mb-sm-3,.my-sm-3{margin-bottom:1rem!important}.ml-sm-3,.mx-sm-3{margin-left:1rem!important}.m-sm-4{margin:1.5rem!important}.mt-sm-4,.my-sm-4{margin-top:1.5rem!important}.mr-sm-4,.mx-sm-4{margin-right:1.5rem!important}.mb-sm-4,.my-sm-4{margin-bottom:1.5rem!important}.ml-sm-4,.mx-sm-4{margin-left:1.5rem!important}.m-sm-5{margin:3rem!important}.mt-sm-5,.my-sm-5{margin-top:3rem!important}.mr-sm-5,.mx-sm-5{margin-right:3rem!important}.mb-sm-5,.my-sm-5{margin-bottom:3rem!important}.ml-sm-5,.mx-sm-5{margin-left:3rem!important}.p-sm-0{padding:0!important}.pt-sm-0,.py-sm-0{padding-top:0!important}.pr-sm-0,.px-sm-0{padding-right:0!important}.pb-sm-0,.py-sm-0{padding-bottom:0!important}.pl-sm-0,.px-sm-0{padding-left:0!important}.p-sm-1{padding:.25rem!important}.pt-sm-1,.py-sm-1{padding-top:.25rem!important}.pr-sm-1,.px-sm-1{padding-right:.25rem!important}.pb-sm-1,.py-sm-1{padding-bottom:.25rem!important}.pl-sm-1,.px-sm-1{padding-left:.25rem!important}.p-sm-2{padding:.5rem!important}.pt-sm-2,.py-sm-2{padding-top:.5rem!important}.pr-sm-2,.px-sm-2{padding-right:.5rem!important}.pb-sm-2,.py-sm-2{padding-bottom:.5rem!important}.pl-sm-2,.px-sm-2{padding-left:.5rem!important}.p-sm-3{padding:1rem!important}.pt-sm-3,.py-sm-3{padding-top:1rem!important}.pr-sm-3,.px-sm-3{padding-right:1rem!important}.pb-sm-3,.py-sm-3{padding-bottom:1rem!important}.pl-sm-3,.px-sm-3{padding-left:1rem!important}.p-sm-4{padding:1.5rem!important}.pt-sm-4,.py-sm-4{padding-top:1.5rem!important}.pr-sm-4,.px-sm-4{padding-right:1.5rem!important}.pb-sm-4,.py-sm-4{padding-bottom:1.5rem!important}.pl-sm-4,.px-sm-4{padding-left:1.5rem!important}.p-sm-5{padding:3rem!important}.pt-sm-5,.py-sm-5{padding-top:3rem!important}.pr-sm-5,.px-sm-5{padding-right:3rem!important}.pb-sm-5,.py-sm-5{padding-bottom:3rem!important}.pl-sm-5,.px-sm-5{padding-left:3rem!important}.m-sm-n1{margin:-.25rem!important}.mt-sm-n1,.my-sm-n1{margin-top:-.25rem!important}.mr-sm-n1,.mx-sm-n1{margin-right:-.25rem!important}.mb-sm-n1,.my-sm-n1{margin-bottom:-.25rem!important}.ml-sm-n1,.mx-sm-n1{margin-left:-.25rem!important}.m-sm-n2{margin:-.5rem!important}.mt-sm-n2,.my-sm-n2{margin-top:-.5rem!important}.mr-sm-n2,.mx-sm-n2{margin-right:-.5rem!important}.mb-sm-n2,.my-sm-n2{margin-bottom:-.5rem!important}.ml-sm-n2,.mx-sm-n2{margin-left:-.5rem!important}.m-sm-n3{margin:-1rem!important}.mt-sm-n3,.my-sm-n3{margin-top:-1rem!important}.mr-sm-n3,.mx-sm-n3{margin-right:-1rem!important}.mb-sm-n3,.my-sm-n3{margin-bottom:-1rem!important}.ml-sm-n3,.mx-sm-n3{margin-left:-1rem!important}.m-sm-n4{margin:-1.5rem!important}.mt-sm-n4,.my-sm-n4{margin-top:-1.5rem!important}.mr-sm-n4,.mx-sm-n4{margin-right:-1.5rem!important}.mb-sm-n4,.my-sm-n4{margin-bottom:-1.5rem!important}.ml-sm-n4,.mx-sm-n4{margin-left:-1.5rem!important}.m-sm-n5{margin:-3rem!important}.mt-sm-n5,.my-sm-n5{margin-top:-3rem!important}.mr-sm-n5,.mx-sm-n5{margin-right:-3rem!important}.mb-sm-n5,.my-sm-n5{margin-bottom:-3rem!important}.ml-sm-n5,.mx-sm-n5{margin-left:-3rem!important}.m-sm-auto{margin:auto!important}.mt-sm-auto,.my-sm-auto{margin-top:auto!important}.mr-sm-auto,.mx-sm-auto{margin-right:auto!important}.mb-sm-auto,.my-sm-auto{margin-bottom:auto!important}.ml-sm-auto,.mx-sm-auto{margin-left:auto!important}}@media (min-width:768px){.m-md-0{margin:0!important}.mt-md-0,.my-md-0{margin-top:0!important}.mr-md-0,.mx-md-0{margin-right:0!important}.mb-md-0,.my-md-0{margin-bottom:0!important}.ml-md-0,.mx-md-0{margin-left:0!important}.m-md-1{margin:.25rem!important}.mt-md-1,.my-md-1{margin-top:.25rem!important}.mr-md-1,.mx-md-1{margin-right:.25rem!important}.mb-md-1,.my-md-1{margin-bottom:.25rem!important}.ml-md-1,.mx-md-1{margin-left:.25rem!important}.m-md-2{margin:.5rem!important}.mt-md-2,.my-md-2{margin-top:.5rem!important}.mr-md-2,.mx-md-2{margin-right:.5rem!important}.mb-md-2,.my-md-2{margin-bottom:.5rem!important}.ml-md-2,.mx-md-2{margin-left:.5rem!important}.m-md-3{margin:1rem!important}.mt-md-3,.my-md-3{margin-top:1rem!important}.mr-md-3,.mx-md-3{margin-right:1rem!important}.mb-md-3,.my-md-3{margin-bottom:1rem!important}.ml-md-3,.mx-md-3{margin-left:1rem!important}.m-md-4{margin:1.5rem!important}.mt-md-4,.my-md-4{margin-top:1.5rem!important}.mr-md-4,.mx-md-4{margin-right:1.5rem!important}.mb-md-4,.my-md-4{margin-bottom:1.5rem!important}.ml-md-4,.mx-md-4{margin-left:1.5rem!important}.m-md-5{margin:3rem!important}.mt-md-5,.my-md-5{margin-top:3rem!important}.mr-md-5,.mx-md-5{margin-right:3rem!important}.mb-md-5,.my-md-5{margin-bottom:3rem!important}.ml-md-5,.mx-md-5{margin-left:3rem!important}.p-md-0{padding:0!important}.pt-md-0,.py-md-0{padding-top:0!important}.pr-md-0,.px-md-0{padding-right:0!important}.pb-md-0,.py-md-0{padding-bottom:0!important}.pl-md-0,.px-md-0{padding-left:0!important}.p-md-1{padding:.25rem!important}.pt-md-1,.py-md-1{padding-top:.25rem!important}.pr-md-1,.px-md-1{padding-right:.25rem!important}.pb-md-1,.py-md-1{padding-bottom:.25rem!important}.pl-md-1,.px-md-1{padding-left:.25rem!important}.p-md-2{padding:.5rem!important}.pt-md-2,.py-md-2{padding-top:.5rem!important}.pr-md-2,.px-md-2{padding-right:.5rem!important}.pb-md-2,.py-md-2{padding-bottom:.5rem!important}.pl-md-2,.px-md-2{padding-left:.5rem!important}.p-md-3{padding:1rem!important}.pt-md-3,.py-md-3{padding-top:1rem!important}.pr-md-3,.px-md-3{padding-right:1rem!important}.pb-md-3,.py-md-3{padding-bottom:1rem!important}.pl-md-3,.px-md-3{padding-left:1rem!important}.p-md-4{padding:1.5rem!important}.pt-md-4,.py-md-4{padding-top:1.5rem!important}.pr-md-4,.px-md-4{padding-right:1.5rem!important}.pb-md-4,.py-md-4{padding-bottom:1.5rem!important}.pl-md-4,.px-md-4{padding-left:1.5rem!important}.p-md-5{padding:3rem!important}.pt-md-5,.py-md-5{padding-top:3rem!important}.pr-md-5,.px-md-5{padding-right:3rem!important}.pb-md-5,.py-md-5{padding-bottom:3rem!important}.pl-md-5,.px-md-5{padding-left:3rem!important}.m-md-n1{margin:-.25rem!important}.mt-md-n1,.my-md-n1{margin-top:-.25rem!important}.mr-md-n1,.mx-md-n1{margin-right:-.25rem!important}.mb-md-n1,.my-md-n1{margin-bottom:-.25rem!important}.ml-md-n1,.mx-md-n1{margin-left:-.25rem!important}.m-md-n2{margin:-.5rem!important}.mt-md-n2,.my-md-n2{margin-top:-.5rem!important}.mr-md-n2,.mx-md-n2{margin-right:-.5rem!important}.mb-md-n2,.my-md-n2{margin-bottom:-.5rem!important}.ml-md-n2,.mx-md-n2{margin-left:-.5rem!important}.m-md-n3{margin:-1rem!important}.mt-md-n3,.my-md-n3{margin-top:-1rem!important}.mr-md-n3,.mx-md-n3{margin-right:-1rem!important}.mb-md-n3,.my-md-n3{margin-bottom:-1rem!important}.ml-md-n3,.mx-md-n3{margin-left:-1rem!important}.m-md-n4{margin:-1.5rem!important}.mt-md-n4,.my-md-n4{margin-top:-1.5rem!important}.mr-md-n4,.mx-md-n4{margin-right:-1.5rem!important}.mb-md-n4,.my-md-n4{margin-bottom:-1.5rem!important}.ml-md-n4,.mx-md-n4{margin-left:-1.5rem!important}.m-md-n5{margin:-3rem!important}.mt-md-n5,.my-md-n5{margin-top:-3rem!important}.mr-md-n5,.mx-md-n5{margin-right:-3rem!important}.mb-md-n5,.my-md-n5{margin-bottom:-3rem!important}.ml-md-n5,.mx-md-n5{margin-left:-3rem!important}.m-md-auto{margin:auto!important}.mt-md-auto,.my-md-auto{margin-top:auto!important}.mr-md-auto,.mx-md-auto{margin-right:auto!important}.mb-md-auto,.my-md-auto{margin-bottom:auto!important}.ml-md-auto,.mx-md-auto{margin-left:auto!important}}@media (min-width:992px){.m-lg-0{margin:0!important}.mt-lg-0,.my-lg-0{margin-top:0!important}.mr-lg-0,.mx-lg-0{margin-right:0!important}.mb-lg-0,.my-lg-0{margin-bottom:0!important}.ml-lg-0,.mx-lg-0{margin-left:0!important}.m-lg-1{margin:.25rem!important}.mt-lg-1,.my-lg-1{margin-top:.25rem!important}.mr-lg-1,.mx-lg-1{margin-right:.25rem!important}.mb-lg-1,.my-lg-1{margin-bottom:.25rem!important}.ml-lg-1,.mx-lg-1{margin-left:.25rem!important}.m-lg-2{margin:.5rem!important}.mt-lg-2,.my-lg-2{margin-top:.5rem!important}.mr-lg-2,.mx-lg-2{margin-right:.5rem!important}.mb-lg-2,.my-lg-2{margin-bottom:.5rem!important}.ml-lg-2,.mx-lg-2{margin-left:.5rem!important}.m-lg-3{margin:1rem!important}.mt-lg-3,.my-lg-3{margin-top:1rem!important}.mr-lg-3,.mx-lg-3{margin-right:1rem!important}.mb-lg-3,.my-lg-3{margin-bottom:1rem!important}.ml-lg-3,.mx-lg-3{margin-left:1rem!important}.m-lg-4{margin:1.5rem!important}.mt-lg-4,.my-lg-4{margin-top:1.5rem!important}.mr-lg-4,.mx-lg-4{margin-right:1.5rem!important}.mb-lg-4,.my-lg-4{margin-bottom:1.5rem!important}.ml-lg-4,.mx-lg-4{margin-left:1.5rem!important}.m-lg-5{margin:3rem!important}.mt-lg-5,.my-lg-5{margin-top:3rem!important}.mr-lg-5,.mx-lg-5{margin-right:3rem!important}.mb-lg-5,.my-lg-5{margin-bottom:3rem!important}.ml-lg-5,.mx-lg-5{margin-left:3rem!important}.p-lg-0{padding:0!important}.pt-lg-0,.py-lg-0{padding-top:0!important}.pr-lg-0,.px-lg-0{padding-right:0!important}.pb-lg-0,.py-lg-0{padding-bottom:0!important}.pl-lg-0,.px-lg-0{padding-left:0!important}.p-lg-1{padding:.25rem!important}.pt-lg-1,.py-lg-1{padding-top:.25rem!important}.pr-lg-1,.px-lg-1{padding-right:.25rem!important}.pb-lg-1,.py-lg-1{padding-bottom:.25rem!important}.pl-lg-1,.px-lg-1{padding-left:.25rem!important}.p-lg-2{padding:.5rem!important}.pt-lg-2,.py-lg-2{padding-top:.5rem!important}.pr-lg-2,.px-lg-2{padding-right:.5rem!important}.pb-lg-2,.py-lg-2{padding-bottom:.5rem!important}.pl-lg-2,.px-lg-2{padding-left:.5rem!important}.p-lg-3{padding:1rem!important}.pt-lg-3,.py-lg-3{padding-top:1rem!important}.pr-lg-3,.px-lg-3{padding-right:1rem!important}.pb-lg-3,.py-lg-3{padding-bottom:1rem!important}.pl-lg-3,.px-lg-3{padding-left:1rem!important}.p-lg-4{padding:1.5rem!important}.pt-lg-4,.py-lg-4{padding-top:1.5rem!important}.pr-lg-4,.px-lg-4{padding-right:1.5rem!important}.pb-lg-4,.py-lg-4{padding-bottom:1.5rem!important}.pl-lg-4,.px-lg-4{padding-left:1.5rem!important}.p-lg-5{padding:3rem!important}.pt-lg-5,.py-lg-5{padding-top:3rem!important}.pr-lg-5,.px-lg-5{padding-right:3rem!important}.pb-lg-5,.py-lg-5{padding-bottom:3rem!important}.pl-lg-5,.px-lg-5{padding-left:3rem!important}.m-lg-n1{margin:-.25rem!important}.mt-lg-n1,.my-lg-n1{margin-top:-.25rem!important}.mr-lg-n1,.mx-lg-n1{margin-right:-.25rem!important}.mb-lg-n1,.my-lg-n1{margin-bottom:-.25rem!important}.ml-lg-n1,.mx-lg-n1{margin-left:-.25rem!important}.m-lg-n2{margin:-.5rem!important}.mt-lg-n2,.my-lg-n2{margin-top:-.5rem!important}.mr-lg-n2,.mx-lg-n2{margin-right:-.5rem!important}.mb-lg-n2,.my-lg-n2{margin-bottom:-.5rem!important}.ml-lg-n2,.mx-lg-n2{margin-left:-.5rem!important}.m-lg-n3{margin:-1rem!important}.mt-lg-n3,.my-lg-n3{margin-top:-1rem!important}.mr-lg-n3,.mx-lg-n3{margin-right:-1rem!important}.mb-lg-n3,.my-lg-n3{margin-bottom:-1rem!important}.ml-lg-n3,.mx-lg-n3{margin-left:-1rem!important}.m-lg-n4{margin:-1.5rem!important}.mt-lg-n4,.my-lg-n4{margin-top:-1.5rem!important}.mr-lg-n4,.mx-lg-n4{margin-right:-1.5rem!important}.mb-lg-n4,.my-lg-n4{margin-bottom:-1.5rem!important}.ml-lg-n4,.mx-lg-n4{margin-left:-1.5rem!important}.m-lg-n5{margin:-3rem!important}.mt-lg-n5,.my-lg-n5{margin-top:-3rem!important}.mr-lg-n5,.mx-lg-n5{margin-right:-3rem!important}.mb-lg-n5,.my-lg-n5{margin-bottom:-3rem!important}.ml-lg-n5,.mx-lg-n5{margin-left:-3rem!important}.m-lg-auto{margin:auto!important}.mt-lg-auto,.my-lg-auto{margin-top:auto!important}.mr-lg-auto,.mx-lg-auto{margin-right:auto!important}.mb-lg-auto,.my-lg-auto{margin-bottom:auto!important}.ml-lg-auto,.mx-lg-auto{margin-left:auto!important}}@media (min-width:1200px){.m-xl-0{margin:0!important}.mt-xl-0,.my-xl-0{margin-top:0!important}.mr-xl-0,.mx-xl-0{margin-right:0!important}.mb-xl-0,.my-xl-0{margin-bottom:0!important}.ml-xl-0,.mx-xl-0{margin-left:0!important}.m-xl-1{margin:.25rem!important}.mt-xl-1,.my-xl-1{margin-top:.25rem!important}.mr-xl-1,.mx-xl-1{margin-right:.25rem!important}.mb-xl-1,.my-xl-1{margin-bottom:.25rem!important}.ml-xl-1,.mx-xl-1{margin-left:.25rem!important}.m-xl-2{margin:.5rem!important}.mt-xl-2,.my-xl-2{margin-top:.5rem!important}.mr-xl-2,.mx-xl-2{margin-right:.5rem!important}.mb-xl-2,.my-xl-2{margin-bottom:.5rem!important}.ml-xl-2,.mx-xl-2{margin-left:.5rem!important}.m-xl-3{margin:1rem!important}.mt-xl-3,.my-xl-3{margin-top:1rem!important}.mr-xl-3,.mx-xl-3{margin-right:1rem!important}.mb-xl-3,.my-xl-3{margin-bottom:1rem!important}.ml-xl-3,.mx-xl-3{margin-left:1rem!important}.m-xl-4{margin:1.5rem!important}.mt-xl-4,.my-xl-4{margin-top:1.5rem!important}.mr-xl-4,.mx-xl-4{margin-right:1.5rem!important}.mb-xl-4,.my-xl-4{margin-bottom:1.5rem!important}.ml-xl-4,.mx-xl-4{margin-left:1.5rem!important}.m-xl-5{margin:3rem!important}.mt-xl-5,.my-xl-5{margin-top:3rem!important}.mr-xl-5,.mx-xl-5{margin-right:3rem!important}.mb-xl-5,.my-xl-5{margin-bottom:3rem!important}.ml-xl-5,.mx-xl-5{margin-left:3rem!important}.p-xl-0{padding:0!important}.pt-xl-0,.py-xl-0{padding-top:0!important}.pr-xl-0,.px-xl-0{padding-right:0!important}.pb-xl-0,.py-xl-0{padding-bottom:0!important}.pl-xl-0,.px-xl-0{padding-left:0!important}.p-xl-1{padding:.25rem!important}.pt-xl-1,.py-xl-1{padding-top:.25rem!important}.pr-xl-1,.px-xl-1{padding-right:.25rem!important}.pb-xl-1,.py-xl-1{padding-bottom:.25rem!important}.pl-xl-1,.px-xl-1{padding-left:.25rem!important}.p-xl-2{padding:.5rem!important}.pt-xl-2,.py-xl-2{padding-top:.5rem!important}.pr-xl-2,.px-xl-2{padding-right:.5rem!important}.pb-xl-2,.py-xl-2{padding-bottom:.5rem!important}.pl-xl-2,.px-xl-2{padding-left:.5rem!important}.p-xl-3{padding:1rem!important}.pt-xl-3,.py-xl-3{padding-top:1rem!important}.pr-xl-3,.px-xl-3{padding-right:1rem!important}.pb-xl-3,.py-xl-3{padding-bottom:1rem!important}.pl-xl-3,.px-xl-3{padding-left:1rem!important}.p-xl-4{padding:1.5rem!important}.pt-xl-4,.py-xl-4{padding-top:1.5rem!important}.pr-xl-4,.px-xl-4{padding-right:1.5rem!important}.pb-xl-4,.py-xl-4{padding-bottom:1.5rem!important}.pl-xl-4,.px-xl-4{padding-left:1.5rem!important}.p-xl-5{padding:3rem!important}.pt-xl-5,.py-xl-5{padding-top:3rem!important}.pr-xl-5,.px-xl-5{padding-right:3rem!important}.pb-xl-5,.py-xl-5{padding-bottom:3rem!important}.pl-xl-5,.px-xl-5{padding-left:3rem!important}.m-xl-n1{margin:-.25rem!important}.mt-xl-n1,.my-xl-n1{margin-top:-.25rem!important}.mr-xl-n1,.mx-xl-n1{margin-right:-.25rem!important}.mb-xl-n1,.my-xl-n1{margin-bottom:-.25rem!important}.ml-xl-n1,.mx-xl-n1{margin-left:-.25rem!important}.m-xl-n2{margin:-.5rem!important}.mt-xl-n2,.my-xl-n2{margin-top:-.5rem!important}.mr-xl-n2,.mx-xl-n2{margin-right:-.5rem!important}.mb-xl-n2,.my-xl-n2{margin-bottom:-.5rem!important}.ml-xl-n2,.mx-xl-n2{margin-left:-.5rem!important}.m-xl-n3{margin:-1rem!important}.mt-xl-n3,.my-xl-n3{margin-top:-1rem!important}.mr-xl-n3,.mx-xl-n3{margin-right:-1rem!important}.mb-xl-n3,.my-xl-n3{margin-bottom:-1rem!important}.ml-xl-n3,.mx-xl-n3{margin-left:-1rem!important}.m-xl-n4{margin:-1.5rem!important}.mt-xl-n4,.my-xl-n4{margin-top:-1.5rem!important}.mr-xl-n4,.mx-xl-n4{margin-right:-1.5rem!important}.mb-xl-n4,.my-xl-n4{margin-bottom:-1.5rem!important}.ml-xl-n4,.mx-xl-n4{margin-left:-1.5rem!important}.m-xl-n5{margin:-3rem!important}.mt-xl-n5,.my-xl-n5{margin-top:-3rem!important}.mr-xl-n5,.mx-xl-n5{margin-right:-3rem!important}.mb-xl-n5,.my-xl-n5{margin-bottom:-3rem!important}.ml-xl-n5,.mx-xl-n5{margin-left:-3rem!important}.m-xl-auto{margin:auto!important}.mt-xl-auto,.my-xl-auto{margin-top:auto!important}.mr-xl-auto,.mx-xl-auto{margin-right:auto!important}.mb-xl-auto,.my-xl-auto{margin-bottom:auto!important}.ml-xl-auto,.mx-xl-auto{margin-left:auto!important}}.stretched-link::after{position:absolute;top:0;right:0;bottom:0;left:0;z-index:1;pointer-events:auto;content:"";background-color:rgba(0,0,0,0)}.text-monospace{font-family:SFMono-Regular,Menlo,Monaco,Consolas,"Liberation Mono","Courier New",monospace!important}.text-justify{text-align:justify!important}.text-wrap{white-space:normal!important}.text-nowrap{white-space:nowrap!important}.text-truncate{overflow:hidden;text-overflow:ellipsis;white-space:nowrap}.text-left{text-align:left!important}.text-right{text-align:right!important}.text-center{text-align:center!important}@media (min-width:576px){.text-sm-left{text-align:left!important}.text-sm-right{text-align:right!important}.text-sm-center{text-align:center!important}}@media (min-width:768px){.text-md-left{text-align:left!important}.text-md-right{text-align:right!important}.text-md-center{text-align:center!important}}@media (min-width:992px){.text-lg-left{text-align:left!important}.text-lg-right{text-align:right!important}.text-lg-center{text-align:center!important}}@media (min-width:1200px){.text-xl-left{text-align:left!important}.text-xl-right{text-align:right!important}.text-xl-center{text-align:center!important}}.text-lowercase{text-transform:lowercase!important}.text-uppercase{text-transform:uppercase!important}.text-capitalize{text-transform:capitalize!important}.font-weight-light{font-weight:300!important}.font-weight-lighter{font-weight:lighter!important}.font-weight-normal{font-weight:400!important}.font-weight-bold{font-weight:700!important}.font-weight-bolder{font-weight:bolder!important}.font-italic{font-style:italic!important}.text-white{color:#fff!important}.text-primary{color:#007bff!important}a.text-primary:focus,a.text-primary:hover{color:#0056b3!important}.text-secondary{color:#6c757d!important}a.text-secondary:focus,a.text-secondary:hover{color:#494f54!important}.text-success{color:#28a745!important}a.text-success:focus,a.text-success:hover{color:#19692c!important}.text-info{color:#17a2b8!important}a.text-info:focus,a.text-info:hover{color:#0f6674!important}.text-warning{color:#ffc107!important}a.text-warning:focus,a.text-warning:hover{color:#ba8b00!important}.text-danger{color:#dc3545!important}a.text-danger:focus,a.text-danger:hover{color:#a71d2a!important}.text-light{color:#f8f9fa!important}a.text-light:focus,a.text-light:hover{color:#cbd3da!important}.text-dark{color:#343a40!important}a.text-dark:focus,a.text-dark:hover{color:#121416!important}.text-body{color:#212529!important}.text-muted{color:#6c757d!important}.text-black-50{color:rgba(0,0,0,.5)!important}.text-white-50{color:rgba(255,255,255,.5)!important}.text-hide{font:0/0 a;color:transparent;text-shadow:none;background-color:transparent;border:0}.text-decoration-none{text-decoration:none!important}.text-break{word-break:break-word!important;word-wrap:break-word!important}.text-reset{color:inherit!important}.visible{visibility:visible!important}.invisible{visibility:hidden!important}@media print{*,::after,::before{text-shadow:none!important;box-shadow:none!important}a:not(.btn){text-decoration:underline}abbr[title]::after{content:" (" attr(title) ")"}pre{white-space:pre-wrap!important}blockquote,pre{border:1px solid #adb5bd;page-break-inside:avoid}thead{display:table-header-group}img,tr{page-break-inside:avoid}h2,h3,p{orphans:3;widows:3}h2,h3{page-break-after:avoid}@page{size:a3}body{min-width:992px!important}.container{min-width:992px!important}.navbar{display:none}.badge{border:1px solid #000}.table{border-collapse:collapse!important}.table td,.table th{background-color:#fff!important}.table-bordered td,.table-bordered th{border:1px solid #dee2e6!important}.table-dark{color:inherit}.table-dark tbody+tbody,.table-dark td,.table-dark th,.table-dark thead th{border-color:#dee2e6}.table .thead-dark th{color:inherit;border-color:#dee2e6}} +/*# sourceMappingURL=bootstrap.min.css.map */ \ No newline at end of file diff --git a/assets/css/fontawesome-all.min.css b/assets/css/fontawesome-all.min.css new file mode 100644 index 0000000000..7404573ebc --- /dev/null +++ b/assets/css/fontawesome-all.min.css @@ -0,0 +1,6 @@ +/*! + * Font Awesome Free 6.1.1 by @fontawesome - https://fontawesome.com + * License - https://fontawesome.com/license/free (Icons: CC BY 4.0, Fonts: SIL OFL 1.1, Code: MIT License) + * Copyright 2022 Fonticons, Inc. + */ + .fa{font-family:var(--fa-style-family,"Font Awesome 6 Free");font-weight:var(--fa-style,900)}.fa,.fa-brands,.fa-duotone,.fa-light,.fa-regular,.fa-solid,.fa-thin,.fab,.fad,.fal,.far,.fas,.fat{-moz-osx-font-smoothing:grayscale;-webkit-font-smoothing:antialiased;display:var(--fa-display,inline-block);font-style:normal;font-variant:normal;line-height:1;text-rendering:auto}.fa-1x{font-size:1em}.fa-2x{font-size:2em}.fa-3x{font-size:3em}.fa-4x{font-size:4em}.fa-5x{font-size:5em}.fa-6x{font-size:6em}.fa-7x{font-size:7em}.fa-8x{font-size:8em}.fa-9x{font-size:9em}.fa-10x{font-size:10em}.fa-2xs{font-size:.625em;line-height:.1em;vertical-align:.225em}.fa-xs{font-size:.75em;line-height:.08333em;vertical-align:.125em}.fa-sm{font-size:.875em;line-height:.07143em;vertical-align:.05357em}.fa-lg{font-size:1.25em;line-height:.05em;vertical-align:-.075em}.fa-xl{font-size:1.5em;line-height:.04167em;vertical-align:-.125em}.fa-2xl{font-size:2em;line-height:.03125em;vertical-align:-.1875em}.fa-fw{text-align:center;width:1.25em}.fa-ul{list-style-type:none;margin-left:var(--fa-li-margin,2.5em);padding-left:0}.fa-ul>li{position:relative}.fa-li{left:calc(var(--fa-li-width, 2em)*-1);position:absolute;text-align:center;width:var(--fa-li-width,2em);line-height:inherit}.fa-border{border-radius:var(--fa-border-radius,.1em);border:var(--fa-border-width,.08em) var(--fa-border-style,solid) var(--fa-border-color,#eee);padding:var(--fa-border-padding,.2em .25em .15em)}.fa-pull-left{float:left;margin-right:var(--fa-pull-margin,.3em)}.fa-pull-right{float:right;margin-left:var(--fa-pull-margin,.3em)}.fa-beat{-webkit-animation-name:fa-beat;animation-name:fa-beat;-webkit-animation-delay:var(--fa-animation-delay,0);animation-delay:var(--fa-animation-delay,0);-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal);-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,ease-in-out);animation-timing-function:var(--fa-animation-timing,ease-in-out)}.fa-bounce{-webkit-animation-name:fa-bounce;animation-name:fa-bounce;-webkit-animation-delay:var(--fa-animation-delay,0);animation-delay:var(--fa-animation-delay,0);-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal);-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,cubic-bezier(.28,.84,.42,1));animation-timing-function:var(--fa-animation-timing,cubic-bezier(.28,.84,.42,1))}.fa-fade{-webkit-animation-name:fa-fade;animation-name:fa-fade;-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,cubic-bezier(.4,0,.6,1));animation-timing-function:var(--fa-animation-timing,cubic-bezier(.4,0,.6,1))}.fa-beat-fade,.fa-fade{-webkit-animation-delay:var(--fa-animation-delay,0);animation-delay:var(--fa-animation-delay,0);-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal);-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s)}.fa-beat-fade{-webkit-animation-name:fa-beat-fade;animation-name:fa-beat-fade;-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,cubic-bezier(.4,0,.6,1));animation-timing-function:var(--fa-animation-timing,cubic-bezier(.4,0,.6,1))}.fa-flip{-webkit-animation-name:fa-flip;animation-name:fa-flip;-webkit-animation-delay:var(--fa-animation-delay,0);animation-delay:var(--fa-animation-delay,0);-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal);-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,ease-in-out);animation-timing-function:var(--fa-animation-timing,ease-in-out)}.fa-shake{-webkit-animation-name:fa-shake;animation-name:fa-shake;-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,linear);animation-timing-function:var(--fa-animation-timing,linear)}.fa-shake,.fa-spin{-webkit-animation-delay:var(--fa-animation-delay,0);animation-delay:var(--fa-animation-delay,0);-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal)}.fa-spin{-webkit-animation-name:fa-spin;animation-name:fa-spin;-webkit-animation-duration:var(--fa-animation-duration,2s);animation-duration:var(--fa-animation-duration,2s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,linear);animation-timing-function:var(--fa-animation-timing,linear)}.fa-spin-reverse{--fa-animation-direction:reverse}.fa-pulse,.fa-spin-pulse{-webkit-animation-name:fa-spin;animation-name:fa-spin;-webkit-animation-direction:var(--fa-animation-direction,normal);animation-direction:var(--fa-animation-direction,normal);-webkit-animation-duration:var(--fa-animation-duration,1s);animation-duration:var(--fa-animation-duration,1s);-webkit-animation-iteration-count:var(--fa-animation-iteration-count,infinite);animation-iteration-count:var(--fa-animation-iteration-count,infinite);-webkit-animation-timing-function:var(--fa-animation-timing,steps(8));animation-timing-function:var(--fa-animation-timing,steps(8))}@media (prefers-reduced-motion:reduce){.fa-beat,.fa-beat-fade,.fa-bounce,.fa-fade,.fa-flip,.fa-pulse,.fa-shake,.fa-spin,.fa-spin-pulse{-webkit-animation-delay:-1ms;animation-delay:-1ms;-webkit-animation-duration:1ms;animation-duration:1ms;-webkit-animation-iteration-count:1;animation-iteration-count:1;transition-delay:0s;transition-duration:0s}}@-webkit-keyframes fa-beat{0%,90%{-webkit-transform:scale(1);transform:scale(1)}45%{-webkit-transform:scale(var(--fa-beat-scale,1.25));transform:scale(var(--fa-beat-scale,1.25))}}@keyframes fa-beat{0%,90%{-webkit-transform:scale(1);transform:scale(1)}45%{-webkit-transform:scale(var(--fa-beat-scale,1.25));transform:scale(var(--fa-beat-scale,1.25))}}@-webkit-keyframes fa-bounce{0%{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}10%{-webkit-transform:scale(var(--fa-bounce-start-scale-x,1.1),var(--fa-bounce-start-scale-y,.9)) translateY(0);transform:scale(var(--fa-bounce-start-scale-x,1.1),var(--fa-bounce-start-scale-y,.9)) translateY(0)}30%{-webkit-transform:scale(var(--fa-bounce-jump-scale-x,.9),var(--fa-bounce-jump-scale-y,1.1)) translateY(var(--fa-bounce-height,-.5em));transform:scale(var(--fa-bounce-jump-scale-x,.9),var(--fa-bounce-jump-scale-y,1.1)) translateY(var(--fa-bounce-height,-.5em))}50%{-webkit-transform:scale(var(--fa-bounce-land-scale-x,1.05),var(--fa-bounce-land-scale-y,.95)) translateY(0);transform:scale(var(--fa-bounce-land-scale-x,1.05),var(--fa-bounce-land-scale-y,.95)) translateY(0)}57%{-webkit-transform:scale(1) translateY(var(--fa-bounce-rebound,-.125em));transform:scale(1) translateY(var(--fa-bounce-rebound,-.125em))}64%{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}to{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}}@keyframes fa-bounce{0%{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}10%{-webkit-transform:scale(var(--fa-bounce-start-scale-x,1.1),var(--fa-bounce-start-scale-y,.9)) translateY(0);transform:scale(var(--fa-bounce-start-scale-x,1.1),var(--fa-bounce-start-scale-y,.9)) translateY(0)}30%{-webkit-transform:scale(var(--fa-bounce-jump-scale-x,.9),var(--fa-bounce-jump-scale-y,1.1)) translateY(var(--fa-bounce-height,-.5em));transform:scale(var(--fa-bounce-jump-scale-x,.9),var(--fa-bounce-jump-scale-y,1.1)) translateY(var(--fa-bounce-height,-.5em))}50%{-webkit-transform:scale(var(--fa-bounce-land-scale-x,1.05),var(--fa-bounce-land-scale-y,.95)) translateY(0);transform:scale(var(--fa-bounce-land-scale-x,1.05),var(--fa-bounce-land-scale-y,.95)) translateY(0)}57%{-webkit-transform:scale(1) translateY(var(--fa-bounce-rebound,-.125em));transform:scale(1) translateY(var(--fa-bounce-rebound,-.125em))}64%{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}to{-webkit-transform:scale(1) translateY(0);transform:scale(1) translateY(0)}}@-webkit-keyframes fa-fade{50%{opacity:var(--fa-fade-opacity,.4)}}@keyframes fa-fade{50%{opacity:var(--fa-fade-opacity,.4)}}@-webkit-keyframes fa-beat-fade{0%,to{opacity:var(--fa-beat-fade-opacity,.4);-webkit-transform:scale(1);transform:scale(1)}50%{opacity:1;-webkit-transform:scale(var(--fa-beat-fade-scale,1.125));transform:scale(var(--fa-beat-fade-scale,1.125))}}@keyframes fa-beat-fade{0%,to{opacity:var(--fa-beat-fade-opacity,.4);-webkit-transform:scale(1);transform:scale(1)}50%{opacity:1;-webkit-transform:scale(var(--fa-beat-fade-scale,1.125));transform:scale(var(--fa-beat-fade-scale,1.125))}}@-webkit-keyframes fa-flip{50%{-webkit-transform:rotate3d(var(--fa-flip-x,0),var(--fa-flip-y,1),var(--fa-flip-z,0),var(--fa-flip-angle,-180deg));transform:rotate3d(var(--fa-flip-x,0),var(--fa-flip-y,1),var(--fa-flip-z,0),var(--fa-flip-angle,-180deg))}}@keyframes fa-flip{50%{-webkit-transform:rotate3d(var(--fa-flip-x,0),var(--fa-flip-y,1),var(--fa-flip-z,0),var(--fa-flip-angle,-180deg));transform:rotate3d(var(--fa-flip-x,0),var(--fa-flip-y,1),var(--fa-flip-z,0),var(--fa-flip-angle,-180deg))}}@-webkit-keyframes fa-shake{0%{-webkit-transform:rotate(-15deg);transform:rotate(-15deg)}4%{-webkit-transform:rotate(15deg);transform:rotate(15deg)}8%,24%{-webkit-transform:rotate(-18deg);transform:rotate(-18deg)}12%,28%{-webkit-transform:rotate(18deg);transform:rotate(18deg)}16%{-webkit-transform:rotate(-22deg);transform:rotate(-22deg)}20%{-webkit-transform:rotate(22deg);transform:rotate(22deg)}32%{-webkit-transform:rotate(-12deg);transform:rotate(-12deg)}36%{-webkit-transform:rotate(12deg);transform:rotate(12deg)}40%,to{-webkit-transform:rotate(0deg);transform:rotate(0deg)}}@keyframes fa-shake{0%{-webkit-transform:rotate(-15deg);transform:rotate(-15deg)}4%{-webkit-transform:rotate(15deg);transform:rotate(15deg)}8%,24%{-webkit-transform:rotate(-18deg);transform:rotate(-18deg)}12%,28%{-webkit-transform:rotate(18deg);transform:rotate(18deg)}16%{-webkit-transform:rotate(-22deg);transform:rotate(-22deg)}20%{-webkit-transform:rotate(22deg);transform:rotate(22deg)}32%{-webkit-transform:rotate(-12deg);transform:rotate(-12deg)}36%{-webkit-transform:rotate(12deg);transform:rotate(12deg)}40%,to{-webkit-transform:rotate(0deg);transform:rotate(0deg)}}@-webkit-keyframes fa-spin{0%{-webkit-transform:rotate(0deg);transform:rotate(0deg)}to{-webkit-transform:rotate(1turn);transform:rotate(1turn)}}@keyframes fa-spin{0%{-webkit-transform:rotate(0deg);transform:rotate(0deg)}to{-webkit-transform:rotate(1turn);transform:rotate(1turn)}}.fa-rotate-90{-webkit-transform:rotate(90deg);transform:rotate(90deg)}.fa-rotate-180{-webkit-transform:rotate(180deg);transform:rotate(180deg)}.fa-rotate-270{-webkit-transform:rotate(270deg);transform:rotate(270deg)}.fa-flip-horizontal{-webkit-transform:scaleX(-1);transform:scaleX(-1)}.fa-flip-vertical{-webkit-transform:scaleY(-1);transform:scaleY(-1)}.fa-flip-both,.fa-flip-horizontal.fa-flip-vertical{-webkit-transform:scale(-1);transform:scale(-1)}.fa-rotate-by{-webkit-transform:rotate(var(--fa-rotate-angle,none));transform:rotate(var(--fa-rotate-angle,none))}.fa-stack{display:inline-block;height:2em;line-height:2em;position:relative;vertical-align:middle;width:2.5em}.fa-stack-1x,.fa-stack-2x{left:0;position:absolute;text-align:center;width:100%;z-index:var(--fa-stack-z-index,auto)}.fa-stack-1x{line-height:inherit}.fa-stack-2x{font-size:2em}.fa-inverse{color:var(--fa-inverse,#fff)}.fa-0:before{content:"\30"}.fa-1:before{content:"\31"}.fa-2:before{content:"\32"}.fa-3:before{content:"\33"}.fa-4:before{content:"\34"}.fa-5:before{content:"\35"}.fa-6:before{content:"\36"}.fa-7:before{content:"\37"}.fa-8:before{content:"\38"}.fa-9:before{content:"\39"}.fa-a:before{content:"\41"}.fa-address-book:before,.fa-contact-book:before{content:"\f2b9"}.fa-address-card:before,.fa-contact-card:before,.fa-vcard:before{content:"\f2bb"}.fa-align-center:before{content:"\f037"}.fa-align-justify:before{content:"\f039"}.fa-align-left:before{content:"\f036"}.fa-align-right:before{content:"\f038"}.fa-anchor:before{content:"\f13d"}.fa-anchor-circle-check:before{content:"\e4aa"}.fa-anchor-circle-exclamation:before{content:"\e4ab"}.fa-anchor-circle-xmark:before{content:"\e4ac"}.fa-anchor-lock:before{content:"\e4ad"}.fa-angle-down:before{content:"\f107"}.fa-angle-left:before{content:"\f104"}.fa-angle-right:before{content:"\f105"}.fa-angle-up:before{content:"\f106"}.fa-angle-double-down:before,.fa-angles-down:before{content:"\f103"}.fa-angle-double-left:before,.fa-angles-left:before{content:"\f100"}.fa-angle-double-right:before,.fa-angles-right:before{content:"\f101"}.fa-angle-double-up:before,.fa-angles-up:before{content:"\f102"}.fa-ankh:before{content:"\f644"}.fa-apple-alt:before,.fa-apple-whole:before{content:"\f5d1"}.fa-archway:before{content:"\f557"}.fa-arrow-down:before{content:"\f063"}.fa-arrow-down-1-9:before,.fa-sort-numeric-asc:before,.fa-sort-numeric-down:before{content:"\f162"}.fa-arrow-down-9-1:before,.fa-sort-numeric-desc:before,.fa-sort-numeric-down-alt:before{content:"\f886"}.fa-arrow-down-a-z:before,.fa-sort-alpha-asc:before,.fa-sort-alpha-down:before{content:"\f15d"}.fa-arrow-down-long:before,.fa-long-arrow-down:before{content:"\f175"}.fa-arrow-down-short-wide:before,.fa-sort-amount-desc:before,.fa-sort-amount-down-alt:before{content:"\f884"}.fa-arrow-down-up-across-line:before{content:"\e4af"}.fa-arrow-down-up-lock:before{content:"\e4b0"}.fa-arrow-down-wide-short:before,.fa-sort-amount-asc:before,.fa-sort-amount-down:before{content:"\f160"}.fa-arrow-down-z-a:before,.fa-sort-alpha-desc:before,.fa-sort-alpha-down-alt:before{content:"\f881"}.fa-arrow-left:before{content:"\f060"}.fa-arrow-left-long:before,.fa-long-arrow-left:before{content:"\f177"}.fa-arrow-pointer:before,.fa-mouse-pointer:before{content:"\f245"}.fa-arrow-right:before{content:"\f061"}.fa-arrow-right-arrow-left:before,.fa-exchange:before{content:"\f0ec"}.fa-arrow-right-from-bracket:before,.fa-sign-out:before{content:"\f08b"}.fa-arrow-right-long:before,.fa-long-arrow-right:before{content:"\f178"}.fa-arrow-right-to-bracket:before,.fa-sign-in:before{content:"\f090"}.fa-arrow-right-to-city:before{content:"\e4b3"}.fa-arrow-left-rotate:before,.fa-arrow-rotate-back:before,.fa-arrow-rotate-backward:before,.fa-arrow-rotate-left:before,.fa-undo:before{content:"\f0e2"}.fa-arrow-right-rotate:before,.fa-arrow-rotate-forward:before,.fa-arrow-rotate-right:before,.fa-redo:before{content:"\f01e"}.fa-arrow-trend-down:before{content:"\e097"}.fa-arrow-trend-up:before{content:"\e098"}.fa-arrow-turn-down:before,.fa-level-down:before{content:"\f149"}.fa-arrow-turn-up:before,.fa-level-up:before{content:"\f148"}.fa-arrow-up:before{content:"\f062"}.fa-arrow-up-1-9:before,.fa-sort-numeric-up:before{content:"\f163"}.fa-arrow-up-9-1:before,.fa-sort-numeric-up-alt:before{content:"\f887"}.fa-arrow-up-a-z:before,.fa-sort-alpha-up:before{content:"\f15e"}.fa-arrow-up-from-bracket:before{content:"\e09a"}.fa-arrow-up-from-ground-water:before{content:"\e4b5"}.fa-arrow-up-from-water-pump:before{content:"\e4b6"}.fa-arrow-up-long:before,.fa-long-arrow-up:before{content:"\f176"}.fa-arrow-up-right-dots:before{content:"\e4b7"}.fa-arrow-up-right-from-square:before,.fa-external-link:before{content:"\f08e"}.fa-arrow-up-short-wide:before,.fa-sort-amount-up-alt:before{content:"\f885"}.fa-arrow-up-wide-short:before,.fa-sort-amount-up:before{content:"\f161"}.fa-arrow-up-z-a:before,.fa-sort-alpha-up-alt:before{content:"\f882"}.fa-arrows-down-to-line:before{content:"\e4b8"}.fa-arrows-down-to-people:before{content:"\e4b9"}.fa-arrows-h:before,.fa-arrows-left-right:before{content:"\f07e"}.fa-arrows-left-right-to-line:before{content:"\e4ba"}.fa-arrows-rotate:before,.fa-refresh:before,.fa-sync:before{content:"\f021"}.fa-arrows-spin:before{content:"\e4bb"}.fa-arrows-split-up-and-left:before{content:"\e4bc"}.fa-arrows-to-circle:before{content:"\e4bd"}.fa-arrows-to-dot:before{content:"\e4be"}.fa-arrows-to-eye:before{content:"\e4bf"}.fa-arrows-turn-right:before{content:"\e4c0"}.fa-arrows-turn-to-dots:before{content:"\e4c1"}.fa-arrows-up-down:before,.fa-arrows-v:before{content:"\f07d"}.fa-arrows-up-down-left-right:before,.fa-arrows:before{content:"\f047"}.fa-arrows-up-to-line:before{content:"\e4c2"}.fa-asterisk:before{content:"\2a"}.fa-at:before{content:"\40"}.fa-atom:before{content:"\f5d2"}.fa-audio-description:before{content:"\f29e"}.fa-austral-sign:before{content:"\e0a9"}.fa-award:before{content:"\f559"}.fa-b:before{content:"\42"}.fa-baby:before{content:"\f77c"}.fa-baby-carriage:before,.fa-carriage-baby:before{content:"\f77d"}.fa-backward:before{content:"\f04a"}.fa-backward-fast:before,.fa-fast-backward:before{content:"\f049"}.fa-backward-step:before,.fa-step-backward:before{content:"\f048"}.fa-bacon:before{content:"\f7e5"}.fa-bacteria:before{content:"\e059"}.fa-bacterium:before{content:"\e05a"}.fa-bag-shopping:before,.fa-shopping-bag:before{content:"\f290"}.fa-bahai:before{content:"\f666"}.fa-baht-sign:before{content:"\e0ac"}.fa-ban:before,.fa-cancel:before{content:"\f05e"}.fa-ban-smoking:before,.fa-smoking-ban:before{content:"\f54d"}.fa-band-aid:before,.fa-bandage:before{content:"\f462"}.fa-barcode:before{content:"\f02a"}.fa-bars:before,.fa-navicon:before{content:"\f0c9"}.fa-bars-progress:before,.fa-tasks-alt:before{content:"\f828"}.fa-bars-staggered:before,.fa-reorder:before,.fa-stream:before{content:"\f550"}.fa-baseball-ball:before,.fa-baseball:before{content:"\f433"}.fa-baseball-bat-ball:before{content:"\f432"}.fa-basket-shopping:before,.fa-shopping-basket:before{content:"\f291"}.fa-basketball-ball:before,.fa-basketball:before{content:"\f434"}.fa-bath:before,.fa-bathtub:before{content:"\f2cd"}.fa-battery-0:before,.fa-battery-empty:before{content:"\f244"}.fa-battery-5:before,.fa-battery-full:before,.fa-battery:before{content:"\f240"}.fa-battery-3:before,.fa-battery-half:before{content:"\f242"}.fa-battery-2:before,.fa-battery-quarter:before{content:"\f243"}.fa-battery-4:before,.fa-battery-three-quarters:before{content:"\f241"}.fa-bed:before{content:"\f236"}.fa-bed-pulse:before,.fa-procedures:before{content:"\f487"}.fa-beer-mug-empty:before,.fa-beer:before{content:"\f0fc"}.fa-bell:before{content:"\f0f3"}.fa-bell-concierge:before,.fa-concierge-bell:before{content:"\f562"}.fa-bell-slash:before{content:"\f1f6"}.fa-bezier-curve:before{content:"\f55b"}.fa-bicycle:before{content:"\f206"}.fa-binoculars:before{content:"\f1e5"}.fa-biohazard:before{content:"\f780"}.fa-bitcoin-sign:before{content:"\e0b4"}.fa-blender:before{content:"\f517"}.fa-blender-phone:before{content:"\f6b6"}.fa-blog:before{content:"\f781"}.fa-bold:before{content:"\f032"}.fa-bolt:before,.fa-zap:before{content:"\f0e7"}.fa-bolt-lightning:before{content:"\e0b7"}.fa-bomb:before{content:"\f1e2"}.fa-bone:before{content:"\f5d7"}.fa-bong:before{content:"\f55c"}.fa-book:before{content:"\f02d"}.fa-atlas:before,.fa-book-atlas:before{content:"\f558"}.fa-bible:before,.fa-book-bible:before{content:"\f647"}.fa-book-bookmark:before{content:"\e0bb"}.fa-book-journal-whills:before,.fa-journal-whills:before{content:"\f66a"}.fa-book-medical:before{content:"\f7e6"}.fa-book-open:before{content:"\f518"}.fa-book-open-reader:before,.fa-book-reader:before{content:"\f5da"}.fa-book-quran:before,.fa-quran:before{content:"\f687"}.fa-book-dead:before,.fa-book-skull:before{content:"\f6b7"}.fa-bookmark:before{content:"\f02e"}.fa-border-all:before{content:"\f84c"}.fa-border-none:before{content:"\f850"}.fa-border-style:before,.fa-border-top-left:before{content:"\f853"}.fa-bore-hole:before{content:"\e4c3"}.fa-bottle-droplet:before{content:"\e4c4"}.fa-bottle-water:before{content:"\e4c5"}.fa-bowl-food:before{content:"\e4c6"}.fa-bowl-rice:before{content:"\e2eb"}.fa-bowling-ball:before{content:"\f436"}.fa-box:before{content:"\f466"}.fa-archive:before,.fa-box-archive:before{content:"\f187"}.fa-box-open:before{content:"\f49e"}.fa-box-tissue:before{content:"\e05b"}.fa-boxes-packing:before{content:"\e4c7"}.fa-boxes-alt:before,.fa-boxes-stacked:before,.fa-boxes:before{content:"\f468"}.fa-braille:before{content:"\f2a1"}.fa-brain:before{content:"\f5dc"}.fa-brazilian-real-sign:before{content:"\e46c"}.fa-bread-slice:before{content:"\f7ec"}.fa-bridge:before{content:"\e4c8"}.fa-bridge-circle-check:before{content:"\e4c9"}.fa-bridge-circle-exclamation:before{content:"\e4ca"}.fa-bridge-circle-xmark:before{content:"\e4cb"}.fa-bridge-lock:before{content:"\e4cc"}.fa-bridge-water:before{content:"\e4ce"}.fa-briefcase:before{content:"\f0b1"}.fa-briefcase-medical:before{content:"\f469"}.fa-broom:before{content:"\f51a"}.fa-broom-ball:before,.fa-quidditch-broom-ball:before,.fa-quidditch:before{content:"\f458"}.fa-brush:before{content:"\f55d"}.fa-bucket:before{content:"\e4cf"}.fa-bug:before{content:"\f188"}.fa-bug-slash:before{content:"\e490"}.fa-bugs:before{content:"\e4d0"}.fa-building:before{content:"\f1ad"}.fa-building-circle-arrow-right:before{content:"\e4d1"}.fa-building-circle-check:before{content:"\e4d2"}.fa-building-circle-exclamation:before{content:"\e4d3"}.fa-building-circle-xmark:before{content:"\e4d4"}.fa-bank:before,.fa-building-columns:before,.fa-institution:before,.fa-museum:before,.fa-university:before{content:"\f19c"}.fa-building-flag:before{content:"\e4d5"}.fa-building-lock:before{content:"\e4d6"}.fa-building-ngo:before{content:"\e4d7"}.fa-building-shield:before{content:"\e4d8"}.fa-building-un:before{content:"\e4d9"}.fa-building-user:before{content:"\e4da"}.fa-building-wheat:before{content:"\e4db"}.fa-bullhorn:before{content:"\f0a1"}.fa-bullseye:before{content:"\f140"}.fa-burger:before,.fa-hamburger:before{content:"\f805"}.fa-burst:before{content:"\e4dc"}.fa-bus:before{content:"\f207"}.fa-bus-alt:before,.fa-bus-simple:before{content:"\f55e"}.fa-briefcase-clock:before,.fa-business-time:before{content:"\f64a"}.fa-c:before{content:"\43"}.fa-birthday-cake:before,.fa-cake-candles:before,.fa-cake:before{content:"\f1fd"}.fa-calculator:before{content:"\f1ec"}.fa-calendar:before{content:"\f133"}.fa-calendar-check:before{content:"\f274"}.fa-calendar-day:before{content:"\f783"}.fa-calendar-alt:before,.fa-calendar-days:before{content:"\f073"}.fa-calendar-minus:before{content:"\f272"}.fa-calendar-plus:before{content:"\f271"}.fa-calendar-week:before{content:"\f784"}.fa-calendar-times:before,.fa-calendar-xmark:before{content:"\f273"}.fa-camera-alt:before,.fa-camera:before{content:"\f030"}.fa-camera-retro:before{content:"\f083"}.fa-camera-rotate:before{content:"\e0d8"}.fa-campground:before{content:"\f6bb"}.fa-candy-cane:before{content:"\f786"}.fa-cannabis:before{content:"\f55f"}.fa-capsules:before{content:"\f46b"}.fa-automobile:before,.fa-car:before{content:"\f1b9"}.fa-battery-car:before,.fa-car-battery:before{content:"\f5df"}.fa-car-burst:before,.fa-car-crash:before{content:"\f5e1"}.fa-car-on:before{content:"\e4dd"}.fa-car-alt:before,.fa-car-rear:before{content:"\f5de"}.fa-car-side:before{content:"\f5e4"}.fa-car-tunnel:before{content:"\e4de"}.fa-caravan:before{content:"\f8ff"}.fa-caret-down:before{content:"\f0d7"}.fa-caret-left:before{content:"\f0d9"}.fa-caret-right:before{content:"\f0da"}.fa-caret-up:before{content:"\f0d8"}.fa-carrot:before{content:"\f787"}.fa-cart-arrow-down:before{content:"\f218"}.fa-cart-flatbed:before,.fa-dolly-flatbed:before{content:"\f474"}.fa-cart-flatbed-suitcase:before,.fa-luggage-cart:before{content:"\f59d"}.fa-cart-plus:before{content:"\f217"}.fa-cart-shopping:before,.fa-shopping-cart:before{content:"\f07a"}.fa-cash-register:before{content:"\f788"}.fa-cat:before{content:"\f6be"}.fa-cedi-sign:before{content:"\e0df"}.fa-cent-sign:before{content:"\e3f5"}.fa-certificate:before{content:"\f0a3"}.fa-chair:before{content:"\f6c0"}.fa-blackboard:before,.fa-chalkboard:before{content:"\f51b"}.fa-chalkboard-teacher:before,.fa-chalkboard-user:before{content:"\f51c"}.fa-champagne-glasses:before,.fa-glass-cheers:before{content:"\f79f"}.fa-charging-station:before{content:"\f5e7"}.fa-area-chart:before,.fa-chart-area:before{content:"\f1fe"}.fa-bar-chart:before,.fa-chart-bar:before{content:"\f080"}.fa-chart-column:before{content:"\e0e3"}.fa-chart-gantt:before{content:"\e0e4"}.fa-chart-line:before,.fa-line-chart:before{content:"\f201"}.fa-chart-pie:before,.fa-pie-chart:before{content:"\f200"}.fa-chart-simple:before{content:"\e473"}.fa-check:before{content:"\f00c"}.fa-check-double:before{content:"\f560"}.fa-check-to-slot:before,.fa-vote-yea:before{content:"\f772"}.fa-cheese:before{content:"\f7ef"}.fa-chess:before{content:"\f439"}.fa-chess-bishop:before{content:"\f43a"}.fa-chess-board:before{content:"\f43c"}.fa-chess-king:before{content:"\f43f"}.fa-chess-knight:before{content:"\f441"}.fa-chess-pawn:before{content:"\f443"}.fa-chess-queen:before{content:"\f445"}.fa-chess-rook:before{content:"\f447"}.fa-chevron-down:before{content:"\f078"}.fa-chevron-left:before{content:"\f053"}.fa-chevron-right:before{content:"\f054"}.fa-chevron-up:before{content:"\f077"}.fa-child:before{content:"\f1ae"}.fa-child-dress:before{content:"\e59c"}.fa-child-reaching:before{content:"\e59d"}.fa-child-rifle:before{content:"\e4e0"}.fa-children:before{content:"\e4e1"}.fa-church:before{content:"\f51d"}.fa-circle:before{content:"\f111"}.fa-arrow-circle-down:before,.fa-circle-arrow-down:before{content:"\f0ab"}.fa-arrow-circle-left:before,.fa-circle-arrow-left:before{content:"\f0a8"}.fa-arrow-circle-right:before,.fa-circle-arrow-right:before{content:"\f0a9"}.fa-arrow-circle-up:before,.fa-circle-arrow-up:before{content:"\f0aa"}.fa-check-circle:before,.fa-circle-check:before{content:"\f058"}.fa-chevron-circle-down:before,.fa-circle-chevron-down:before{content:"\f13a"}.fa-chevron-circle-left:before,.fa-circle-chevron-left:before{content:"\f137"}.fa-chevron-circle-right:before,.fa-circle-chevron-right:before{content:"\f138"}.fa-chevron-circle-up:before,.fa-circle-chevron-up:before{content:"\f139"}.fa-circle-dollar-to-slot:before,.fa-donate:before{content:"\f4b9"}.fa-circle-dot:before,.fa-dot-circle:before{content:"\f192"}.fa-arrow-alt-circle-down:before,.fa-circle-down:before{content:"\f358"}.fa-circle-exclamation:before,.fa-exclamation-circle:before{content:"\f06a"}.fa-circle-h:before,.fa-hospital-symbol:before{content:"\f47e"}.fa-adjust:before,.fa-circle-half-stroke:before{content:"\f042"}.fa-circle-info:before,.fa-info-circle:before{content:"\f05a"}.fa-arrow-alt-circle-left:before,.fa-circle-left:before{content:"\f359"}.fa-circle-minus:before,.fa-minus-circle:before{content:"\f056"}.fa-circle-nodes:before{content:"\e4e2"}.fa-circle-notch:before{content:"\f1ce"}.fa-circle-pause:before,.fa-pause-circle:before{content:"\f28b"}.fa-circle-play:before,.fa-play-circle:before{content:"\f144"}.fa-circle-plus:before,.fa-plus-circle:before{content:"\f055"}.fa-circle-question:before,.fa-question-circle:before{content:"\f059"}.fa-circle-radiation:before,.fa-radiation-alt:before{content:"\f7ba"}.fa-arrow-alt-circle-right:before,.fa-circle-right:before{content:"\f35a"}.fa-circle-stop:before,.fa-stop-circle:before{content:"\f28d"}.fa-arrow-alt-circle-up:before,.fa-circle-up:before{content:"\f35b"}.fa-circle-user:before,.fa-user-circle:before{content:"\f2bd"}.fa-circle-xmark:before,.fa-times-circle:before,.fa-xmark-circle:before{content:"\f057"}.fa-city:before{content:"\f64f"}.fa-clapperboard:before{content:"\e131"}.fa-clipboard:before{content:"\f328"}.fa-clipboard-check:before{content:"\f46c"}.fa-clipboard-list:before{content:"\f46d"}.fa-clipboard-question:before{content:"\e4e3"}.fa-clipboard-user:before{content:"\f7f3"}.fa-clock-four:before,.fa-clock:before{content:"\f017"}.fa-clock-rotate-left:before,.fa-history:before{content:"\f1da"}.fa-clone:before{content:"\f24d"}.fa-closed-captioning:before{content:"\f20a"}.fa-cloud:before{content:"\f0c2"}.fa-cloud-arrow-down:before,.fa-cloud-download-alt:before,.fa-cloud-download:before{content:"\f0ed"}.fa-cloud-arrow-up:before,.fa-cloud-upload-alt:before,.fa-cloud-upload:before{content:"\f0ee"}.fa-cloud-bolt:before,.fa-thunderstorm:before{content:"\f76c"}.fa-cloud-meatball:before{content:"\f73b"}.fa-cloud-moon:before{content:"\f6c3"}.fa-cloud-moon-rain:before{content:"\f73c"}.fa-cloud-rain:before{content:"\f73d"}.fa-cloud-showers-heavy:before{content:"\f740"}.fa-cloud-showers-water:before{content:"\e4e4"}.fa-cloud-sun:before{content:"\f6c4"}.fa-cloud-sun-rain:before{content:"\f743"}.fa-clover:before{content:"\e139"}.fa-code:before{content:"\f121"}.fa-code-branch:before{content:"\f126"}.fa-code-commit:before{content:"\f386"}.fa-code-compare:before{content:"\e13a"}.fa-code-fork:before{content:"\e13b"}.fa-code-merge:before{content:"\f387"}.fa-code-pull-request:before{content:"\e13c"}.fa-coins:before{content:"\f51e"}.fa-colon-sign:before{content:"\e140"}.fa-comment:before{content:"\f075"}.fa-comment-dollar:before{content:"\f651"}.fa-comment-dots:before,.fa-commenting:before{content:"\f4ad"}.fa-comment-medical:before{content:"\f7f5"}.fa-comment-slash:before{content:"\f4b3"}.fa-comment-sms:before,.fa-sms:before{content:"\f7cd"}.fa-comments:before{content:"\f086"}.fa-comments-dollar:before{content:"\f653"}.fa-compact-disc:before{content:"\f51f"}.fa-compass:before{content:"\f14e"}.fa-compass-drafting:before,.fa-drafting-compass:before{content:"\f568"}.fa-compress:before{content:"\f066"}.fa-computer:before{content:"\e4e5"}.fa-computer-mouse:before,.fa-mouse:before{content:"\f8cc"}.fa-cookie:before{content:"\f563"}.fa-cookie-bite:before{content:"\f564"}.fa-copy:before{content:"\f0c5"}.fa-copyright:before{content:"\f1f9"}.fa-couch:before{content:"\f4b8"}.fa-cow:before{content:"\f6c8"}.fa-credit-card-alt:before,.fa-credit-card:before{content:"\f09d"}.fa-crop:before{content:"\f125"}.fa-crop-alt:before,.fa-crop-simple:before{content:"\f565"}.fa-cross:before{content:"\f654"}.fa-crosshairs:before{content:"\f05b"}.fa-crow:before{content:"\f520"}.fa-crown:before{content:"\f521"}.fa-crutch:before{content:"\f7f7"}.fa-cruzeiro-sign:before{content:"\e152"}.fa-cube:before{content:"\f1b2"}.fa-cubes:before{content:"\f1b3"}.fa-cubes-stacked:before{content:"\e4e6"}.fa-d:before{content:"\44"}.fa-database:before{content:"\f1c0"}.fa-backspace:before,.fa-delete-left:before{content:"\f55a"}.fa-democrat:before{content:"\f747"}.fa-desktop-alt:before,.fa-desktop:before{content:"\f390"}.fa-dharmachakra:before{content:"\f655"}.fa-diagram-next:before{content:"\e476"}.fa-diagram-predecessor:before{content:"\e477"}.fa-diagram-project:before,.fa-project-diagram:before{content:"\f542"}.fa-diagram-successor:before{content:"\e47a"}.fa-diamond:before{content:"\f219"}.fa-diamond-turn-right:before,.fa-directions:before{content:"\f5eb"}.fa-dice:before{content:"\f522"}.fa-dice-d20:before{content:"\f6cf"}.fa-dice-d6:before{content:"\f6d1"}.fa-dice-five:before{content:"\f523"}.fa-dice-four:before{content:"\f524"}.fa-dice-one:before{content:"\f525"}.fa-dice-six:before{content:"\f526"}.fa-dice-three:before{content:"\f527"}.fa-dice-two:before{content:"\f528"}.fa-disease:before{content:"\f7fa"}.fa-display:before{content:"\e163"}.fa-divide:before{content:"\f529"}.fa-dna:before{content:"\f471"}.fa-dog:before{content:"\f6d3"}.fa-dollar-sign:before,.fa-dollar:before,.fa-usd:before{content:"\24"}.fa-dolly-box:before,.fa-dolly:before{content:"\f472"}.fa-dong-sign:before{content:"\e169"}.fa-door-closed:before{content:"\f52a"}.fa-door-open:before{content:"\f52b"}.fa-dove:before{content:"\f4ba"}.fa-compress-alt:before,.fa-down-left-and-up-right-to-center:before{content:"\f422"}.fa-down-long:before,.fa-long-arrow-alt-down:before{content:"\f309"}.fa-download:before{content:"\f019"}.fa-dragon:before{content:"\f6d5"}.fa-draw-polygon:before{content:"\f5ee"}.fa-droplet:before,.fa-tint:before{content:"\f043"}.fa-droplet-slash:before,.fa-tint-slash:before{content:"\f5c7"}.fa-drum:before{content:"\f569"}.fa-drum-steelpan:before{content:"\f56a"}.fa-drumstick-bite:before{content:"\f6d7"}.fa-dumbbell:before{content:"\f44b"}.fa-dumpster:before{content:"\f793"}.fa-dumpster-fire:before{content:"\f794"}.fa-dungeon:before{content:"\f6d9"}.fa-e:before{content:"\45"}.fa-deaf:before,.fa-deafness:before,.fa-ear-deaf:before,.fa-hard-of-hearing:before{content:"\f2a4"}.fa-assistive-listening-systems:before,.fa-ear-listen:before{content:"\f2a2"}.fa-earth-africa:before,.fa-globe-africa:before{content:"\f57c"}.fa-earth-america:before,.fa-earth-americas:before,.fa-earth:before,.fa-globe-americas:before{content:"\f57d"}.fa-earth-asia:before,.fa-globe-asia:before{content:"\f57e"}.fa-earth-europe:before,.fa-globe-europe:before{content:"\f7a2"}.fa-earth-oceania:before,.fa-globe-oceania:before{content:"\e47b"}.fa-egg:before{content:"\f7fb"}.fa-eject:before{content:"\f052"}.fa-elevator:before{content:"\e16d"}.fa-ellipsis-h:before,.fa-ellipsis:before{content:"\f141"}.fa-ellipsis-v:before,.fa-ellipsis-vertical:before{content:"\f142"}.fa-envelope:before{content:"\f0e0"}.fa-envelope-circle-check:before{content:"\e4e8"}.fa-envelope-open:before{content:"\f2b6"}.fa-envelope-open-text:before{content:"\f658"}.fa-envelopes-bulk:before,.fa-mail-bulk:before{content:"\f674"}.fa-equals:before{content:"\3d"}.fa-eraser:before{content:"\f12d"}.fa-ethernet:before{content:"\f796"}.fa-eur:before,.fa-euro-sign:before,.fa-euro:before{content:"\f153"}.fa-exclamation:before{content:"\21"}.fa-expand:before{content:"\f065"}.fa-explosion:before{content:"\e4e9"}.fa-eye:before{content:"\f06e"}.fa-eye-dropper-empty:before,.fa-eye-dropper:before,.fa-eyedropper:before{content:"\f1fb"}.fa-eye-low-vision:before,.fa-low-vision:before{content:"\f2a8"}.fa-eye-slash:before{content:"\f070"}.fa-f:before{content:"\46"}.fa-angry:before,.fa-face-angry:before{content:"\f556"}.fa-dizzy:before,.fa-face-dizzy:before{content:"\f567"}.fa-face-flushed:before,.fa-flushed:before{content:"\f579"}.fa-face-frown:before,.fa-frown:before{content:"\f119"}.fa-face-frown-open:before,.fa-frown-open:before{content:"\f57a"}.fa-face-grimace:before,.fa-grimace:before{content:"\f57f"}.fa-face-grin:before,.fa-grin:before{content:"\f580"}.fa-face-grin-beam:before,.fa-grin-beam:before{content:"\f582"}.fa-face-grin-beam-sweat:before,.fa-grin-beam-sweat:before{content:"\f583"}.fa-face-grin-hearts:before,.fa-grin-hearts:before{content:"\f584"}.fa-face-grin-squint:before,.fa-grin-squint:before{content:"\f585"}.fa-face-grin-squint-tears:before,.fa-grin-squint-tears:before{content:"\f586"}.fa-face-grin-stars:before,.fa-grin-stars:before{content:"\f587"}.fa-face-grin-tears:before,.fa-grin-tears:before{content:"\f588"}.fa-face-grin-tongue:before,.fa-grin-tongue:before{content:"\f589"}.fa-face-grin-tongue-squint:before,.fa-grin-tongue-squint:before{content:"\f58a"}.fa-face-grin-tongue-wink:before,.fa-grin-tongue-wink:before{content:"\f58b"}.fa-face-grin-wide:before,.fa-grin-alt:before{content:"\f581"}.fa-face-grin-wink:before,.fa-grin-wink:before{content:"\f58c"}.fa-face-kiss:before,.fa-kiss:before{content:"\f596"}.fa-face-kiss-beam:before,.fa-kiss-beam:before{content:"\f597"}.fa-face-kiss-wink-heart:before,.fa-kiss-wink-heart:before{content:"\f598"}.fa-face-laugh:before,.fa-laugh:before{content:"\f599"}.fa-face-laugh-beam:before,.fa-laugh-beam:before{content:"\f59a"}.fa-face-laugh-squint:before,.fa-laugh-squint:before{content:"\f59b"}.fa-face-laugh-wink:before,.fa-laugh-wink:before{content:"\f59c"}.fa-face-meh:before,.fa-meh:before{content:"\f11a"}.fa-face-meh-blank:before,.fa-meh-blank:before{content:"\f5a4"}.fa-face-rolling-eyes:before,.fa-meh-rolling-eyes:before{content:"\f5a5"}.fa-face-sad-cry:before,.fa-sad-cry:before{content:"\f5b3"}.fa-face-sad-tear:before,.fa-sad-tear:before{content:"\f5b4"}.fa-face-smile:before,.fa-smile:before{content:"\f118"}.fa-face-smile-beam:before,.fa-smile-beam:before{content:"\f5b8"}.fa-face-smile-wink:before,.fa-smile-wink:before{content:"\f4da"}.fa-face-surprise:before,.fa-surprise:before{content:"\f5c2"}.fa-face-tired:before,.fa-tired:before{content:"\f5c8"}.fa-fan:before{content:"\f863"}.fa-faucet:before{content:"\e005"}.fa-faucet-drip:before{content:"\e006"}.fa-fax:before{content:"\f1ac"}.fa-feather:before{content:"\f52d"}.fa-feather-alt:before,.fa-feather-pointed:before{content:"\f56b"}.fa-ferry:before{content:"\e4ea"}.fa-file:before{content:"\f15b"}.fa-file-arrow-down:before,.fa-file-download:before{content:"\f56d"}.fa-file-arrow-up:before,.fa-file-upload:before{content:"\f574"}.fa-file-audio:before{content:"\f1c7"}.fa-file-circle-check:before{content:"\e493"}.fa-file-circle-exclamation:before{content:"\e4eb"}.fa-file-circle-minus:before{content:"\e4ed"}.fa-file-circle-plus:before{content:"\e4ee"}.fa-file-circle-question:before{content:"\e4ef"}.fa-file-circle-xmark:before{content:"\e494"}.fa-file-code:before{content:"\f1c9"}.fa-file-contract:before{content:"\f56c"}.fa-file-csv:before{content:"\f6dd"}.fa-file-excel:before{content:"\f1c3"}.fa-arrow-right-from-file:before,.fa-file-export:before{content:"\f56e"}.fa-file-image:before{content:"\f1c5"}.fa-arrow-right-to-file:before,.fa-file-import:before{content:"\f56f"}.fa-file-invoice:before{content:"\f570"}.fa-file-invoice-dollar:before{content:"\f571"}.fa-file-alt:before,.fa-file-lines:before,.fa-file-text:before{content:"\f15c"}.fa-file-medical:before{content:"\f477"}.fa-file-pdf:before{content:"\f1c1"}.fa-file-edit:before,.fa-file-pen:before{content:"\f31c"}.fa-file-powerpoint:before{content:"\f1c4"}.fa-file-prescription:before{content:"\f572"}.fa-file-shield:before{content:"\e4f0"}.fa-file-signature:before{content:"\f573"}.fa-file-video:before{content:"\f1c8"}.fa-file-medical-alt:before,.fa-file-waveform:before{content:"\f478"}.fa-file-word:before{content:"\f1c2"}.fa-file-archive:before,.fa-file-zipper:before{content:"\f1c6"}.fa-fill:before{content:"\f575"}.fa-fill-drip:before{content:"\f576"}.fa-film:before{content:"\f008"}.fa-filter:before{content:"\f0b0"}.fa-filter-circle-dollar:before,.fa-funnel-dollar:before{content:"\f662"}.fa-filter-circle-xmark:before{content:"\e17b"}.fa-fingerprint:before{content:"\f577"}.fa-fire:before{content:"\f06d"}.fa-fire-burner:before{content:"\e4f1"}.fa-fire-extinguisher:before{content:"\f134"}.fa-fire-alt:before,.fa-fire-flame-curved:before{content:"\f7e4"}.fa-burn:before,.fa-fire-flame-simple:before{content:"\f46a"}.fa-fish:before{content:"\f578"}.fa-fish-fins:before{content:"\e4f2"}.fa-flag:before{content:"\f024"}.fa-flag-checkered:before{content:"\f11e"}.fa-flag-usa:before{content:"\f74d"}.fa-flask:before{content:"\f0c3"}.fa-flask-vial:before{content:"\e4f3"}.fa-floppy-disk:before,.fa-save:before{content:"\f0c7"}.fa-florin-sign:before{content:"\e184"}.fa-folder-blank:before,.fa-folder:before{content:"\f07b"}.fa-folder-closed:before{content:"\e185"}.fa-folder-minus:before{content:"\f65d"}.fa-folder-open:before{content:"\f07c"}.fa-folder-plus:before{content:"\f65e"}.fa-folder-tree:before{content:"\f802"}.fa-font:before{content:"\f031"}.fa-football-ball:before,.fa-football:before{content:"\f44e"}.fa-forward:before{content:"\f04e"}.fa-fast-forward:before,.fa-forward-fast:before{content:"\f050"}.fa-forward-step:before,.fa-step-forward:before{content:"\f051"}.fa-franc-sign:before{content:"\e18f"}.fa-frog:before{content:"\f52e"}.fa-futbol-ball:before,.fa-futbol:before,.fa-soccer-ball:before{content:"\f1e3"}.fa-g:before{content:"\47"}.fa-gamepad:before{content:"\f11b"}.fa-gas-pump:before{content:"\f52f"}.fa-dashboard:before,.fa-gauge-med:before,.fa-gauge:before,.fa-tachometer-alt-average:before{content:"\f624"}.fa-gauge-high:before,.fa-tachometer-alt-fast:before,.fa-tachometer-alt:before{content:"\f625"}.fa-gauge-simple-med:before,.fa-gauge-simple:before,.fa-tachometer-average:before{content:"\f629"}.fa-gauge-simple-high:before,.fa-tachometer-fast:before,.fa-tachometer:before{content:"\f62a"}.fa-gavel:before,.fa-legal:before{content:"\f0e3"}.fa-cog:before,.fa-gear:before{content:"\f013"}.fa-cogs:before,.fa-gears:before{content:"\f085"}.fa-gem:before{content:"\f3a5"}.fa-genderless:before{content:"\f22d"}.fa-ghost:before{content:"\f6e2"}.fa-gift:before{content:"\f06b"}.fa-gifts:before{content:"\f79c"}.fa-glass-water:before{content:"\e4f4"}.fa-glass-water-droplet:before{content:"\e4f5"}.fa-glasses:before{content:"\f530"}.fa-globe:before{content:"\f0ac"}.fa-golf-ball-tee:before,.fa-golf-ball:before{content:"\f450"}.fa-gopuram:before{content:"\f664"}.fa-graduation-cap:before,.fa-mortar-board:before{content:"\f19d"}.fa-greater-than:before{content:"\3e"}.fa-greater-than-equal:before{content:"\f532"}.fa-grip-horizontal:before,.fa-grip:before{content:"\f58d"}.fa-grip-lines:before{content:"\f7a4"}.fa-grip-lines-vertical:before{content:"\f7a5"}.fa-grip-vertical:before{content:"\f58e"}.fa-group-arrows-rotate:before{content:"\e4f6"}.fa-guarani-sign:before{content:"\e19a"}.fa-guitar:before{content:"\f7a6"}.fa-gun:before{content:"\e19b"}.fa-h:before{content:"\48"}.fa-hammer:before{content:"\f6e3"}.fa-hamsa:before{content:"\f665"}.fa-hand-paper:before,.fa-hand:before{content:"\f256"}.fa-hand-back-fist:before,.fa-hand-rock:before{content:"\f255"}.fa-allergies:before,.fa-hand-dots:before{content:"\f461"}.fa-fist-raised:before,.fa-hand-fist:before{content:"\f6de"}.fa-hand-holding:before{content:"\f4bd"}.fa-hand-holding-dollar:before,.fa-hand-holding-usd:before{content:"\f4c0"}.fa-hand-holding-droplet:before,.fa-hand-holding-water:before{content:"\f4c1"}.fa-hand-holding-hand:before{content:"\e4f7"}.fa-hand-holding-heart:before{content:"\f4be"}.fa-hand-holding-medical:before{content:"\e05c"}.fa-hand-lizard:before{content:"\f258"}.fa-hand-middle-finger:before{content:"\f806"}.fa-hand-peace:before{content:"\f25b"}.fa-hand-point-down:before{content:"\f0a7"}.fa-hand-point-left:before{content:"\f0a5"}.fa-hand-point-right:before{content:"\f0a4"}.fa-hand-point-up:before{content:"\f0a6"}.fa-hand-pointer:before{content:"\f25a"}.fa-hand-scissors:before{content:"\f257"}.fa-hand-sparkles:before{content:"\e05d"}.fa-hand-spock:before{content:"\f259"}.fa-handcuffs:before{content:"\e4f8"}.fa-hands:before,.fa-sign-language:before,.fa-signing:before{content:"\f2a7"}.fa-american-sign-language-interpreting:before,.fa-asl-interpreting:before,.fa-hands-american-sign-language-interpreting:before,.fa-hands-asl-interpreting:before{content:"\f2a3"}.fa-hands-bound:before{content:"\e4f9"}.fa-hands-bubbles:before,.fa-hands-wash:before{content:"\e05e"}.fa-hands-clapping:before{content:"\e1a8"}.fa-hands-holding:before{content:"\f4c2"}.fa-hands-holding-child:before{content:"\e4fa"}.fa-hands-holding-circle:before{content:"\e4fb"}.fa-hands-praying:before,.fa-praying-hands:before{content:"\f684"}.fa-handshake:before{content:"\f2b5"}.fa-hands-helping:before,.fa-handshake-angle:before{content:"\f4c4"}.fa-handshake-alt:before,.fa-handshake-simple:before{content:"\f4c6"}.fa-handshake-alt-slash:before,.fa-handshake-simple-slash:before{content:"\e05f"}.fa-handshake-slash:before{content:"\e060"}.fa-hanukiah:before{content:"\f6e6"}.fa-hard-drive:before,.fa-hdd:before{content:"\f0a0"}.fa-hashtag:before{content:"\23"}.fa-hat-cowboy:before{content:"\f8c0"}.fa-hat-cowboy-side:before{content:"\f8c1"}.fa-hat-wizard:before{content:"\f6e8"}.fa-head-side-cough:before{content:"\e061"}.fa-head-side-cough-slash:before{content:"\e062"}.fa-head-side-mask:before{content:"\e063"}.fa-head-side-virus:before{content:"\e064"}.fa-header:before,.fa-heading:before{content:"\f1dc"}.fa-headphones:before{content:"\f025"}.fa-headphones-alt:before,.fa-headphones-simple:before{content:"\f58f"}.fa-headset:before{content:"\f590"}.fa-heart:before{content:"\f004"}.fa-heart-circle-bolt:before{content:"\e4fc"}.fa-heart-circle-check:before{content:"\e4fd"}.fa-heart-circle-exclamation:before{content:"\e4fe"}.fa-heart-circle-minus:before{content:"\e4ff"}.fa-heart-circle-plus:before{content:"\e500"}.fa-heart-circle-xmark:before{content:"\e501"}.fa-heart-broken:before,.fa-heart-crack:before{content:"\f7a9"}.fa-heart-pulse:before,.fa-heartbeat:before{content:"\f21e"}.fa-helicopter:before{content:"\f533"}.fa-helicopter-symbol:before{content:"\e502"}.fa-hard-hat:before,.fa-hat-hard:before,.fa-helmet-safety:before{content:"\f807"}.fa-helmet-un:before{content:"\e503"}.fa-highlighter:before{content:"\f591"}.fa-hill-avalanche:before{content:"\e507"}.fa-hill-rockslide:before{content:"\e508"}.fa-hippo:before{content:"\f6ed"}.fa-hockey-puck:before{content:"\f453"}.fa-holly-berry:before{content:"\f7aa"}.fa-horse:before{content:"\f6f0"}.fa-horse-head:before{content:"\f7ab"}.fa-hospital-alt:before,.fa-hospital-wide:before,.fa-hospital:before{content:"\f0f8"}.fa-hospital-user:before{content:"\f80d"}.fa-hot-tub-person:before,.fa-hot-tub:before{content:"\f593"}.fa-hotdog:before{content:"\f80f"}.fa-hotel:before{content:"\f594"}.fa-hourglass-2:before,.fa-hourglass-half:before,.fa-hourglass:before{content:"\f254"}.fa-hourglass-empty:before{content:"\f252"}.fa-hourglass-3:before,.fa-hourglass-end:before{content:"\f253"}.fa-hourglass-1:before,.fa-hourglass-start:before{content:"\f251"}.fa-home-alt:before,.fa-home-lg-alt:before,.fa-home:before,.fa-house:before{content:"\f015"}.fa-home-lg:before,.fa-house-chimney:before{content:"\e3af"}.fa-house-chimney-crack:before,.fa-house-damage:before{content:"\f6f1"}.fa-clinic-medical:before,.fa-house-chimney-medical:before{content:"\f7f2"}.fa-house-chimney-user:before{content:"\e065"}.fa-house-chimney-window:before{content:"\e00d"}.fa-house-circle-check:before{content:"\e509"}.fa-house-circle-exclamation:before{content:"\e50a"}.fa-house-circle-xmark:before{content:"\e50b"}.fa-house-crack:before{content:"\e3b1"}.fa-house-fire:before{content:"\e50c"}.fa-house-flag:before{content:"\e50d"}.fa-house-flood-water:before{content:"\e50e"}.fa-house-flood-water-circle-arrow-right:before{content:"\e50f"}.fa-house-laptop:before,.fa-laptop-house:before{content:"\e066"}.fa-house-lock:before{content:"\e510"}.fa-house-medical:before{content:"\e3b2"}.fa-house-medical-circle-check:before{content:"\e511"}.fa-house-medical-circle-exclamation:before{content:"\e512"}.fa-house-medical-circle-xmark:before{content:"\e513"}.fa-house-medical-flag:before{content:"\e514"}.fa-house-signal:before{content:"\e012"}.fa-house-tsunami:before{content:"\e515"}.fa-home-user:before,.fa-house-user:before{content:"\e1b0"}.fa-hryvnia-sign:before,.fa-hryvnia:before{content:"\f6f2"}.fa-hurricane:before{content:"\f751"}.fa-i:before{content:"\49"}.fa-i-cursor:before{content:"\f246"}.fa-ice-cream:before{content:"\f810"}.fa-icicles:before{content:"\f7ad"}.fa-heart-music-camera-bolt:before,.fa-icons:before{content:"\f86d"}.fa-id-badge:before{content:"\f2c1"}.fa-drivers-license:before,.fa-id-card:before{content:"\f2c2"}.fa-id-card-alt:before,.fa-id-card-clip:before{content:"\f47f"}.fa-igloo:before{content:"\f7ae"}.fa-image:before{content:"\f03e"}.fa-image-portrait:before,.fa-portrait:before{content:"\f3e0"}.fa-images:before{content:"\f302"}.fa-inbox:before{content:"\f01c"}.fa-indent:before{content:"\f03c"}.fa-indian-rupee-sign:before,.fa-indian-rupee:before,.fa-inr:before{content:"\e1bc"}.fa-industry:before{content:"\f275"}.fa-infinity:before{content:"\f534"}.fa-info:before{content:"\f129"}.fa-italic:before{content:"\f033"}.fa-j:before{content:"\4a"}.fa-jar:before{content:"\e516"}.fa-jar-wheat:before{content:"\e517"}.fa-jedi:before{content:"\f669"}.fa-fighter-jet:before,.fa-jet-fighter:before{content:"\f0fb"}.fa-jet-fighter-up:before{content:"\e518"}.fa-joint:before{content:"\f595"}.fa-jug-detergent:before{content:"\e519"}.fa-k:before{content:"\4b"}.fa-kaaba:before{content:"\f66b"}.fa-key:before{content:"\f084"}.fa-keyboard:before{content:"\f11c"}.fa-khanda:before{content:"\f66d"}.fa-kip-sign:before{content:"\e1c4"}.fa-first-aid:before,.fa-kit-medical:before{content:"\f479"}.fa-kitchen-set:before{content:"\e51a"}.fa-kiwi-bird:before{content:"\f535"}.fa-l:before{content:"\4c"}.fa-land-mine-on:before{content:"\e51b"}.fa-landmark:before{content:"\f66f"}.fa-landmark-alt:before,.fa-landmark-dome:before{content:"\f752"}.fa-landmark-flag:before{content:"\e51c"}.fa-language:before{content:"\f1ab"}.fa-laptop:before{content:"\f109"}.fa-laptop-code:before{content:"\f5fc"}.fa-laptop-file:before{content:"\e51d"}.fa-laptop-medical:before{content:"\f812"}.fa-lari-sign:before{content:"\e1c8"}.fa-layer-group:before{content:"\f5fd"}.fa-leaf:before{content:"\f06c"}.fa-left-long:before,.fa-long-arrow-alt-left:before{content:"\f30a"}.fa-arrows-alt-h:before,.fa-left-right:before{content:"\f337"}.fa-lemon:before{content:"\f094"}.fa-less-than:before{content:"\3c"}.fa-less-than-equal:before{content:"\f537"}.fa-life-ring:before{content:"\f1cd"}.fa-lightbulb:before{content:"\f0eb"}.fa-lines-leaning:before{content:"\e51e"}.fa-chain:before,.fa-link:before{content:"\f0c1"}.fa-chain-broken:before,.fa-chain-slash:before,.fa-link-slash:before,.fa-unlink:before{content:"\f127"}.fa-lira-sign:before{content:"\f195"}.fa-list-squares:before,.fa-list:before{content:"\f03a"}.fa-list-check:before,.fa-tasks:before{content:"\f0ae"}.fa-list-1-2:before,.fa-list-numeric:before,.fa-list-ol:before{content:"\f0cb"}.fa-list-dots:before,.fa-list-ul:before{content:"\f0ca"}.fa-litecoin-sign:before{content:"\e1d3"}.fa-location-arrow:before{content:"\f124"}.fa-location-crosshairs:before,.fa-location:before{content:"\f601"}.fa-location-dot:before,.fa-map-marker-alt:before{content:"\f3c5"}.fa-location-pin:before,.fa-map-marker:before{content:"\f041"}.fa-location-pin-lock:before{content:"\e51f"}.fa-lock:before{content:"\f023"}.fa-lock-open:before{content:"\f3c1"}.fa-locust:before{content:"\e520"}.fa-lungs:before{content:"\f604"}.fa-lungs-virus:before{content:"\e067"}.fa-m:before{content:"\4d"}.fa-magnet:before{content:"\f076"}.fa-magnifying-glass:before,.fa-search:before{content:"\f002"}.fa-magnifying-glass-arrow-right:before{content:"\e521"}.fa-magnifying-glass-chart:before{content:"\e522"}.fa-magnifying-glass-dollar:before,.fa-search-dollar:before{content:"\f688"}.fa-magnifying-glass-location:before,.fa-search-location:before{content:"\f689"}.fa-magnifying-glass-minus:before,.fa-search-minus:before{content:"\f010"}.fa-magnifying-glass-plus:before,.fa-search-plus:before{content:"\f00e"}.fa-manat-sign:before{content:"\e1d5"}.fa-map:before{content:"\f279"}.fa-map-location:before,.fa-map-marked:before{content:"\f59f"}.fa-map-location-dot:before,.fa-map-marked-alt:before{content:"\f5a0"}.fa-map-pin:before{content:"\f276"}.fa-marker:before{content:"\f5a1"}.fa-mars:before{content:"\f222"}.fa-mars-and-venus:before{content:"\f224"}.fa-mars-and-venus-burst:before{content:"\e523"}.fa-mars-double:before{content:"\f227"}.fa-mars-stroke:before{content:"\f229"}.fa-mars-stroke-h:before,.fa-mars-stroke-right:before{content:"\f22b"}.fa-mars-stroke-up:before,.fa-mars-stroke-v:before{content:"\f22a"}.fa-glass-martini-alt:before,.fa-martini-glass:before{content:"\f57b"}.fa-cocktail:before,.fa-martini-glass-citrus:before{content:"\f561"}.fa-glass-martini:before,.fa-martini-glass-empty:before{content:"\f000"}.fa-mask:before{content:"\f6fa"}.fa-mask-face:before{content:"\e1d7"}.fa-mask-ventilator:before{content:"\e524"}.fa-masks-theater:before,.fa-theater-masks:before{content:"\f630"}.fa-mattress-pillow:before{content:"\e525"}.fa-expand-arrows-alt:before,.fa-maximize:before{content:"\f31e"}.fa-medal:before{content:"\f5a2"}.fa-memory:before{content:"\f538"}.fa-menorah:before{content:"\f676"}.fa-mercury:before{content:"\f223"}.fa-comment-alt:before,.fa-message:before{content:"\f27a"}.fa-meteor:before{content:"\f753"}.fa-microchip:before{content:"\f2db"}.fa-microphone:before{content:"\f130"}.fa-microphone-alt:before,.fa-microphone-lines:before{content:"\f3c9"}.fa-microphone-alt-slash:before,.fa-microphone-lines-slash:before{content:"\f539"}.fa-microphone-slash:before{content:"\f131"}.fa-microscope:before{content:"\f610"}.fa-mill-sign:before{content:"\e1ed"}.fa-compress-arrows-alt:before,.fa-minimize:before{content:"\f78c"}.fa-minus:before,.fa-subtract:before{content:"\f068"}.fa-mitten:before{content:"\f7b5"}.fa-mobile-android:before,.fa-mobile-phone:before,.fa-mobile:before{content:"\f3ce"}.fa-mobile-button:before{content:"\f10b"}.fa-mobile-retro:before{content:"\e527"}.fa-mobile-android-alt:before,.fa-mobile-screen:before{content:"\f3cf"}.fa-mobile-alt:before,.fa-mobile-screen-button:before{content:"\f3cd"}.fa-money-bill:before{content:"\f0d6"}.fa-money-bill-1:before,.fa-money-bill-alt:before{content:"\f3d1"}.fa-money-bill-1-wave:before,.fa-money-bill-wave-alt:before{content:"\f53b"}.fa-money-bill-transfer:before{content:"\e528"}.fa-money-bill-trend-up:before{content:"\e529"}.fa-money-bill-wave:before{content:"\f53a"}.fa-money-bill-wheat:before{content:"\e52a"}.fa-money-bills:before{content:"\e1f3"}.fa-money-check:before{content:"\f53c"}.fa-money-check-alt:before,.fa-money-check-dollar:before{content:"\f53d"}.fa-monument:before{content:"\f5a6"}.fa-moon:before{content:"\f186"}.fa-mortar-pestle:before{content:"\f5a7"}.fa-mosque:before{content:"\f678"}.fa-mosquito:before{content:"\e52b"}.fa-mosquito-net:before{content:"\e52c"}.fa-motorcycle:before{content:"\f21c"}.fa-mound:before{content:"\e52d"}.fa-mountain:before{content:"\f6fc"}.fa-mountain-city:before{content:"\e52e"}.fa-mountain-sun:before{content:"\e52f"}.fa-mug-hot:before{content:"\f7b6"}.fa-coffee:before,.fa-mug-saucer:before{content:"\f0f4"}.fa-music:before{content:"\f001"}.fa-n:before{content:"\4e"}.fa-naira-sign:before{content:"\e1f6"}.fa-network-wired:before{content:"\f6ff"}.fa-neuter:before{content:"\f22c"}.fa-newspaper:before{content:"\f1ea"}.fa-not-equal:before{content:"\f53e"}.fa-note-sticky:before,.fa-sticky-note:before{content:"\f249"}.fa-notes-medical:before{content:"\f481"}.fa-o:before{content:"\4f"}.fa-object-group:before{content:"\f247"}.fa-object-ungroup:before{content:"\f248"}.fa-oil-can:before{content:"\f613"}.fa-oil-well:before{content:"\e532"}.fa-om:before{content:"\f679"}.fa-otter:before{content:"\f700"}.fa-dedent:before,.fa-outdent:before{content:"\f03b"}.fa-p:before{content:"\50"}.fa-pager:before{content:"\f815"}.fa-paint-roller:before{content:"\f5aa"}.fa-paint-brush:before,.fa-paintbrush:before{content:"\f1fc"}.fa-palette:before{content:"\f53f"}.fa-pallet:before{content:"\f482"}.fa-panorama:before{content:"\e209"}.fa-paper-plane:before{content:"\f1d8"}.fa-paperclip:before{content:"\f0c6"}.fa-parachute-box:before{content:"\f4cd"}.fa-paragraph:before{content:"\f1dd"}.fa-passport:before{content:"\f5ab"}.fa-file-clipboard:before,.fa-paste:before{content:"\f0ea"}.fa-pause:before{content:"\f04c"}.fa-paw:before{content:"\f1b0"}.fa-peace:before{content:"\f67c"}.fa-pen:before{content:"\f304"}.fa-pen-alt:before,.fa-pen-clip:before{content:"\f305"}.fa-pen-fancy:before{content:"\f5ac"}.fa-pen-nib:before{content:"\f5ad"}.fa-pen-ruler:before,.fa-pencil-ruler:before{content:"\f5ae"}.fa-edit:before,.fa-pen-to-square:before{content:"\f044"}.fa-pencil-alt:before,.fa-pencil:before{content:"\f303"}.fa-people-arrows-left-right:before,.fa-people-arrows:before{content:"\e068"}.fa-people-carry-box:before,.fa-people-carry:before{content:"\f4ce"}.fa-people-group:before{content:"\e533"}.fa-people-line:before{content:"\e534"}.fa-people-pulling:before{content:"\e535"}.fa-people-robbery:before{content:"\e536"}.fa-people-roof:before{content:"\e537"}.fa-pepper-hot:before{content:"\f816"}.fa-percent:before,.fa-percentage:before{content:"\25"}.fa-male:before,.fa-person:before{content:"\f183"}.fa-person-arrow-down-to-line:before{content:"\e538"}.fa-person-arrow-up-from-line:before{content:"\e539"}.fa-biking:before,.fa-person-biking:before{content:"\f84a"}.fa-person-booth:before{content:"\f756"}.fa-person-breastfeeding:before{content:"\e53a"}.fa-person-burst:before{content:"\e53b"}.fa-person-cane:before{content:"\e53c"}.fa-person-chalkboard:before{content:"\e53d"}.fa-person-circle-check:before{content:"\e53e"}.fa-person-circle-exclamation:before{content:"\e53f"}.fa-person-circle-minus:before{content:"\e540"}.fa-person-circle-plus:before{content:"\e541"}.fa-person-circle-question:before{content:"\e542"}.fa-person-circle-xmark:before{content:"\e543"}.fa-digging:before,.fa-person-digging:before{content:"\f85e"}.fa-diagnoses:before,.fa-person-dots-from-line:before{content:"\f470"}.fa-female:before,.fa-person-dress:before{content:"\f182"}.fa-person-dress-burst:before{content:"\e544"}.fa-person-drowning:before{content:"\e545"}.fa-person-falling:before{content:"\e546"}.fa-person-falling-burst:before{content:"\e547"}.fa-person-half-dress:before{content:"\e548"}.fa-person-harassing:before{content:"\e549"}.fa-hiking:before,.fa-person-hiking:before{content:"\f6ec"}.fa-person-military-pointing:before{content:"\e54a"}.fa-person-military-rifle:before{content:"\e54b"}.fa-person-military-to-person:before{content:"\e54c"}.fa-person-praying:before,.fa-pray:before{content:"\f683"}.fa-person-pregnant:before{content:"\e31e"}.fa-person-rays:before{content:"\e54d"}.fa-person-rifle:before{content:"\e54e"}.fa-person-running:before,.fa-running:before{content:"\f70c"}.fa-person-shelter:before{content:"\e54f"}.fa-person-skating:before,.fa-skating:before{content:"\f7c5"}.fa-person-skiing:before,.fa-skiing:before{content:"\f7c9"}.fa-person-skiing-nordic:before,.fa-skiing-nordic:before{content:"\f7ca"}.fa-person-snowboarding:before,.fa-snowboarding:before{content:"\f7ce"}.fa-person-swimming:before,.fa-swimmer:before{content:"\f5c4"}.fa-person-through-window:before{content:"\e433"}.fa-person-walking:before,.fa-walking:before{content:"\f554"}.fa-person-walking-arrow-loop-left:before{content:"\e551"}.fa-person-walking-arrow-right:before{content:"\e552"}.fa-person-walking-dashed-line-arrow-right:before{content:"\e553"}.fa-person-walking-luggage:before{content:"\e554"}.fa-blind:before,.fa-person-walking-with-cane:before{content:"\f29d"}.fa-peseta-sign:before{content:"\e221"}.fa-peso-sign:before{content:"\e222"}.fa-phone:before{content:"\f095"}.fa-phone-alt:before,.fa-phone-flip:before{content:"\f879"}.fa-phone-slash:before{content:"\f3dd"}.fa-phone-volume:before,.fa-volume-control-phone:before{content:"\f2a0"}.fa-photo-film:before,.fa-photo-video:before{content:"\f87c"}.fa-piggy-bank:before{content:"\f4d3"}.fa-pills:before{content:"\f484"}.fa-pizza-slice:before{content:"\f818"}.fa-place-of-worship:before{content:"\f67f"}.fa-plane:before{content:"\f072"}.fa-plane-arrival:before{content:"\f5af"}.fa-plane-circle-check:before{content:"\e555"}.fa-plane-circle-exclamation:before{content:"\e556"}.fa-plane-circle-xmark:before{content:"\e557"}.fa-plane-departure:before{content:"\f5b0"}.fa-plane-lock:before{content:"\e558"}.fa-plane-slash:before{content:"\e069"}.fa-plane-up:before{content:"\e22d"}.fa-plant-wilt:before{content:"\e43b"}.fa-plate-wheat:before{content:"\e55a"}.fa-play:before{content:"\f04b"}.fa-plug:before{content:"\f1e6"}.fa-plug-circle-bolt:before{content:"\e55b"}.fa-plug-circle-check:before{content:"\e55c"}.fa-plug-circle-exclamation:before{content:"\e55d"}.fa-plug-circle-minus:before{content:"\e55e"}.fa-plug-circle-plus:before{content:"\e55f"}.fa-plug-circle-xmark:before{content:"\e560"}.fa-add:before,.fa-plus:before{content:"\2b"}.fa-plus-minus:before{content:"\e43c"}.fa-podcast:before{content:"\f2ce"}.fa-poo:before{content:"\f2fe"}.fa-poo-bolt:before,.fa-poo-storm:before{content:"\f75a"}.fa-poop:before{content:"\f619"}.fa-power-off:before{content:"\f011"}.fa-prescription:before{content:"\f5b1"}.fa-prescription-bottle:before{content:"\f485"}.fa-prescription-bottle-alt:before,.fa-prescription-bottle-medical:before{content:"\f486"}.fa-print:before{content:"\f02f"}.fa-pump-medical:before{content:"\e06a"}.fa-pump-soap:before{content:"\e06b"}.fa-puzzle-piece:before{content:"\f12e"}.fa-q:before{content:"\51"}.fa-qrcode:before{content:"\f029"}.fa-question:before{content:"\3f"}.fa-quote-left-alt:before,.fa-quote-left:before{content:"\f10d"}.fa-quote-right-alt:before,.fa-quote-right:before{content:"\f10e"}.fa-r:before{content:"\52"}.fa-radiation:before{content:"\f7b9"}.fa-radio:before{content:"\f8d7"}.fa-rainbow:before{content:"\f75b"}.fa-ranking-star:before{content:"\e561"}.fa-receipt:before{content:"\f543"}.fa-record-vinyl:before{content:"\f8d9"}.fa-ad:before,.fa-rectangle-ad:before{content:"\f641"}.fa-list-alt:before,.fa-rectangle-list:before{content:"\f022"}.fa-rectangle-times:before,.fa-rectangle-xmark:before,.fa-times-rectangle:before,.fa-window-close:before{content:"\f410"}.fa-recycle:before{content:"\f1b8"}.fa-registered:before{content:"\f25d"}.fa-repeat:before{content:"\f363"}.fa-mail-reply:before,.fa-reply:before{content:"\f3e5"}.fa-mail-reply-all:before,.fa-reply-all:before{content:"\f122"}.fa-republican:before{content:"\f75e"}.fa-restroom:before{content:"\f7bd"}.fa-retweet:before{content:"\f079"}.fa-ribbon:before{content:"\f4d6"}.fa-right-from-bracket:before,.fa-sign-out-alt:before{content:"\f2f5"}.fa-exchange-alt:before,.fa-right-left:before{content:"\f362"}.fa-long-arrow-alt-right:before,.fa-right-long:before{content:"\f30b"}.fa-right-to-bracket:before,.fa-sign-in-alt:before{content:"\f2f6"}.fa-ring:before{content:"\f70b"}.fa-road:before{content:"\f018"}.fa-road-barrier:before{content:"\e562"}.fa-road-bridge:before{content:"\e563"}.fa-road-circle-check:before{content:"\e564"}.fa-road-circle-exclamation:before{content:"\e565"}.fa-road-circle-xmark:before{content:"\e566"}.fa-road-lock:before{content:"\e567"}.fa-road-spikes:before{content:"\e568"}.fa-robot:before{content:"\f544"}.fa-rocket:before{content:"\f135"}.fa-rotate:before,.fa-sync-alt:before{content:"\f2f1"}.fa-rotate-back:before,.fa-rotate-backward:before,.fa-rotate-left:before,.fa-undo-alt:before{content:"\f2ea"}.fa-redo-alt:before,.fa-rotate-forward:before,.fa-rotate-right:before{content:"\f2f9"}.fa-route:before{content:"\f4d7"}.fa-feed:before,.fa-rss:before{content:"\f09e"}.fa-rouble:before,.fa-rub:before,.fa-ruble-sign:before,.fa-ruble:before{content:"\f158"}.fa-rug:before{content:"\e569"}.fa-ruler:before{content:"\f545"}.fa-ruler-combined:before{content:"\f546"}.fa-ruler-horizontal:before{content:"\f547"}.fa-ruler-vertical:before{content:"\f548"}.fa-rupee-sign:before,.fa-rupee:before{content:"\f156"}.fa-rupiah-sign:before{content:"\e23d"}.fa-s:before{content:"\53"}.fa-sack-dollar:before{content:"\f81d"}.fa-sack-xmark:before{content:"\e56a"}.fa-sailboat:before{content:"\e445"}.fa-satellite:before{content:"\f7bf"}.fa-satellite-dish:before{content:"\f7c0"}.fa-balance-scale:before,.fa-scale-balanced:before{content:"\f24e"}.fa-balance-scale-left:before,.fa-scale-unbalanced:before{content:"\f515"}.fa-balance-scale-right:before,.fa-scale-unbalanced-flip:before{content:"\f516"}.fa-school:before{content:"\f549"}.fa-school-circle-check:before{content:"\e56b"}.fa-school-circle-exclamation:before{content:"\e56c"}.fa-school-circle-xmark:before{content:"\e56d"}.fa-school-flag:before{content:"\e56e"}.fa-school-lock:before{content:"\e56f"}.fa-cut:before,.fa-scissors:before{content:"\f0c4"}.fa-screwdriver:before{content:"\f54a"}.fa-screwdriver-wrench:before,.fa-tools:before{content:"\f7d9"}.fa-scroll:before{content:"\f70e"}.fa-scroll-torah:before,.fa-torah:before{content:"\f6a0"}.fa-sd-card:before{content:"\f7c2"}.fa-section:before{content:"\e447"}.fa-seedling:before,.fa-sprout:before{content:"\f4d8"}.fa-server:before{content:"\f233"}.fa-shapes:before,.fa-triangle-circle-square:before{content:"\f61f"}.fa-arrow-turn-right:before,.fa-mail-forward:before,.fa-share:before{content:"\f064"}.fa-share-from-square:before,.fa-share-square:before{content:"\f14d"}.fa-share-alt:before,.fa-share-nodes:before{content:"\f1e0"}.fa-sheet-plastic:before{content:"\e571"}.fa-ils:before,.fa-shekel-sign:before,.fa-shekel:before,.fa-sheqel-sign:before,.fa-sheqel:before{content:"\f20b"}.fa-shield-blank:before,.fa-shield:before{content:"\f132"}.fa-shield-cat:before{content:"\e572"}.fa-shield-dog:before{content:"\e573"}.fa-shield-alt:before,.fa-shield-halved:before{content:"\f3ed"}.fa-shield-heart:before{content:"\e574"}.fa-shield-virus:before{content:"\e06c"}.fa-ship:before{content:"\f21a"}.fa-shirt:before,.fa-t-shirt:before,.fa-tshirt:before{content:"\f553"}.fa-shoe-prints:before{content:"\f54b"}.fa-shop:before,.fa-store-alt:before{content:"\f54f"}.fa-shop-lock:before{content:"\e4a5"}.fa-shop-slash:before,.fa-store-alt-slash:before{content:"\e070"}.fa-shower:before{content:"\f2cc"}.fa-shrimp:before{content:"\e448"}.fa-random:before,.fa-shuffle:before{content:"\f074"}.fa-shuttle-space:before,.fa-space-shuttle:before{content:"\f197"}.fa-sign-hanging:before,.fa-sign:before{content:"\f4d9"}.fa-signal-5:before,.fa-signal-perfect:before,.fa-signal:before{content:"\f012"}.fa-signature:before{content:"\f5b7"}.fa-map-signs:before,.fa-signs-post:before{content:"\f277"}.fa-sim-card:before{content:"\f7c4"}.fa-sink:before{content:"\e06d"}.fa-sitemap:before{content:"\f0e8"}.fa-skull:before{content:"\f54c"}.fa-skull-crossbones:before{content:"\f714"}.fa-slash:before{content:"\f715"}.fa-sleigh:before{content:"\f7cc"}.fa-sliders-h:before,.fa-sliders:before{content:"\f1de"}.fa-smog:before{content:"\f75f"}.fa-smoking:before{content:"\f48d"}.fa-snowflake:before{content:"\f2dc"}.fa-snowman:before{content:"\f7d0"}.fa-snowplow:before{content:"\f7d2"}.fa-soap:before{content:"\e06e"}.fa-socks:before{content:"\f696"}.fa-solar-panel:before{content:"\f5ba"}.fa-sort:before,.fa-unsorted:before{content:"\f0dc"}.fa-sort-desc:before,.fa-sort-down:before{content:"\f0dd"}.fa-sort-asc:before,.fa-sort-up:before{content:"\f0de"}.fa-spa:before{content:"\f5bb"}.fa-pastafarianism:before,.fa-spaghetti-monster-flying:before{content:"\f67b"}.fa-spell-check:before{content:"\f891"}.fa-spider:before{content:"\f717"}.fa-spinner:before{content:"\f110"}.fa-splotch:before{content:"\f5bc"}.fa-spoon:before,.fa-utensil-spoon:before{content:"\f2e5"}.fa-spray-can:before{content:"\f5bd"}.fa-air-freshener:before,.fa-spray-can-sparkles:before{content:"\f5d0"}.fa-square:before{content:"\f0c8"}.fa-external-link-square:before,.fa-square-arrow-up-right:before{content:"\f14c"}.fa-caret-square-down:before,.fa-square-caret-down:before{content:"\f150"}.fa-caret-square-left:before,.fa-square-caret-left:before{content:"\f191"}.fa-caret-square-right:before,.fa-square-caret-right:before{content:"\f152"}.fa-caret-square-up:before,.fa-square-caret-up:before{content:"\f151"}.fa-check-square:before,.fa-square-check:before{content:"\f14a"}.fa-envelope-square:before,.fa-square-envelope:before{content:"\f199"}.fa-square-full:before{content:"\f45c"}.fa-h-square:before,.fa-square-h:before{content:"\f0fd"}.fa-minus-square:before,.fa-square-minus:before{content:"\f146"}.fa-square-nfi:before{content:"\e576"}.fa-parking:before,.fa-square-parking:before{content:"\f540"}.fa-pen-square:before,.fa-pencil-square:before,.fa-square-pen:before{content:"\f14b"}.fa-square-person-confined:before{content:"\e577"}.fa-phone-square:before,.fa-square-phone:before{content:"\f098"}.fa-phone-square-alt:before,.fa-square-phone-flip:before{content:"\f87b"}.fa-plus-square:before,.fa-square-plus:before{content:"\f0fe"}.fa-poll-h:before,.fa-square-poll-horizontal:before{content:"\f682"}.fa-poll:before,.fa-square-poll-vertical:before{content:"\f681"}.fa-square-root-alt:before,.fa-square-root-variable:before{content:"\f698"}.fa-rss-square:before,.fa-square-rss:before{content:"\f143"}.fa-share-alt-square:before,.fa-square-share-nodes:before{content:"\f1e1"}.fa-external-link-square-alt:before,.fa-square-up-right:before{content:"\f360"}.fa-square-virus:before{content:"\e578"}.fa-square-xmark:before,.fa-times-square:before,.fa-xmark-square:before{content:"\f2d3"}.fa-rod-asclepius:before,.fa-rod-snake:before,.fa-staff-aesculapius:before,.fa-staff-snake:before{content:"\e579"}.fa-stairs:before{content:"\e289"}.fa-stamp:before{content:"\f5bf"}.fa-star:before{content:"\f005"}.fa-star-and-crescent:before{content:"\f699"}.fa-star-half:before{content:"\f089"}.fa-star-half-alt:before,.fa-star-half-stroke:before{content:"\f5c0"}.fa-star-of-david:before{content:"\f69a"}.fa-star-of-life:before{content:"\f621"}.fa-gbp:before,.fa-pound-sign:before,.fa-sterling-sign:before{content:"\f154"}.fa-stethoscope:before{content:"\f0f1"}.fa-stop:before{content:"\f04d"}.fa-stopwatch:before{content:"\f2f2"}.fa-stopwatch-20:before{content:"\e06f"}.fa-store:before{content:"\f54e"}.fa-store-slash:before{content:"\e071"}.fa-street-view:before{content:"\f21d"}.fa-strikethrough:before{content:"\f0cc"}.fa-stroopwafel:before{content:"\f551"}.fa-subscript:before{content:"\f12c"}.fa-suitcase:before{content:"\f0f2"}.fa-medkit:before,.fa-suitcase-medical:before{content:"\f0fa"}.fa-suitcase-rolling:before{content:"\f5c1"}.fa-sun:before{content:"\f185"}.fa-sun-plant-wilt:before{content:"\e57a"}.fa-superscript:before{content:"\f12b"}.fa-swatchbook:before{content:"\f5c3"}.fa-synagogue:before{content:"\f69b"}.fa-syringe:before{content:"\f48e"}.fa-t:before{content:"\54"}.fa-table:before{content:"\f0ce"}.fa-table-cells:before,.fa-th:before{content:"\f00a"}.fa-table-cells-large:before,.fa-th-large:before{content:"\f009"}.fa-columns:before,.fa-table-columns:before{content:"\f0db"}.fa-table-list:before,.fa-th-list:before{content:"\f00b"}.fa-ping-pong-paddle-ball:before,.fa-table-tennis-paddle-ball:before,.fa-table-tennis:before{content:"\f45d"}.fa-tablet-android:before,.fa-tablet:before{content:"\f3fb"}.fa-tablet-button:before{content:"\f10a"}.fa-tablet-alt:before,.fa-tablet-screen-button:before{content:"\f3fa"}.fa-tablets:before{content:"\f490"}.fa-digital-tachograph:before,.fa-tachograph-digital:before{content:"\f566"}.fa-tag:before{content:"\f02b"}.fa-tags:before{content:"\f02c"}.fa-tape:before{content:"\f4db"}.fa-tarp:before{content:"\e57b"}.fa-tarp-droplet:before{content:"\e57c"}.fa-cab:before,.fa-taxi:before{content:"\f1ba"}.fa-teeth:before{content:"\f62e"}.fa-teeth-open:before{content:"\f62f"}.fa-temperature-arrow-down:before,.fa-temperature-down:before{content:"\e03f"}.fa-temperature-arrow-up:before,.fa-temperature-up:before{content:"\e040"}.fa-temperature-0:before,.fa-temperature-empty:before,.fa-thermometer-0:before,.fa-thermometer-empty:before{content:"\f2cb"}.fa-temperature-4:before,.fa-temperature-full:before,.fa-thermometer-4:before,.fa-thermometer-full:before{content:"\f2c7"}.fa-temperature-2:before,.fa-temperature-half:before,.fa-thermometer-2:before,.fa-thermometer-half:before{content:"\f2c9"}.fa-temperature-high:before{content:"\f769"}.fa-temperature-low:before{content:"\f76b"}.fa-temperature-1:before,.fa-temperature-quarter:before,.fa-thermometer-1:before,.fa-thermometer-quarter:before{content:"\f2ca"}.fa-temperature-3:before,.fa-temperature-three-quarters:before,.fa-thermometer-3:before,.fa-thermometer-three-quarters:before{content:"\f2c8"}.fa-tenge-sign:before,.fa-tenge:before{content:"\f7d7"}.fa-tent:before{content:"\e57d"}.fa-tent-arrow-down-to-line:before{content:"\e57e"}.fa-tent-arrow-left-right:before{content:"\e57f"}.fa-tent-arrow-turn-left:before{content:"\e580"}.fa-tent-arrows-down:before{content:"\e581"}.fa-tents:before{content:"\e582"}.fa-terminal:before{content:"\f120"}.fa-text-height:before{content:"\f034"}.fa-remove-format:before,.fa-text-slash:before{content:"\f87d"}.fa-text-width:before{content:"\f035"}.fa-thermometer:before{content:"\f491"}.fa-thumbs-down:before{content:"\f165"}.fa-thumbs-up:before{content:"\f164"}.fa-thumb-tack:before,.fa-thumbtack:before{content:"\f08d"}.fa-ticket:before{content:"\f145"}.fa-ticket-alt:before,.fa-ticket-simple:before{content:"\f3ff"}.fa-timeline:before{content:"\e29c"}.fa-toggle-off:before{content:"\f204"}.fa-toggle-on:before{content:"\f205"}.fa-toilet:before{content:"\f7d8"}.fa-toilet-paper:before{content:"\f71e"}.fa-toilet-paper-slash:before{content:"\e072"}.fa-toilet-portable:before{content:"\e583"}.fa-toilets-portable:before{content:"\e584"}.fa-toolbox:before{content:"\f552"}.fa-tooth:before{content:"\f5c9"}.fa-torii-gate:before{content:"\f6a1"}.fa-tornado:before{content:"\f76f"}.fa-broadcast-tower:before,.fa-tower-broadcast:before{content:"\f519"}.fa-tower-cell:before{content:"\e585"}.fa-tower-observation:before{content:"\e586"}.fa-tractor:before{content:"\f722"}.fa-trademark:before{content:"\f25c"}.fa-traffic-light:before{content:"\f637"}.fa-trailer:before{content:"\e041"}.fa-train:before{content:"\f238"}.fa-subway:before,.fa-train-subway:before{content:"\f239"}.fa-train-tram:before,.fa-tram:before{content:"\f7da"}.fa-transgender-alt:before,.fa-transgender:before{content:"\f225"}.fa-trash:before{content:"\f1f8"}.fa-trash-arrow-up:before,.fa-trash-restore:before{content:"\f829"}.fa-trash-alt:before,.fa-trash-can:before{content:"\f2ed"}.fa-trash-can-arrow-up:before,.fa-trash-restore-alt:before{content:"\f82a"}.fa-tree:before{content:"\f1bb"}.fa-tree-city:before{content:"\e587"}.fa-exclamation-triangle:before,.fa-triangle-exclamation:before,.fa-warning:before{content:"\f071"}.fa-trophy:before{content:"\f091"}.fa-trowel:before{content:"\e589"}.fa-trowel-bricks:before{content:"\e58a"}.fa-truck:before{content:"\f0d1"}.fa-truck-arrow-right:before{content:"\e58b"}.fa-truck-droplet:before{content:"\e58c"}.fa-shipping-fast:before,.fa-truck-fast:before{content:"\f48b"}.fa-truck-field:before{content:"\e58d"}.fa-truck-field-un:before{content:"\e58e"}.fa-truck-front:before{content:"\e2b7"}.fa-ambulance:before,.fa-truck-medical:before{content:"\f0f9"}.fa-truck-monster:before{content:"\f63b"}.fa-truck-moving:before{content:"\f4df"}.fa-truck-pickup:before{content:"\f63c"}.fa-truck-plane:before{content:"\e58f"}.fa-truck-loading:before,.fa-truck-ramp-box:before{content:"\f4de"}.fa-teletype:before,.fa-tty:before{content:"\f1e4"}.fa-try:before,.fa-turkish-lira-sign:before,.fa-turkish-lira:before{content:"\e2bb"}.fa-level-down-alt:before,.fa-turn-down:before{content:"\f3be"}.fa-level-up-alt:before,.fa-turn-up:before{content:"\f3bf"}.fa-television:before,.fa-tv-alt:before,.fa-tv:before{content:"\f26c"}.fa-u:before{content:"\55"}.fa-umbrella:before{content:"\f0e9"}.fa-umbrella-beach:before{content:"\f5ca"}.fa-underline:before{content:"\f0cd"}.fa-universal-access:before{content:"\f29a"}.fa-unlock:before{content:"\f09c"}.fa-unlock-alt:before,.fa-unlock-keyhole:before{content:"\f13e"}.fa-arrows-alt-v:before,.fa-up-down:before{content:"\f338"}.fa-arrows-alt:before,.fa-up-down-left-right:before{content:"\f0b2"}.fa-long-arrow-alt-up:before,.fa-up-long:before{content:"\f30c"}.fa-expand-alt:before,.fa-up-right-and-down-left-from-center:before{content:"\f424"}.fa-external-link-alt:before,.fa-up-right-from-square:before{content:"\f35d"}.fa-upload:before{content:"\f093"}.fa-user:before{content:"\f007"}.fa-user-astronaut:before{content:"\f4fb"}.fa-user-check:before{content:"\f4fc"}.fa-user-clock:before{content:"\f4fd"}.fa-user-doctor:before,.fa-user-md:before{content:"\f0f0"}.fa-user-cog:before,.fa-user-gear:before{content:"\f4fe"}.fa-user-graduate:before{content:"\f501"}.fa-user-friends:before,.fa-user-group:before{content:"\f500"}.fa-user-injured:before{content:"\f728"}.fa-user-alt:before,.fa-user-large:before{content:"\f406"}.fa-user-alt-slash:before,.fa-user-large-slash:before{content:"\f4fa"}.fa-user-lock:before{content:"\f502"}.fa-user-minus:before{content:"\f503"}.fa-user-ninja:before{content:"\f504"}.fa-user-nurse:before{content:"\f82f"}.fa-user-edit:before,.fa-user-pen:before{content:"\f4ff"}.fa-user-plus:before{content:"\f234"}.fa-user-secret:before{content:"\f21b"}.fa-user-shield:before{content:"\f505"}.fa-user-slash:before{content:"\f506"}.fa-user-tag:before{content:"\f507"}.fa-user-tie:before{content:"\f508"}.fa-user-times:before,.fa-user-xmark:before{content:"\f235"}.fa-users:before{content:"\f0c0"}.fa-users-between-lines:before{content:"\e591"}.fa-users-cog:before,.fa-users-gear:before{content:"\f509"}.fa-users-line:before{content:"\e592"}.fa-users-rays:before{content:"\e593"}.fa-users-rectangle:before{content:"\e594"}.fa-users-slash:before{content:"\e073"}.fa-users-viewfinder:before{content:"\e595"}.fa-cutlery:before,.fa-utensils:before{content:"\f2e7"}.fa-v:before{content:"\56"}.fa-shuttle-van:before,.fa-van-shuttle:before{content:"\f5b6"}.fa-vault:before{content:"\e2c5"}.fa-vector-square:before{content:"\f5cb"}.fa-venus:before{content:"\f221"}.fa-venus-double:before{content:"\f226"}.fa-venus-mars:before{content:"\f228"}.fa-vest:before{content:"\e085"}.fa-vest-patches:before{content:"\e086"}.fa-vial:before{content:"\f492"}.fa-vial-circle-check:before{content:"\e596"}.fa-vial-virus:before{content:"\e597"}.fa-vials:before{content:"\f493"}.fa-video-camera:before,.fa-video:before{content:"\f03d"}.fa-video-slash:before{content:"\f4e2"}.fa-vihara:before{content:"\f6a7"}.fa-virus:before{content:"\e074"}.fa-virus-covid:before{content:"\e4a8"}.fa-virus-covid-slash:before{content:"\e4a9"}.fa-virus-slash:before{content:"\e075"}.fa-viruses:before{content:"\e076"}.fa-voicemail:before{content:"\f897"}.fa-volcano:before{content:"\f770"}.fa-volleyball-ball:before,.fa-volleyball:before{content:"\f45f"}.fa-volume-high:before,.fa-volume-up:before{content:"\f028"}.fa-volume-down:before,.fa-volume-low:before{content:"\f027"}.fa-volume-off:before{content:"\f026"}.fa-volume-mute:before,.fa-volume-times:before,.fa-volume-xmark:before{content:"\f6a9"}.fa-vr-cardboard:before{content:"\f729"}.fa-w:before{content:"\57"}.fa-walkie-talkie:before{content:"\f8ef"}.fa-wallet:before{content:"\f555"}.fa-magic:before,.fa-wand-magic:before{content:"\f0d0"}.fa-magic-wand-sparkles:before,.fa-wand-magic-sparkles:before{content:"\e2ca"}.fa-wand-sparkles:before{content:"\f72b"}.fa-warehouse:before{content:"\f494"}.fa-water:before{content:"\f773"}.fa-ladder-water:before,.fa-swimming-pool:before,.fa-water-ladder:before{content:"\f5c5"}.fa-wave-square:before{content:"\f83e"}.fa-weight-hanging:before{content:"\f5cd"}.fa-weight-scale:before,.fa-weight:before{content:"\f496"}.fa-wheat-alt:before,.fa-wheat-awn:before{content:"\e2cd"}.fa-wheat-awn-circle-exclamation:before{content:"\e598"}.fa-wheelchair:before{content:"\f193"}.fa-wheelchair-alt:before,.fa-wheelchair-move:before{content:"\e2ce"}.fa-glass-whiskey:before,.fa-whiskey-glass:before{content:"\f7a0"}.fa-wifi-3:before,.fa-wifi-strong:before,.fa-wifi:before{content:"\f1eb"}.fa-wind:before{content:"\f72e"}.fa-window-maximize:before{content:"\f2d0"}.fa-window-minimize:before{content:"\f2d1"}.fa-window-restore:before{content:"\f2d2"}.fa-wine-bottle:before{content:"\f72f"}.fa-wine-glass:before{content:"\f4e3"}.fa-wine-glass-alt:before,.fa-wine-glass-empty:before{content:"\f5ce"}.fa-krw:before,.fa-won-sign:before,.fa-won:before{content:"\f159"}.fa-worm:before{content:"\e599"}.fa-wrench:before{content:"\f0ad"}.fa-x:before{content:"\58"}.fa-x-ray:before{content:"\f497"}.fa-close:before,.fa-multiply:before,.fa-remove:before,.fa-times:before,.fa-xmark:before{content:"\f00d"}.fa-xmarks-lines:before{content:"\e59a"}.fa-y:before{content:"\59"}.fa-cny:before,.fa-jpy:before,.fa-rmb:before,.fa-yen-sign:before,.fa-yen:before{content:"\f157"}.fa-yin-yang:before{content:"\f6ad"}.fa-z:before{content:"\5a"}.fa-sr-only,.fa-sr-only-focusable:not(:focus),.sr-only,.sr-only-focusable:not(:focus){position:absolute;width:1px;height:1px;padding:0;margin:-1px;overflow:hidden;clip:rect(0,0,0,0);white-space:nowrap;border-width:0}:host,:root{--fa-font-brands:normal 400 1em/1 "Font Awesome 6 Brands"}@font-face{font-family:"Font Awesome 6 Brands";font-style:normal;font-weight:400;font-display:block;src:url(../webfonts/fa-brands-400.woff2) format("woff2"),url(../webfonts/fa-brands-400.ttf) format("truetype")}.fa-brands,.fab{font-family:"Font Awesome 6 Brands";font-weight:400}.fa-42-group:before,.fa-innosoft:before{content:"\e080"}.fa-500px:before{content:"\f26e"}.fa-accessible-icon:before{content:"\f368"}.fa-accusoft:before{content:"\f369"}.fa-adn:before{content:"\f170"}.fa-adversal:before{content:"\f36a"}.fa-affiliatetheme:before{content:"\f36b"}.fa-airbnb:before{content:"\f834"}.fa-algolia:before{content:"\f36c"}.fa-alipay:before{content:"\f642"}.fa-amazon:before{content:"\f270"}.fa-amazon-pay:before{content:"\f42c"}.fa-amilia:before{content:"\f36d"}.fa-android:before{content:"\f17b"}.fa-angellist:before{content:"\f209"}.fa-angrycreative:before{content:"\f36e"}.fa-angular:before{content:"\f420"}.fa-app-store:before{content:"\f36f"}.fa-app-store-ios:before{content:"\f370"}.fa-apper:before{content:"\f371"}.fa-apple:before{content:"\f179"}.fa-apple-pay:before{content:"\f415"}.fa-artstation:before{content:"\f77a"}.fa-asymmetrik:before{content:"\f372"}.fa-atlassian:before{content:"\f77b"}.fa-audible:before{content:"\f373"}.fa-autoprefixer:before{content:"\f41c"}.fa-avianex:before{content:"\f374"}.fa-aviato:before{content:"\f421"}.fa-aws:before{content:"\f375"}.fa-bandcamp:before{content:"\f2d5"}.fa-battle-net:before{content:"\f835"}.fa-behance:before{content:"\f1b4"}.fa-behance-square:before{content:"\f1b5"}.fa-bilibili:before{content:"\e3d9"}.fa-bimobject:before{content:"\f378"}.fa-bitbucket:before{content:"\f171"}.fa-bitcoin:before{content:"\f379"}.fa-bity:before{content:"\f37a"}.fa-black-tie:before{content:"\f27e"}.fa-blackberry:before{content:"\f37b"}.fa-blogger:before{content:"\f37c"}.fa-blogger-b:before{content:"\f37d"}.fa-bluetooth:before{content:"\f293"}.fa-bluetooth-b:before{content:"\f294"}.fa-bootstrap:before{content:"\f836"}.fa-bots:before{content:"\e340"}.fa-btc:before{content:"\f15a"}.fa-buffer:before{content:"\f837"}.fa-buromobelexperte:before{content:"\f37f"}.fa-buy-n-large:before{content:"\f8a6"}.fa-buysellads:before{content:"\f20d"}.fa-canadian-maple-leaf:before{content:"\f785"}.fa-cc-amazon-pay:before{content:"\f42d"}.fa-cc-amex:before{content:"\f1f3"}.fa-cc-apple-pay:before{content:"\f416"}.fa-cc-diners-club:before{content:"\f24c"}.fa-cc-discover:before{content:"\f1f2"}.fa-cc-jcb:before{content:"\f24b"}.fa-cc-mastercard:before{content:"\f1f1"}.fa-cc-paypal:before{content:"\f1f4"}.fa-cc-stripe:before{content:"\f1f5"}.fa-cc-visa:before{content:"\f1f0"}.fa-centercode:before{content:"\f380"}.fa-centos:before{content:"\f789"}.fa-chrome:before{content:"\f268"}.fa-chromecast:before{content:"\f838"}.fa-cloudflare:before{content:"\e07d"}.fa-cloudscale:before{content:"\f383"}.fa-cloudsmith:before{content:"\f384"}.fa-cloudversify:before{content:"\f385"}.fa-cmplid:before{content:"\e360"}.fa-codepen:before{content:"\f1cb"}.fa-codiepie:before{content:"\f284"}.fa-confluence:before{content:"\f78d"}.fa-connectdevelop:before{content:"\f20e"}.fa-contao:before{content:"\f26d"}.fa-cotton-bureau:before{content:"\f89e"}.fa-cpanel:before{content:"\f388"}.fa-creative-commons:before{content:"\f25e"}.fa-creative-commons-by:before{content:"\f4e7"}.fa-creative-commons-nc:before{content:"\f4e8"}.fa-creative-commons-nc-eu:before{content:"\f4e9"}.fa-creative-commons-nc-jp:before{content:"\f4ea"}.fa-creative-commons-nd:before{content:"\f4eb"}.fa-creative-commons-pd:before{content:"\f4ec"}.fa-creative-commons-pd-alt:before{content:"\f4ed"}.fa-creative-commons-remix:before{content:"\f4ee"}.fa-creative-commons-sa:before{content:"\f4ef"}.fa-creative-commons-sampling:before{content:"\f4f0"}.fa-creative-commons-sampling-plus:before{content:"\f4f1"}.fa-creative-commons-share:before{content:"\f4f2"}.fa-creative-commons-zero:before{content:"\f4f3"}.fa-critical-role:before{content:"\f6c9"}.fa-css3:before{content:"\f13c"}.fa-css3-alt:before{content:"\f38b"}.fa-cuttlefish:before{content:"\f38c"}.fa-d-and-d:before{content:"\f38d"}.fa-d-and-d-beyond:before{content:"\f6ca"}.fa-dailymotion:before{content:"\e052"}.fa-dashcube:before{content:"\f210"}.fa-deezer:before{content:"\e077"}.fa-delicious:before{content:"\f1a5"}.fa-deploydog:before{content:"\f38e"}.fa-deskpro:before{content:"\f38f"}.fa-dev:before{content:"\f6cc"}.fa-deviantart:before{content:"\f1bd"}.fa-dhl:before{content:"\f790"}.fa-diaspora:before{content:"\f791"}.fa-digg:before{content:"\f1a6"}.fa-digital-ocean:before{content:"\f391"}.fa-discord:before{content:"\f392"}.fa-discourse:before{content:"\f393"}.fa-dochub:before{content:"\f394"}.fa-docker:before{content:"\f395"}.fa-draft2digital:before{content:"\f396"}.fa-dribbble:before{content:"\f17d"}.fa-dribbble-square:before{content:"\f397"}.fa-dropbox:before{content:"\f16b"}.fa-drupal:before{content:"\f1a9"}.fa-dyalog:before{content:"\f399"}.fa-earlybirds:before{content:"\f39a"}.fa-ebay:before{content:"\f4f4"}.fa-edge:before{content:"\f282"}.fa-edge-legacy:before{content:"\e078"}.fa-elementor:before{content:"\f430"}.fa-ello:before{content:"\f5f1"}.fa-ember:before{content:"\f423"}.fa-empire:before{content:"\f1d1"}.fa-envira:before{content:"\f299"}.fa-erlang:before{content:"\f39d"}.fa-ethereum:before{content:"\f42e"}.fa-etsy:before{content:"\f2d7"}.fa-evernote:before{content:"\f839"}.fa-expeditedssl:before{content:"\f23e"}.fa-facebook:before{content:"\f09a"}.fa-facebook-f:before{content:"\f39e"}.fa-facebook-messenger:before{content:"\f39f"}.fa-facebook-square:before{content:"\f082"}.fa-fantasy-flight-games:before{content:"\f6dc"}.fa-fedex:before{content:"\f797"}.fa-fedora:before{content:"\f798"}.fa-figma:before{content:"\f799"}.fa-firefox:before{content:"\f269"}.fa-firefox-browser:before{content:"\e007"}.fa-first-order:before{content:"\f2b0"}.fa-first-order-alt:before{content:"\f50a"}.fa-firstdraft:before{content:"\f3a1"}.fa-flickr:before{content:"\f16e"}.fa-flipboard:before{content:"\f44d"}.fa-fly:before{content:"\f417"}.fa-font-awesome-flag:before,.fa-font-awesome-logo-full:before,.fa-font-awesome:before{content:"\f2b4"}.fa-fonticons:before{content:"\f280"}.fa-fonticons-fi:before{content:"\f3a2"}.fa-fort-awesome:before{content:"\f286"}.fa-fort-awesome-alt:before{content:"\f3a3"}.fa-forumbee:before{content:"\f211"}.fa-foursquare:before{content:"\f180"}.fa-free-code-camp:before{content:"\f2c5"}.fa-freebsd:before{content:"\f3a4"}.fa-fulcrum:before{content:"\f50b"}.fa-galactic-republic:before{content:"\f50c"}.fa-galactic-senate:before{content:"\f50d"}.fa-get-pocket:before{content:"\f265"}.fa-gg:before{content:"\f260"}.fa-gg-circle:before{content:"\f261"}.fa-git:before{content:"\f1d3"}.fa-git-alt:before{content:"\f841"}.fa-git-square:before{content:"\f1d2"}.fa-github:before{content:"\f09b"}.fa-github-alt:before{content:"\f113"}.fa-github-square:before{content:"\f092"}.fa-gitkraken:before{content:"\f3a6"}.fa-gitlab:before{content:"\f296"}.fa-gitter:before{content:"\f426"}.fa-glide:before{content:"\f2a5"}.fa-glide-g:before{content:"\f2a6"}.fa-gofore:before{content:"\f3a7"}.fa-golang:before{content:"\e40f"}.fa-goodreads:before{content:"\f3a8"}.fa-goodreads-g:before{content:"\f3a9"}.fa-google:before{content:"\f1a0"}.fa-google-drive:before{content:"\f3aa"}.fa-google-pay:before{content:"\e079"}.fa-google-play:before{content:"\f3ab"}.fa-google-plus:before{content:"\f2b3"}.fa-google-plus-g:before{content:"\f0d5"}.fa-google-plus-square:before{content:"\f0d4"}.fa-google-wallet:before{content:"\f1ee"}.fa-gratipay:before{content:"\f184"}.fa-grav:before{content:"\f2d6"}.fa-gripfire:before{content:"\f3ac"}.fa-grunt:before{content:"\f3ad"}.fa-guilded:before{content:"\e07e"}.fa-gulp:before{content:"\f3ae"}.fa-hacker-news:before{content:"\f1d4"}.fa-hacker-news-square:before{content:"\f3af"}.fa-hackerrank:before{content:"\f5f7"}.fa-hashnode:before{content:"\e499"}.fa-hips:before{content:"\f452"}.fa-hire-a-helper:before{content:"\f3b0"}.fa-hive:before{content:"\e07f"}.fa-hooli:before{content:"\f427"}.fa-hornbill:before{content:"\f592"}.fa-hotjar:before{content:"\f3b1"}.fa-houzz:before{content:"\f27c"}.fa-html5:before{content:"\f13b"}.fa-hubspot:before{content:"\f3b2"}.fa-ideal:before{content:"\e013"}.fa-imdb:before{content:"\f2d8"}.fa-instagram:before{content:"\f16d"}.fa-instagram-square:before{content:"\e055"}.fa-instalod:before{content:"\e081"}.fa-intercom:before{content:"\f7af"}.fa-internet-explorer:before{content:"\f26b"}.fa-invision:before{content:"\f7b0"}.fa-ioxhost:before{content:"\f208"}.fa-itch-io:before{content:"\f83a"}.fa-itunes:before{content:"\f3b4"}.fa-itunes-note:before{content:"\f3b5"}.fa-java:before{content:"\f4e4"}.fa-jedi-order:before{content:"\f50e"}.fa-jenkins:before{content:"\f3b6"}.fa-jira:before{content:"\f7b1"}.fa-joget:before{content:"\f3b7"}.fa-joomla:before{content:"\f1aa"}.fa-js:before{content:"\f3b8"}.fa-js-square:before{content:"\f3b9"}.fa-jsfiddle:before{content:"\f1cc"}.fa-kaggle:before{content:"\f5fa"}.fa-keybase:before{content:"\f4f5"}.fa-keycdn:before{content:"\f3ba"}.fa-kickstarter:before{content:"\f3bb"}.fa-kickstarter-k:before{content:"\f3bc"}.fa-korvue:before{content:"\f42f"}.fa-laravel:before{content:"\f3bd"}.fa-lastfm:before{content:"\f202"}.fa-lastfm-square:before{content:"\f203"}.fa-leanpub:before{content:"\f212"}.fa-less:before{content:"\f41d"}.fa-line:before{content:"\f3c0"}.fa-linkedin:before{content:"\f08c"}.fa-linkedin-in:before{content:"\f0e1"}.fa-linode:before{content:"\f2b8"}.fa-linux:before{content:"\f17c"}.fa-lyft:before{content:"\f3c3"}.fa-magento:before{content:"\f3c4"}.fa-mailchimp:before{content:"\f59e"}.fa-mandalorian:before{content:"\f50f"}.fa-markdown:before{content:"\f60f"}.fa-mastodon:before{content:"\f4f6"}.fa-maxcdn:before{content:"\f136"}.fa-mdb:before{content:"\f8ca"}.fa-medapps:before{content:"\f3c6"}.fa-medium-m:before,.fa-medium:before{content:"\f23a"}.fa-medrt:before{content:"\f3c8"}.fa-meetup:before{content:"\f2e0"}.fa-megaport:before{content:"\f5a3"}.fa-mendeley:before{content:"\f7b3"}.fa-microblog:before{content:"\e01a"}.fa-microsoft:before{content:"\f3ca"}.fa-mix:before{content:"\f3cb"}.fa-mixcloud:before{content:"\f289"}.fa-mixer:before{content:"\e056"}.fa-mizuni:before{content:"\f3cc"}.fa-modx:before{content:"\f285"}.fa-monero:before{content:"\f3d0"}.fa-napster:before{content:"\f3d2"}.fa-neos:before{content:"\f612"}.fa-nfc-directional:before{content:"\e530"}.fa-nfc-symbol:before{content:"\e531"}.fa-nimblr:before{content:"\f5a8"}.fa-node:before{content:"\f419"}.fa-node-js:before{content:"\f3d3"}.fa-npm:before{content:"\f3d4"}.fa-ns8:before{content:"\f3d5"}.fa-nutritionix:before{content:"\f3d6"}.fa-octopus-deploy:before{content:"\e082"}.fa-odnoklassniki:before{content:"\f263"}.fa-odnoklassniki-square:before{content:"\f264"}.fa-old-republic:before{content:"\f510"}.fa-opencart:before{content:"\f23d"}.fa-openid:before{content:"\f19b"}.fa-opera:before{content:"\f26a"}.fa-optin-monster:before{content:"\f23c"}.fa-orcid:before{content:"\f8d2"}.fa-osi:before{content:"\f41a"}.fa-padlet:before{content:"\e4a0"}.fa-page4:before{content:"\f3d7"}.fa-pagelines:before{content:"\f18c"}.fa-palfed:before{content:"\f3d8"}.fa-patreon:before{content:"\f3d9"}.fa-paypal:before{content:"\f1ed"}.fa-perbyte:before{content:"\e083"}.fa-periscope:before{content:"\f3da"}.fa-phabricator:before{content:"\f3db"}.fa-phoenix-framework:before{content:"\f3dc"}.fa-phoenix-squadron:before{content:"\f511"}.fa-php:before{content:"\f457"}.fa-pied-piper:before{content:"\f2ae"}.fa-pied-piper-alt:before{content:"\f1a8"}.fa-pied-piper-hat:before{content:"\f4e5"}.fa-pied-piper-pp:before{content:"\f1a7"}.fa-pied-piper-square:before{content:"\e01e"}.fa-pinterest:before{content:"\f0d2"}.fa-pinterest-p:before{content:"\f231"}.fa-pinterest-square:before{content:"\f0d3"}.fa-pix:before{content:"\e43a"}.fa-playstation:before{content:"\f3df"}.fa-product-hunt:before{content:"\f288"}.fa-pushed:before{content:"\f3e1"}.fa-python:before{content:"\f3e2"}.fa-qq:before{content:"\f1d6"}.fa-quinscape:before{content:"\f459"}.fa-quora:before{content:"\f2c4"}.fa-r-project:before{content:"\f4f7"}.fa-raspberry-pi:before{content:"\f7bb"}.fa-ravelry:before{content:"\f2d9"}.fa-react:before{content:"\f41b"}.fa-reacteurope:before{content:"\f75d"}.fa-readme:before{content:"\f4d5"}.fa-rebel:before{content:"\f1d0"}.fa-red-river:before{content:"\f3e3"}.fa-reddit:before{content:"\f1a1"}.fa-reddit-alien:before{content:"\f281"}.fa-reddit-square:before{content:"\f1a2"}.fa-redhat:before{content:"\f7bc"}.fa-renren:before{content:"\f18b"}.fa-replyd:before{content:"\f3e6"}.fa-researchgate:before{content:"\f4f8"}.fa-resolving:before{content:"\f3e7"}.fa-rev:before{content:"\f5b2"}.fa-rocketchat:before{content:"\f3e8"}.fa-rockrms:before{content:"\f3e9"}.fa-rust:before{content:"\e07a"}.fa-safari:before{content:"\f267"}.fa-salesforce:before{content:"\f83b"}.fa-sass:before{content:"\f41e"}.fa-schlix:before{content:"\f3ea"}.fa-screenpal:before{content:"\e570"}.fa-scribd:before{content:"\f28a"}.fa-searchengin:before{content:"\f3eb"}.fa-sellcast:before{content:"\f2da"}.fa-sellsy:before{content:"\f213"}.fa-servicestack:before{content:"\f3ec"}.fa-shirtsinbulk:before{content:"\f214"}.fa-shopify:before{content:"\e057"}.fa-shopware:before{content:"\f5b5"}.fa-simplybuilt:before{content:"\f215"}.fa-sistrix:before{content:"\f3ee"}.fa-sith:before{content:"\f512"}.fa-sitrox:before{content:"\e44a"}.fa-sketch:before{content:"\f7c6"}.fa-skyatlas:before{content:"\f216"}.fa-skype:before{content:"\f17e"}.fa-slack-hash:before,.fa-slack:before{content:"\f198"}.fa-slideshare:before{content:"\f1e7"}.fa-snapchat-ghost:before,.fa-snapchat:before{content:"\f2ab"}.fa-snapchat-square:before{content:"\f2ad"}.fa-soundcloud:before{content:"\f1be"}.fa-sourcetree:before{content:"\f7d3"}.fa-speakap:before{content:"\f3f3"}.fa-speaker-deck:before{content:"\f83c"}.fa-spotify:before{content:"\f1bc"}.fa-square-font-awesome:before{content:"\f425"}.fa-font-awesome-alt:before,.fa-square-font-awesome-stroke:before{content:"\f35c"}.fa-squarespace:before{content:"\f5be"}.fa-stack-exchange:before{content:"\f18d"}.fa-stack-overflow:before{content:"\f16c"}.fa-stackpath:before{content:"\f842"}.fa-staylinked:before{content:"\f3f5"}.fa-steam:before{content:"\f1b6"}.fa-steam-square:before{content:"\f1b7"}.fa-steam-symbol:before{content:"\f3f6"}.fa-sticker-mule:before{content:"\f3f7"}.fa-strava:before{content:"\f428"}.fa-stripe:before{content:"\f429"}.fa-stripe-s:before{content:"\f42a"}.fa-studiovinari:before{content:"\f3f8"}.fa-stumbleupon:before{content:"\f1a4"}.fa-stumbleupon-circle:before{content:"\f1a3"}.fa-superpowers:before{content:"\f2dd"}.fa-supple:before{content:"\f3f9"}.fa-suse:before{content:"\f7d6"}.fa-swift:before{content:"\f8e1"}.fa-symfony:before{content:"\f83d"}.fa-teamspeak:before{content:"\f4f9"}.fa-telegram-plane:before,.fa-telegram:before{content:"\f2c6"}.fa-tencent-weibo:before{content:"\f1d5"}.fa-the-red-yeti:before{content:"\f69d"}.fa-themeco:before{content:"\f5c6"}.fa-themeisle:before{content:"\f2b2"}.fa-think-peaks:before{content:"\f731"}.fa-tiktok:before{content:"\e07b"}.fa-trade-federation:before{content:"\f513"}.fa-trello:before{content:"\f181"}.fa-tumblr:before{content:"\f173"}.fa-tumblr-square:before{content:"\f174"}.fa-twitch:before{content:"\f1e8"}.fa-twitter:before{content:"\f099"}.fa-twitter-square:before{content:"\f081"}.fa-typo3:before{content:"\f42b"}.fa-uber:before{content:"\f402"}.fa-ubuntu:before{content:"\f7df"}.fa-uikit:before{content:"\f403"}.fa-umbraco:before{content:"\f8e8"}.fa-uncharted:before{content:"\e084"}.fa-uniregistry:before{content:"\f404"}.fa-unity:before{content:"\e049"}.fa-unsplash:before{content:"\e07c"}.fa-untappd:before{content:"\f405"}.fa-ups:before{content:"\f7e0"}.fa-usb:before{content:"\f287"}.fa-usps:before{content:"\f7e1"}.fa-ussunnah:before{content:"\f407"}.fa-vaadin:before{content:"\f408"}.fa-viacoin:before{content:"\f237"}.fa-viadeo:before{content:"\f2a9"}.fa-viadeo-square:before{content:"\f2aa"}.fa-viber:before{content:"\f409"}.fa-vimeo:before{content:"\f40a"}.fa-vimeo-square:before{content:"\f194"}.fa-vimeo-v:before{content:"\f27d"}.fa-vine:before{content:"\f1ca"}.fa-vk:before{content:"\f189"}.fa-vnv:before{content:"\f40b"}.fa-vuejs:before{content:"\f41f"}.fa-watchman-monitoring:before{content:"\e087"}.fa-waze:before{content:"\f83f"}.fa-weebly:before{content:"\f5cc"}.fa-weibo:before{content:"\f18a"}.fa-weixin:before{content:"\f1d7"}.fa-whatsapp:before{content:"\f232"}.fa-whatsapp-square:before{content:"\f40c"}.fa-whmcs:before{content:"\f40d"}.fa-wikipedia-w:before{content:"\f266"}.fa-windows:before{content:"\f17a"}.fa-wirsindhandwerk:before,.fa-wsh:before{content:"\e2d0"}.fa-wix:before{content:"\f5cf"}.fa-wizards-of-the-coast:before{content:"\f730"}.fa-wodu:before{content:"\e088"}.fa-wolf-pack-battalion:before{content:"\f514"}.fa-wordpress:before{content:"\f19a"}.fa-wordpress-simple:before{content:"\f411"}.fa-wpbeginner:before{content:"\f297"}.fa-wpexplorer:before{content:"\f2de"}.fa-wpforms:before{content:"\f298"}.fa-wpressr:before{content:"\f3e4"}.fa-xbox:before{content:"\f412"}.fa-xing:before{content:"\f168"}.fa-xing-square:before{content:"\f169"}.fa-y-combinator:before{content:"\f23b"}.fa-yahoo:before{content:"\f19e"}.fa-yammer:before{content:"\f840"}.fa-yandex:before{content:"\f413"}.fa-yandex-international:before{content:"\f414"}.fa-yarn:before{content:"\f7e3"}.fa-yelp:before{content:"\f1e9"}.fa-yoast:before{content:"\f2b1"}.fa-youtube:before{content:"\f167"}.fa-youtube-square:before{content:"\f431"}.fa-zhihu:before{content:"\f63f"}:host,:root{--fa-font-regular:normal 400 1em/1 "Font Awesome 6 Free"}@font-face{font-family:"Font Awesome 6 Free";font-style:normal;font-weight:400;font-display:block;src:url(../webfonts/fa-regular-400.woff2) format("woff2"),url(../webfonts/fa-regular-400.ttf) format("truetype")}.fa-regular,.far{font-family:"Font Awesome 6 Free";font-weight:400}:host,:root{--fa-font-solid:normal 900 1em/1 "Font Awesome 6 Free"}@font-face{font-family:"Font Awesome 6 Free";font-style:normal;font-weight:900;font-display:block;src:url(../webfonts/fa-solid-900.woff2) format("woff2"),url(../webfonts/fa-solid-900.ttf) format("truetype")}.fa-solid,.fas{font-family:"Font Awesome 6 Free";font-weight:900}@font-face{font-family:"Font Awesome 5 Brands";font-display:block;font-weight:400;src:url(../webfonts/fa-brands-400.woff2) format("woff2"),url(../webfonts/fa-brands-400.ttf) format("truetype")}@font-face{font-family:"Font Awesome 5 Free";font-display:block;font-weight:900;src:url(../webfonts/fa-solid-900.woff2) format("woff2"),url(../webfonts/fa-solid-900.ttf) format("truetype")}@font-face{font-family:"Font Awesome 5 Free";font-display:block;font-weight:400;src:url(../webfonts/fa-regular-400.woff2) format("woff2"),url(../webfonts/fa-regular-400.ttf) format("truetype")}@font-face{font-family:"FontAwesome";font-display:block;src:url(../webfonts/fa-solid-900.woff2) format("woff2"),url(../webfonts/fa-solid-900.ttf) format("truetype")}@font-face{font-family:"FontAwesome";font-display:block;src:url(../webfonts/fa-brands-400.woff2) format("woff2"),url(../webfonts/fa-brands-400.ttf) format("truetype")}@font-face{font-family:"FontAwesome";font-display:block;src:url(../webfonts/fa-regular-400.woff2) format("woff2"),url(../webfonts/fa-regular-400.ttf) format("truetype");unicode-range:u+f003,u+f006,u+f014,u+f016-f017,u+f01a-f01b,u+f01d,u+f022,u+f03e,u+f044,u+f046,u+f05c-f05d,u+f06e,u+f070,u+f087-f088,u+f08a,u+f094,u+f096-f097,u+f09d,u+f0a0,u+f0a2,u+f0a4-f0a7,u+f0c5,u+f0c7,u+f0e5-f0e6,u+f0eb,u+f0f6-f0f8,u+f10c,u+f114-f115,u+f118-f11a,u+f11c-f11d,u+f133,u+f147,u+f14e,u+f150-f152,u+f185-f186,u+f18e,u+f190-f192,u+f196,u+f1c1-f1c9,u+f1d9,u+f1db,u+f1e3,u+f1ea,u+f1f7,u+f1f9,u+f20a,u+f247-f248,u+f24a,u+f24d,u+f255-f25b,u+f25d,u+f271-f274,u+f278,u+f27b,u+f28c,u+f28e,u+f29c,u+f2b5,u+f2b7,u+f2ba,u+f2bc,u+f2be,u+f2c0-f2c1,u+f2c3,u+f2d0,u+f2d2,u+f2d4,u+f2dc}@font-face{font-family:"FontAwesome";font-display:block;src:url(../webfonts/fa-v4compatibility.woff2) format("woff2"),url(../webfonts/fa-v4compatibility.ttf) format("truetype");unicode-range:u+f041,u+f047,u+f065-f066,u+f07d-f07e,u+f080,u+f08b,u+f08e,u+f090,u+f09a,u+f0ac,u+f0ae,u+f0b2,u+f0d0,u+f0d6,u+f0e4,u+f0ec,u+f10a-f10b,u+f123,u+f13e,u+f148-f149,u+f14c,u+f156,u+f15e,u+f160-f161,u+f163,u+f175-f178,u+f195,u+f1f8,u+f219,u+f250,u+f252,u+f27a} \ No newline at end of file diff --git a/assets/css/images/intro.svg b/assets/css/images/intro.svg new file mode 100644 index 0000000000..d0d52b8d96 --- /dev/null +++ b/assets/css/images/intro.svg @@ -0,0 +1,14 @@ + + + + + + + + + + + + + + \ No newline at end of file diff --git a/assets/css/jquery.timepicker.css b/assets/css/jquery.timepicker.css new file mode 100644 index 0000000000..950a0b1dad --- /dev/null +++ b/assets/css/jquery.timepicker.css @@ -0,0 +1,72 @@ +.ui-timepicker-wrapper { + overflow-y: auto; + max-height: 150px; + width: 6.5em; + background: #fff; + border: 1px solid #ddd; + -webkit-box-shadow:0 5px 10px rgba(0,0,0,0.2); + -moz-box-shadow:0 5px 10px rgba(0,0,0,0.2); + box-shadow:0 5px 10px rgba(0,0,0,0.2); + outline: none; + z-index: 10001; + margin: 0; +} + +.ui-timepicker-wrapper.ui-timepicker-with-duration { + width: 13em; +} + +.ui-timepicker-wrapper.ui-timepicker-with-duration.ui-timepicker-step-30, +.ui-timepicker-wrapper.ui-timepicker-with-duration.ui-timepicker-step-60 { + width: 11em; +} + +.ui-timepicker-list { + margin: 0; + padding: 0; + list-style: none; +} + +.ui-timepicker-duration { + margin-left: 5px; color: #888; +} + +.ui-timepicker-list:hover .ui-timepicker-duration { + color: #888; +} + +.ui-timepicker-list li { + padding: 3px 0 3px 5px; + cursor: pointer; + white-space: nowrap; + color: #000; + list-style: none; + margin: 0; +} + +.ui-timepicker-list:hover .ui-timepicker-selected { + background: #fff; color: #000; +} + +li.ui-timepicker-selected, +.ui-timepicker-list li:hover, +.ui-timepicker-list .ui-timepicker-selected:hover { + background: #1980EC; color: #fff; +} + +li.ui-timepicker-selected .ui-timepicker-duration, +.ui-timepicker-list li:hover .ui-timepicker-duration { + color: #ccc; +} + +.ui-timepicker-list li.ui-timepicker-disabled, +.ui-timepicker-list li.ui-timepicker-disabled:hover, +.ui-timepicker-list li.ui-timepicker-selected.ui-timepicker-disabled { + color: #888; + cursor: default; +} + +.ui-timepicker-list li.ui-timepicker-disabled:hover, +.ui-timepicker-list li.ui-timepicker-selected.ui-timepicker-disabled { + background: #f2f2f2; +} diff --git a/assets/css/magnific-popup.css b/assets/css/magnific-popup.css new file mode 100644 index 0000000000..9d33824e57 --- /dev/null +++ b/assets/css/magnific-popup.css @@ -0,0 +1,351 @@ +/* Magnific Popup CSS */ +.mfp-bg { + top: 0; + left: 0; + width: 100%; + height: 100%; + z-index: 1042; + overflow: hidden; + position: fixed; + background: #0b0b0b; + opacity: 0.8; } + +.mfp-wrap { + top: 0; + left: 0; + width: 100%; + height: 100%; + z-index: 1043; + position: fixed; + outline: none !important; + -webkit-backface-visibility: hidden; } + +.mfp-container { + text-align: center; + position: absolute; + width: 100%; + height: 100%; + left: 0; + top: 0; + padding: 0 8px; + box-sizing: border-box; } + +.mfp-container:before { + content: ''; + display: inline-block; + height: 100%; + vertical-align: middle; } + +.mfp-align-top .mfp-container:before { + display: none; } + +.mfp-content { + position: relative; + display: inline-block; + vertical-align: middle; + margin: 0 auto; + text-align: left; + z-index: 1045; } + +.mfp-inline-holder .mfp-content, +.mfp-ajax-holder .mfp-content { + width: 100%; + cursor: auto; } + +.mfp-ajax-cur { + cursor: progress; } + +.mfp-zoom-out-cur, .mfp-zoom-out-cur .mfp-image-holder .mfp-close { + cursor: -moz-zoom-out; + cursor: -webkit-zoom-out; + cursor: zoom-out; } + +.mfp-zoom { + cursor: pointer; + cursor: -webkit-zoom-in; + cursor: -moz-zoom-in; + cursor: zoom-in; } + +.mfp-auto-cursor .mfp-content { + cursor: auto; } + +.mfp-close, +.mfp-arrow, +.mfp-preloader, +.mfp-counter { + -webkit-user-select: none; + -moz-user-select: none; + user-select: none; } + +.mfp-loading.mfp-figure { + display: none; } + +.mfp-hide { + display: none !important; } + +.mfp-preloader { + color: #CCC; + position: absolute; + top: 50%; + width: auto; + text-align: center; + margin-top: -0.8em; + left: 8px; + right: 8px; + z-index: 1044; } + .mfp-preloader a { + color: #CCC; } + .mfp-preloader a:hover { + color: #FFF; } + +.mfp-s-ready .mfp-preloader { + display: none; } + +.mfp-s-error .mfp-content { + display: none; } + +button.mfp-close, +button.mfp-arrow { + overflow: visible; + cursor: pointer; + background: transparent; + border: 0; + -webkit-appearance: none; + display: block; + outline: none; + padding: 0; + z-index: 1046; + box-shadow: none; + touch-action: manipulation; } + +button::-moz-focus-inner { + padding: 0; + border: 0; } + +.mfp-close { + width: 44px; + height: 44px; + line-height: 44px; + position: absolute; + right: 0; + top: 0; + text-decoration: none; + text-align: center; + opacity: 0.65; + padding: 0 0 18px 10px; + color: #FFF; + font-style: normal; + font-size: 28px; + font-family: Arial, Baskerville, monospace; } + .mfp-close:hover, + .mfp-close:focus { + opacity: 1; } + .mfp-close:active { + top: 1px; } + +.mfp-close-btn-in .mfp-close { + color: #333; } + +.mfp-image-holder .mfp-close, +.mfp-iframe-holder .mfp-close { + color: #FFF; + right: -6px; + text-align: right; + padding-right: 6px; + width: 100%; } + +.mfp-counter { + position: absolute; + top: 0; + right: 0; + color: #CCC; + font-size: 12px; + line-height: 18px; + white-space: nowrap; } + +.mfp-arrow { + position: absolute; + opacity: 0.65; + margin: 0; + top: 50%; + margin-top: -55px; + padding: 0; + width: 90px; + height: 110px; + -webkit-tap-highlight-color: transparent; } + .mfp-arrow:active { + margin-top: -54px; } + .mfp-arrow:hover, + .mfp-arrow:focus { + opacity: 1; } + .mfp-arrow:before, + .mfp-arrow:after { + content: ''; + display: block; + width: 0; + height: 0; + position: absolute; + left: 0; + top: 0; + margin-top: 35px; + margin-left: 35px; + border: medium inset transparent; } + .mfp-arrow:after { + border-top-width: 13px; + border-bottom-width: 13px; + top: 8px; } + .mfp-arrow:before { + border-top-width: 21px; + border-bottom-width: 21px; + opacity: 0.7; } + +.mfp-arrow-left { + left: 0; } + .mfp-arrow-left:after { + border-right: 17px solid #FFF; + margin-left: 31px; } + .mfp-arrow-left:before { + margin-left: 25px; + border-right: 27px solid #3F3F3F; } + +.mfp-arrow-right { + right: 0; } + .mfp-arrow-right:after { + border-left: 17px solid #FFF; + margin-left: 39px; } + .mfp-arrow-right:before { + border-left: 27px solid #3F3F3F; } + +.mfp-iframe-holder { + padding-top: 40px; + padding-bottom: 40px; } + .mfp-iframe-holder .mfp-content { + line-height: 0; + width: 100%; + max-width: 900px; } + .mfp-iframe-holder .mfp-close { + top: -40px; } + +.mfp-iframe-scaler { + width: 100%; + height: 0; + overflow: hidden; + padding-top: 56.25%; } + .mfp-iframe-scaler iframe { + position: absolute; + display: block; + top: 0; + left: 0; + width: 100%; + height: 100%; + box-shadow: 0 0 8px rgba(0, 0, 0, 0.6); + background: #000; } + +/* Main image in popup */ +img.mfp-img { + width: auto; + max-width: 100%; + height: auto; + display: block; + line-height: 0; + box-sizing: border-box; + padding: 40px 0 40px; + margin: 0 auto; } + +/* The shadow behind the image */ +.mfp-figure { + line-height: 0; } + .mfp-figure:after { + content: ''; + position: absolute; + left: 0; + top: 40px; + bottom: 40px; + display: block; + right: 0; + width: auto; + height: auto; + z-index: -1; + box-shadow: 0 0 8px rgba(0, 0, 0, 0.6); + background: #444; } + .mfp-figure small { + color: #BDBDBD; + display: block; + font-size: 12px; + line-height: 14px; } + .mfp-figure figure { + margin: 0; } + +.mfp-bottom-bar { + margin-top: -36px; + position: absolute; + top: 100%; + left: 0; + width: 100%; + cursor: auto; } + +.mfp-title { + text-align: left; + line-height: 18px; + color: #F3F3F3; + word-wrap: break-word; + padding-right: 36px; } + +.mfp-image-holder .mfp-content { + max-width: 100%; } + +.mfp-gallery .mfp-image-holder .mfp-figure { + cursor: pointer; } + +@media screen and (max-width: 800px) and (orientation: landscape), screen and (max-height: 300px) { + /** + * Remove all paddings around the image on small screen + */ + .mfp-img-mobile .mfp-image-holder { + padding-left: 0; + padding-right: 0; } + .mfp-img-mobile img.mfp-img { + padding: 0; } + .mfp-img-mobile .mfp-figure:after { + top: 0; + bottom: 0; } + .mfp-img-mobile .mfp-figure small { + display: inline; + margin-left: 5px; } + .mfp-img-mobile .mfp-bottom-bar { + background: rgba(0, 0, 0, 0.6); + bottom: 0; + margin: 0; + top: auto; + padding: 3px 5px; + position: fixed; + box-sizing: border-box; } + .mfp-img-mobile .mfp-bottom-bar:empty { + padding: 0; } + .mfp-img-mobile .mfp-counter { + right: 5px; + top: 3px; } + .mfp-img-mobile .mfp-close { + top: 0; + right: 0; + width: 35px; + height: 35px; + line-height: 35px; + background: rgba(0, 0, 0, 0.6); + position: fixed; + text-align: center; + padding: 0; } } + +@media all and (max-width: 900px) { + .mfp-arrow { + -webkit-transform: scale(0.75); + transform: scale(0.75); } + .mfp-arrow-left { + -webkit-transform-origin: 0; + transform-origin: 0; } + .mfp-arrow-right { + -webkit-transform-origin: 100%; + transform-origin: 100%; } + .mfp-container { + padding-left: 6px; + padding-right: 6px; } } \ No newline at end of file diff --git a/assets/css/main.css b/assets/css/main.css new file mode 100644 index 0000000000..ce698d0dcd --- /dev/null +++ b/assets/css/main.css @@ -0,0 +1,5116 @@ +@import url(fontawesome-all.min.css); +@import url("https://fonts.googleapis.com/css?family=Source+Sans+Pro:400,700|Raleway:400,800,900"); + +/* + Future Imperfect by HTML5 UP + html5up.net | @ajlkn + Free for personal and commercial use under the CCA 3.0 license (html5up.net/license) +*/ + +html, body, div, span, applet, object, +iframe, h1, h2, h3, h4, h5, h6, p, blockquote, +pre, a, abbr, acronym, address, big, cite, +code, del, dfn, em, img, ins, kbd, q, s, samp, +small, strike, strong, sub, sup, tt, var, b, +u, i, center, dl, dt, dd, ol, ul, li, fieldset, +form, label, legend, table, caption, tbody, +tfoot, thead, tr, th, td, article, aside, +canvas, details, embed, figure, figcaption, +footer, header, hgroup, menu, nav, output, ruby, +section, summary, time, mark, audio, video { + margin: 0; + padding: 0; + border: 0; + font-size: 100%; + font: inherit; + vertical-align: baseline; +} + +article, aside, details, figcaption, figure, +footer, header, hgroup, menu, nav, section { + display: block; +} + +body { + line-height: 1; +} + +ol, ul { + list-style: none; +} + +blockquote, q { + quotes: none; +} + +blockquote:before, blockquote:after, q:before, q:after { + content: ''; + content: none; +} + +table { + border-collapse: collapse; + border-spacing: 0; +} + +body { + -webkit-text-size-adjust: none; +} + +mark { + background-color: transparent; + color: inherit; +} + +input::-moz-focus-inner { + border: 0; + padding: 0; +} + +input, select, textarea { + -moz-appearance: none; + -webkit-appearance: none; + -ms-appearance: none; + appearance: none; +} + +/* Basic */ + +@-ms-viewport { + width: device-width; +} + +body { + -ms-overflow-style: scrollbar; +} + +@media screen and (max-width: 480px) { + + html, body { + min-width: 320px; + } + +} + +html { + box-sizing: border-box; +} + +*, *:before, *:after { + box-sizing: inherit; +} + +body { + background: #f4f4f4; +} + +body.is-preload *, body.is-preload *:before, body.is-preload *:after { + -moz-animation: none !important; + -webkit-animation: none !important; + -ms-animation: none !important; + animation: none !important; + -moz-transition: none !important; + -webkit-transition: none !important; + -ms-transition: none !important; + transition: none !important; +} + +/* Type */ + +body, input, select, textarea { + color: #646464; + font-family: "Source Sans Pro", Helvetica, sans-serif; + font-size: 14pt; + font-weight: 400; + line-height: 1.75; +} + +@media screen and (max-width: 1680px) { + + body, input, select, textarea { + font-size: 12pt; + } + +} + +@media screen and (max-width: 1280px) { + + body, input, select, textarea { + font-size: 12pt; + } + +} + +@media screen and (max-width: 980px) { + + body, input, select, textarea { + font-size: 12pt; + } + +} + +@media screen and (max-width: 736px) { + + body, input, select, textarea { + font-size: 12pt; + } + +} + +@media screen and (max-width: 480px) { + + body, input, select, textarea { + font-size: 12pt; + } + +} + +a { + -moz-transition: color 0.2s ease, border-bottom-color 0.2s ease; + -webkit-transition: color 0.2s ease, border-bottom-color 0.2s ease; + -ms-transition: color 0.2s ease, border-bottom-color 0.2s ease; + transition: color 0.2s ease, border-bottom-color 0.2s ease; + border-bottom: dotted 1px rgba(160, 160, 160, 0.65); + color: inherit; + text-decoration: none; +} + +a:before { + -moz-transition: color 0.2s ease; + -webkit-transition: color 0.2s ease; + -ms-transition: color 0.2s ease; + transition: color 0.2s ease; +} + +a:hover { + border-bottom-color: transparent; + color: #DB5C5F !important; +} + +a:hover:before { + color: #DB5C5F !important; +} + +strong, b { + color: #3c3b3b; + font-weight: 700; +} + +em, i { + font-style: italic; +} + +p { + margin: 0 0 2em 0; +} + +h1, h2, h3, h4, h5, h6 { + color: #3c3b3b; + font-family: "Raleway", Helvetica, sans-serif; + font-weight: 800; + letter-spacing: 0.25em; + line-height: 1.65; + margin: 0 0 1em 0; + text-transform: uppercase; +} + +h1 a, h2 a, h3 a, h4 a, h5 a, h6 a { + color: inherit; + border-bottom: 0; +} + +h2 { + font-size: 1.1em; +} + +h3 { + font-size: 0.9em; +} + +h4 { + font-size: 0.7em; +} + +h5 { + font-size: 0.7em; +} + +h6 { + font-size: 0.7em; +} + +sub { + font-size: 0.8em; + position: relative; + top: 0.5em; +} + +sup { + font-size: 0.8em; + position: relative; + top: -0.5em; +} + +blockquote { + border-left: solid 4px rgba(160, 160, 160, 0.3); + font-style: italic; + margin: 0 0 2em 0; + padding: 0.5em 0 0.5em 2em; +} + +code { + background: rgba(160, 160, 160, 0.075); + border: solid 1px rgba(160, 160, 160, 0.3); + font-family: "Courier New", monospace; + font-size: 0.9em; + margin: 0 0.25em; + padding: 0.15em 0.5em; +} + +pre { + font-family: "Courier New", monospace; + font-size: 0.9em; + margin: 0 0 1em 0; + background: rgba(160, 160, 160, 0.075); + padding: 0.25em; + overflow: auto; + border: solid 1px rgba(160, 160, 160, 0.3); + line-height: 1.3em; + color: crimson; +} + +.wrap { + white-space: pre-wrap; /* css-3 */ + white-space: -moz-pre-wrap; /* Mozilla, since 1999 */ + white-space: -pre-wrap; /* Opera 4-6 */ + white-space: -o-pre-wrap; /* Opera 7 */ + word-wrap: break-word; /* Internet Explorer 5.5+ */ +} + +pre code { + display: block; + line-height: 1.2em; + /*padding: 1em 1.5em;*/ + overflow: auto; +} + +hr { + border: 0; + border-bottom: solid 1px rgba(160, 160, 160, 0.3); + margin: 2em 0; +} + +hr.major { + margin: 3em 0; +} + +.align-left { + text-align: left; +} + +.align-center { + text-align: center; +} + +.align-right { + text-align: right; +} + +/* Row */ + +.row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; +} + +.row > * { + box-sizing: border-box; +} + +.row.gtr-uniform > * > :last-child { + margin-bottom: 0; +} + +.row.aln-left { + justify-content: flex-start; +} + +.row.aln-center { + justify-content: center; +} + +.row.aln-right { + justify-content: flex-end; +} + +.row.aln-top { + align-items: flex-start; +} + +.row.aln-middle { + align-items: center; +} + +.row.aln-bottom { + align-items: flex-end; +} + +.row > .imp { + order: -1; +} + +.row > .col-1 { + width: 8.33333%; +} + +.row > .off-1 { + margin-left: 8.33333%; +} + +.row > .col-2 { + width: 16.66667%; +} + +.row > .off-2 { + margin-left: 16.66667%; +} + +.row > .col-3 { + width: 25%; +} + +.row > .off-3 { + margin-left: 25%; +} + +.row > .col-4 { + width: 33.33333%; +} + +.row > .off-4 { + margin-left: 33.33333%; +} + +.row > .col-5 { + width: 41.66667%; +} + +.row > .off-5 { + margin-left: 41.66667%; +} + +.row > .col-6 { + width: 50%; +} + +.row > .off-6 { + margin-left: 50%; +} + +.row > .col-7 { + width: 58.33333%; +} + +.row > .off-7 { + margin-left: 58.33333%; +} + +.row > .col-8 { + width: 66.66667%; +} + +.row > .off-8 { + margin-left: 66.66667%; +} + +.row > .col-9 { + width: 75%; +} + +.row > .off-9 { + margin-left: 75%; +} + +.row > .col-10 { + width: 83.33333%; +} + +.row > .off-10 { + margin-left: 83.33333%; +} + +.row > .col-11 { + width: 91.66667%; +} + +.row > .off-11 { + margin-left: 91.66667%; +} + +.row > .col-12 { + width: 100%; +} + +.row > .off-12 { + margin-left: 100%; +} + +.row.gtr-0 { + margin-top: 0; + margin-left: 0em; +} + +.row.gtr-0 > * { + padding: 0 0 0 0em; +} + +.row.gtr-0.gtr-uniform { + margin-top: 0em; +} + +.row.gtr-0.gtr-uniform > * { + padding-top: 0em; +} + +.row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; +} + +.row.gtr-25 > * { + padding: 0 0 0 0.25em; +} + +.row.gtr-25.gtr-uniform { + margin-top: -0.25em; +} + +.row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; +} + +.row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; +} + +.row.gtr-50 > * { + padding: 0 0 0 0.5em; +} + +.row.gtr-50.gtr-uniform { + margin-top: -0.5em; +} + +.row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; +} + +.row { + margin-top: 0; + margin-left: -1em; +} + +.row > * { + padding: 0 0 0 0; +} + +.row.gtr-uniform { + margin-top: -1em; +} + +.row.gtr-uniform > * { + padding-top: 1em; +} + +.row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; +} + +.row.gtr-150 > * { + padding: 0 0 0 1.5em; +} + +.row.gtr-150.gtr-uniform { + margin-top: -1.5em; +} + +.row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; +} + +.row.gtr-200 { + margin-top: 0; + margin-left: -2em; +} + +.row.gtr-200 > * { + padding: 0 0 0 2em; +} + +.row.gtr-200.gtr-uniform { + margin-top: -2em; +} + +.row.gtr-200.gtr-uniform > * { + padding-top: 2em; +} + +@media screen and (max-width: 1680px) { + + .row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; + } + + .row > * { + box-sizing: border-box; + } + + .row.gtr-uniform > * > :last-child { + margin-bottom: 0; + } + + .row.aln-left { + justify-content: flex-start; + } + + .row.aln-center { + justify-content: center; + } + + .row.aln-right { + justify-content: flex-end; + } + + .row.aln-top { + align-items: flex-start; + } + + .row.aln-middle { + align-items: center; + } + + .row.aln-bottom { + align-items: flex-end; + } + + .row > .imp-xlarge { + order: -1; + } + + .row > .col-1-xlarge { + width: 8.33333%; + } + + .row > .off-1-xlarge { + margin-left: 8.33333%; + } + + .row > .col-2-xlarge { + width: 16.66667%; + } + + .row > .off-2-xlarge { + margin-left: 16.66667%; + } + + .row > .col-3-xlarge { + width: 25%; + } + + .row > .off-3-xlarge { + margin-left: 25%; + } + + .row > .col-4-xlarge { + width: 33.33333%; + } + + .row > .off-4-xlarge { + margin-left: 33.33333%; + } + + .row > .col-5-xlarge { + width: 41.66667%; + } + + .row > .off-5-xlarge { + margin-left: 41.66667%; + } + + .row > .col-6-xlarge { + width: 50%; + } + + .row > .off-6-xlarge { + margin-left: 50%; + } + + .row > .col-7-xlarge { + width: 58.33333%; + } + + .row > .off-7-xlarge { + margin-left: 58.33333%; + } + + .row > .col-8-xlarge { + width: 66.66667%; + } + + .row > .off-8-xlarge { + margin-left: 66.66667%; + } + + .row > .col-9-xlarge { + width: 75%; + } + + .row > .off-9-xlarge { + margin-left: 75%; + } + + .row > .col-10-xlarge { + width: 83.33333%; + } + + .row > .off-10-xlarge { + margin-left: 83.33333%; + } + + .row > .col-11-xlarge { + width: 91.66667%; + } + + .row > .off-11-xlarge { + margin-left: 91.66667%; + } + + .row > .col-12-xlarge { + width: 100%; + } + + .row > .off-12-xlarge { + margin-left: 100%; + } + + .row.gtr-0 { + margin-top: 0; + margin-left: 0em; + } + + .row.gtr-0 > * { + padding: 0 0 0 0em; + } + + .row.gtr-0.gtr-uniform { + margin-top: 0em; + } + + .row.gtr-0.gtr-uniform > * { + padding-top: 0em; + } + + .row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; + } + + .row.gtr-25 > * { + padding: 0 0 0 0.25em; + } + + .row.gtr-25.gtr-uniform { + margin-top: -0.25em; + } + + .row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; + } + + .row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; + } + + .row.gtr-50 > * { + padding: 0 0 0 0.5em; + } + + .row.gtr-50.gtr-uniform { + margin-top: -0.5em; + } + + .row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; + } + + .row { + margin-top: 0; + margin-left: -1em; + } + + .row > * { + padding: 0 0 0 0; + } + + .row.gtr-uniform { + margin-top: -1em; + } + + .row.gtr-uniform > * { + padding-top: 1em; + } + + .row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; + } + + .row.gtr-150 > * { + padding: 0 0 0 1.5em; + } + + .row.gtr-150.gtr-uniform { + margin-top: -1.5em; + } + + .row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; + } + + .row.gtr-200 { + margin-top: 0; + margin-left: -2em; + } + + .row.gtr-200 > * { + padding: 0 0 0 2em; + } + + .row.gtr-200.gtr-uniform { + margin-top: -2em; + } + + .row.gtr-200.gtr-uniform > * { + padding-top: 2em; + } + +} + +@media screen and (max-width: 1280px) { + + .row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; + } + + .row > * { + box-sizing: border-box; + } + + .row.gtr-uniform > * > :last-child { + margin-bottom: 0; + } + + .row.aln-left { + justify-content: flex-start; + } + + .row.aln-center { + justify-content: center; + } + + .row.aln-right { + justify-content: flex-end; + } + + .row.aln-top { + align-items: flex-start; + } + + .row.aln-middle { + align-items: center; + } + + .row.aln-bottom { + align-items: flex-end; + } + + .row > .imp-large { + order: -1; + } + + .row > .col-1-large { + width: 8.33333%; + } + + .row > .off-1-large { + margin-left: 8.33333%; + } + + .row > .col-2-large { + width: 16.66667%; + } + + .row > .off-2-large { + margin-left: 16.66667%; + } + + .row > .col-3-large { + width: 25%; + } + + .row > .off-3-large { + margin-left: 25%; + } + + .row > .col-4-large { + width: 33.33333%; + } + + .row > .off-4-large { + margin-left: 33.33333%; + } + + .row > .col-5-large { + width: 41.66667%; + } + + .row > .off-5-large { + margin-left: 41.66667%; + } + + .row > .col-6-large { + width: 50%; + } + + .row > .off-6-large { + margin-left: 50%; + } + + .row > .col-7-large { + width: 58.33333%; + } + + .row > .off-7-large { + margin-left: 58.33333%; + } + + .row > .col-8-large { + width: 66.66667%; + } + + .row > .off-8-large { + margin-left: 66.66667%; + } + + .row > .col-9-large { + width: 75%; + } + + .row > .off-9-large { + margin-left: 75%; + } + + .row > .col-10-large { + width: 83.33333%; + } + + .row > .off-10-large { + margin-left: 83.33333%; + } + + .row > .col-11-large { + width: 91.66667%; + } + + .row > .off-11-large { + margin-left: 91.66667%; + } + + .row > .col-12-large { + width: 100%; + } + + .row > .off-12-large { + margin-left: 100%; + } + + .row.gtr-0 { + margin-top: 0; + margin-left: 0em; + } + + .row.gtr-0 > * { + padding: 0 0 0 0em; + } + + .row.gtr-0.gtr-uniform { + margin-top: 0em; + } + + .row.gtr-0.gtr-uniform > * { + padding-top: 0em; + } + + .row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; + } + + .row.gtr-25 > * { + padding: 0 0 0 0.25em; + } + + .row.gtr-25.gtr-uniform { + margin-top: -0.25em; + } + + .row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; + } + + .row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; + } + + .row.gtr-50 > * { + padding: 0 0 0 0.5em; + } + + .row.gtr-50.gtr-uniform { + margin-top: -0.5em; + } + + .row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; + } + + .row { + margin-top: 0; + margin-left: -1em; + } + + .row > * { + padding: 0 0 0 0; + } + + .row.gtr-uniform { + margin-top: -1em; + } + + .row.gtr-uniform > * { + padding-top: 1em; + } + + .row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; + } + + .row.gtr-150 > * { + padding: 0 0 0 1.5em; + } + + .row.gtr-150.gtr-uniform { + margin-top: -1.5em; + } + + .row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; + } + + .row.gtr-200 { + margin-top: 0; + margin-left: -2em; + } + + .row.gtr-200 > * { + padding: 0 0 0 2em; + } + + .row.gtr-200.gtr-uniform { + margin-top: -2em; + } + + .row.gtr-200.gtr-uniform > * { + padding-top: 2em; + } + +} + +@media screen and (max-width: 980px) { + + .row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; + } + + .row > * { + box-sizing: border-box; + } + + .row.gtr-uniform > * > :last-child { + margin-bottom: 0; + } + + .row.aln-left { + justify-content: flex-start; + } + + .row.aln-center { + justify-content: center; + } + + .row.aln-right { + justify-content: flex-end; + } + + .row.aln-top { + align-items: flex-start; + } + + .row.aln-middle { + align-items: center; + } + + .row.aln-bottom { + align-items: flex-end; + } + + .row > .imp-medium { + order: -1; + } + + .row > .col-1-medium { + width: 8.33333%; + } + + .row > .off-1-medium { + margin-left: 8.33333%; + } + + .row > .col-2-medium { + width: 16.66667%; + } + + .row > .off-2-medium { + margin-left: 16.66667%; + } + + .row > .col-3-medium { + width: 25%; + } + + .row > .off-3-medium { + margin-left: 25%; + } + + .row > .col-4-medium { + width: 33.33333%; + } + + .row > .off-4-medium { + margin-left: 33.33333%; + } + + .row > .col-5-medium { + width: 41.66667%; + } + + .row > .off-5-medium { + margin-left: 41.66667%; + } + + .row > .col-6-medium { + width: 50%; + } + + .row > .off-6-medium { + margin-left: 50%; + } + + .row > .col-7-medium { + width: 58.33333%; + } + + .row > .off-7-medium { + margin-left: 58.33333%; + } + + .row > .col-8-medium { + width: 66.66667%; + } + + .row > .off-8-medium { + margin-left: 66.66667%; + } + + .row > .col-9-medium { + width: 75%; + } + + .row > .off-9-medium { + margin-left: 75%; + } + + .row > .col-10-medium { + width: 83.33333%; + } + + .row > .off-10-medium { + margin-left: 83.33333%; + } + + .row > .col-11-medium { + width: 91.66667%; + } + + .row > .off-11-medium { + margin-left: 91.66667%; + } + + .row > .col-12-medium { + width: 100%; + } + + .row > .off-12-medium { + margin-left: 100%; + } + + .row.gtr-0 { + margin-top: 0; + margin-left: 0em; + } + + .row.gtr-0 > * { + padding: 0 0 0 0em; + } + + .row.gtr-0.gtr-uniform { + margin-top: 0em; + } + + .row.gtr-0.gtr-uniform > * { + padding-top: 0em; + } + + .row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; + } + + .row.gtr-25 > * { + padding: 0 0 0 0.25em; + } + + .row.gtr-25.gtr-uniform { + margin-top: -0.25em; + } + + .row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; + } + + .row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; + } + + .row.gtr-50 > * { + padding: 0 0 0 0.5em; + } + + .row.gtr-50.gtr-uniform { + margin-top: -0.5em; + } + + .row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; + } + + .row { + margin-top: 0; + margin-left: -1em; + } + + .row > * { + padding: 0 0 0 0; + } + + .row.gtr-uniform { + margin-top: -1em; + } + + .row.gtr-uniform > * { + padding-top: 1em; + } + + .row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; + } + + .row.gtr-150 > * { + padding: 0 0 0 1.5em; + } + + .row.gtr-150.gtr-uniform { + margin-top: -1.5em; + } + + .row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; + } + + .row.gtr-200 { + margin-top: 0; + margin-left: -2em; + } + + .row.gtr-200 > * { + padding: 0 0 0 2em; + } + + .row.gtr-200.gtr-uniform { + margin-top: -2em; + } + + .row.gtr-200.gtr-uniform > * { + padding-top: 2em; + } + +} + +@media screen and (max-width: 736px) { + + .row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; + } + + .row > * { + box-sizing: border-box; + } + + .row.gtr-uniform > * > :last-child { + margin-bottom: 0; + } + + .row.aln-left { + justify-content: flex-start; + } + + .row.aln-center { + justify-content: center; + } + + .row.aln-right { + justify-content: flex-end; + } + + .row.aln-top { + align-items: flex-start; + } + + .row.aln-middle { + align-items: center; + } + + .row.aln-bottom { + align-items: flex-end; + } + + .row > .imp-small { + order: -1; + } + + .row > .col-1-small { + width: 8.33333%; + } + + .row > .off-1-small { + margin-left: 8.33333%; + } + + .row > .col-2-small { + width: 16.66667%; + } + + .row > .off-2-small { + margin-left: 16.66667%; + } + + .row > .col-3-small { + width: 25%; + } + + .row > .off-3-small { + margin-left: 25%; + } + + .row > .col-4-small { + width: 33.33333%; + } + + .row > .off-4-small { + margin-left: 33.33333%; + } + + .row > .col-5-small { + width: 41.66667%; + } + + .row > .off-5-small { + margin-left: 41.66667%; + } + + .row > .col-6-small { + width: 50%; + } + + .row > .off-6-small { + margin-left: 50%; + } + + .row > .col-7-small { + width: 58.33333%; + } + + .row > .off-7-small { + margin-left: 58.33333%; + } + + .row > .col-8-small { + width: 66.66667%; + } + + .row > .off-8-small { + margin-left: 66.66667%; + } + + .row > .col-9-small { + width: 75%; + } + + .row > .off-9-small { + margin-left: 75%; + } + + .row > .col-10-small { + width: 83.33333%; + } + + .row > .off-10-small { + margin-left: 83.33333%; + } + + .row > .col-11-small { + width: 91.66667%; + } + + .row > .off-11-small { + margin-left: 91.66667%; + } + + .row > .col-12-small { + width: 100%; + } + + .row > .off-12-small { + margin-left: 100%; + } + + .row.gtr-0 { + margin-top: 0; + margin-left: 0em; + } + + .row.gtr-0 > * { + padding: 0 0 0 0em; + } + + .row.gtr-0.gtr-uniform { + margin-top: 0em; + } + + .row.gtr-0.gtr-uniform > * { + padding-top: 0em; + } + + .row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; + } + + .row.gtr-25 > * { + padding: 0 0 0 0.25em; + } + + .row.gtr-25.gtr-uniform { + margin-top: -0.25em; + } + + .row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; + } + + .row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; + } + + .row.gtr-50 > * { + padding: 0 0 0 0.5em; + } + + .row.gtr-50.gtr-uniform { + margin-top: -0.5em; + } + + .row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; + } + + .row { + margin-top: 0; + margin-left: -1em; + } + + .row > * { + padding: 0 0 0 0; + } + + .row.gtr-uniform { + margin-top: -1em; + } + + .row.gtr-uniform > * { + padding-top: 1em; + } + + .row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; + } + + .row.gtr-150 > * { + padding: 0 0 0 1.5em; + } + + .row.gtr-150.gtr-uniform { + margin-top: -1.5em; + } + + .row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; + } + + .row.gtr-200 { + margin-top: 0; + margin-left: -2em; + } + + .row.gtr-200 > * { + padding: 0 0 0 2em; + } + + .row.gtr-200.gtr-uniform { + margin-top: -2em; + } + + .row.gtr-200.gtr-uniform > * { + padding-top: 2em; + } + +} + +@media screen and (max-width: 480px) { + + .row { + display: flex; + flex-wrap: wrap; + box-sizing: border-box; + align-items: stretch; + } + + .row > * { + box-sizing: border-box; + } + + .row.gtr-uniform > * > :last-child { + margin-bottom: 0; + } + + .row.aln-left { + justify-content: flex-start; + } + + .row.aln-center { + justify-content: center; + } + + .row.aln-right { + justify-content: flex-end; + } + + .row.aln-top { + align-items: flex-start; + } + + .row.aln-middle { + align-items: center; + } + + .row.aln-bottom { + align-items: flex-end; + } + + .row > .imp-xsmall { + order: -1; + } + + .row > .col-1-xsmall { + width: 8.33333%; + } + + .row > .off-1-xsmall { + margin-left: 8.33333%; + } + + .row > .col-2-xsmall { + width: 16.66667%; + } + + .row > .off-2-xsmall { + margin-left: 16.66667%; + } + + .row > .col-3-xsmall { + width: 25%; + } + + .row > .off-3-xsmall { + margin-left: 25%; + } + + .row > .col-4-xsmall { + width: 33.33333%; + } + + .row > .off-4-xsmall { + margin-left: 33.33333%; + } + + .row > .col-5-xsmall { + width: 41.66667%; + } + + .row > .off-5-xsmall { + margin-left: 41.66667%; + } + + .row > .col-6-xsmall { + width: 50%; + } + + .row > .off-6-xsmall { + margin-left: 50%; + } + + .row > .col-7-xsmall { + width: 58.33333%; + } + + .row > .off-7-xsmall { + margin-left: 58.33333%; + } + + .row > .col-8-xsmall { + width: 66.66667%; + } + + .row > .off-8-xsmall { + margin-left: 66.66667%; + } + + .row > .col-9-xsmall { + width: 75%; + } + + .row > .off-9-xsmall { + margin-left: 75%; + } + + .row > .col-10-xsmall { + width: 83.33333%; + } + + .row > .off-10-xsmall { + margin-left: 83.33333%; + } + + .row > .col-11-xsmall { + width: 91.66667%; + } + + .row > .off-11-xsmall { + margin-left: 91.66667%; + } + + .row > .col-12-xsmall { + width: 100%; + } + + .row > .off-12-xsmall { + margin-left: 100%; + } + + .row.gtr-0 { + margin-top: 0; + margin-left: 0em; + } + + .row.gtr-0 > * { + padding: 0 0 0 0em; + } + + .row.gtr-0.gtr-uniform { + margin-top: 0em; + } + + .row.gtr-0.gtr-uniform > * { + padding-top: 0em; + } + + .row.gtr-25 { + margin-top: 0; + margin-left: -0.25em; + } + + .row.gtr-25 > * { + padding: 0 0 0 0.25em; + } + + .row.gtr-25.gtr-uniform { + margin-top: -0.25em; + } + + .row.gtr-25.gtr-uniform > * { + padding-top: 0.25em; + } + + .row.gtr-50 { + margin-top: 0; + margin-left: -0.5em; + } + + .row.gtr-50 > * { + padding: 0 0 0 0.5em; + } + + .row.gtr-50.gtr-uniform { + margin-top: -0.5em; + } + + .row.gtr-50.gtr-uniform > * { + padding-top: 0.5em; + } + + .row { + margin-top: 0; + margin-left: -1em; + } + + .row > * { + padding: 0 0 0 0; + } + + .row.gtr-uniform { + margin-top: -1em; + } + + .row.gtr-uniform > * { + padding-top: 1em; + } + + .row.gtr-150 { + margin-top: 0; + margin-left: -1.5em; + } + + .row.gtr-150 > * { + padding: 0 0 0 1.5em; + } + + .row.gtr-150.gtr-uniform { + margin-top: -1.5em; + } + + .row.gtr-150.gtr-uniform > * { + padding-top: 1.5em; + } + + .row.gtr-200 { + margin-top: 0; + margin-left: -2em; + } + + .row.gtr-200 > * { + padding: 0 0 0 2em; + } + + .row.gtr-200.gtr-uniform { + margin-top: -2em; + } + + .row.gtr-200.gtr-uniform > * { + padding-top: 2em; + } + +} + +/* Author */ + +.author { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-flex-direction: row; + -webkit-flex-direction: row; + -ms-flex-direction: row; + flex-direction: row; + -moz-align-items: center; + -webkit-align-items: center; + -ms-align-items: center; + align-items: center; + -moz-justify-content: -moz-flex-end; + -webkit-justify-content: -webkit-flex-end; + -ms-justify-content: -ms-flex-end; + justify-content: flex-end; + border-bottom: 0; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + text-transform: uppercase; + white-space: nowrap; +} + +.author .name { + -moz-transition: border-bottom-color 0.2s ease; + -webkit-transition: border-bottom-color 0.2s ease; + -ms-transition: border-bottom-color 0.2s ease; + transition: border-bottom-color 0.2s ease; + border-bottom: dotted 1px rgba(160, 160, 160, 0.65); + display: block; + margin: 0 1.5em 0 0; +} + +.author img { + border-radius: 100%; + display: block; + width: 4em; +} + +.author:hover .name { + border-bottom-color: transparent; +} + +/* Blurb */ + +.blurb h2 { + font-size: 0.8em; + margin: 0 0 1.5em 0; +} + +.blurb h3 { + font-size: 0.7em; +} + +.blurb p { + font-size: 0.9em; +} + +/* Box */ + +.box { + border: solid 1px rgba(160, 160, 160, 0.3); + margin-bottom: 2em; + padding: 1.5em; +} + +.box > :last-child, +.box > :last-child > :last-child, +.box > :last-child > :last-child > :last-child { + margin-bottom: 0; +} + +.box.alt { + border: 0; + border-radius: 0; + padding: 0; +} + +/* Button */ + +input[type="submit"], +input[type="reset"], +input[type="button"], +button, +.button { + -moz-appearance: none; + -webkit-appearance: none; + -ms-appearance: none; + appearance: none; + -moz-transition: background-color 0.2s ease, box-shadow 0.2s ease, color 0.2s ease; + -webkit-transition: background-color 0.2s ease, box-shadow 0.2s ease, color 0.2s ease; + -ms-transition: background-color 0.2s ease, box-shadow 0.2s ease, color 0.2s ease; + transition: background-color 0.2s ease, box-shadow 0.2s ease, color 0.2s ease; + background-color: transparent; + border: 0; + box-shadow: inset 0 0 0 1px rgba(160, 160, 160, 0.3); + color: #3c3b3b !important; + cursor: pointer; + display: inline-block; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 800; + height: 4.8125em; + letter-spacing: 0.25em; + line-height: 4.8125em; + padding: 0 2.5em; + text-align: center; + text-decoration: none; + text-transform: uppercase; + white-space: nowrap; +} + +input[type="submit"]:hover, +input[type="reset"]:hover, +input[type="button"]:hover, +button:hover, +.button:hover { + box-shadow: inset 0 0 0 1px #2ebaae; + color: #2ebaae !important; +} + +input[type="submit"]:hover:active, +input[type="reset"]:hover:active, +input[type="button"]:hover:active, +button:hover:active, +.button:hover:active { + background-color: rgba(46, 186, 174, 0.05); +} + +input[type="submit"]:before, input[type="submit"]:after, +input[type="reset"]:before, +input[type="reset"]:after, +input[type="button"]:before, +input[type="button"]:after, +button:before, +button:after, +.button:before, +.button:after { + color: #aaaaaa; + position: relative; +} + +input[type="submit"]:before, +input[type="reset"]:before, +input[type="button"]:before, +button:before, +.button:before { + left: -1em; + padding: 0 0 0 0.75em; +} + +input[type="submit"]:after, +input[type="reset"]:after, +input[type="button"]:after, +button:after, +.button:after { + left: 1em; + padding: 0 0.75em 0 0; +} + +input[type="submit"].fit, +input[type="reset"].fit, +input[type="button"].fit, +button.fit, +.button.fit { + width: 100%; +} + +input[type="submit"].large, +input[type="reset"].large, +input[type="button"].large, +button.large, +.button.large { + font-size: 0.7em; + padding: 0 3em; +} + +input[type="submit"].small, +input[type="reset"].small, +input[type="button"].small, +button.small, +.button.small { + font-size: 0.5em; +} + +input[type="submit"].disabled, input[type="submit"]:disabled, +input[type="reset"].disabled, +input[type="reset"]:disabled, +input[type="button"].disabled, +input[type="button"]:disabled, +button.disabled, +button:disabled, +.button.disabled, +.button:disabled { + pointer-events: none; + color: rgba(160, 160, 160, 0.3) !important; +} + +input[type="submit"].disabled:before, input[type="submit"]:disabled:before, +input[type="reset"].disabled:before, +input[type="reset"]:disabled:before, +input[type="button"].disabled:before, +input[type="button"]:disabled:before, +button.disabled:before, +button:disabled:before, +.button.disabled:before, +.button:disabled:before { + color: rgba(160, 160, 160, 0.3) !important; +} + +/* Form */ + +form { + margin: 0 0 2em 0; +} + +form.search { + text-decoration: none; + position: relative; +} + +form.search:before { + -moz-osx-font-smoothing: grayscale; + -webkit-font-smoothing: antialiased; + display: inline-block; + font-style: normal; + font-variant: normal; + text-rendering: auto; + line-height: 1; + text-transform: none !important; + font-family: 'Font Awesome 5 Free'; + font-weight: 900; +} + +form.search:before { + color: #aaaaaa; + content: '\f002'; + display: block; + height: 2.75em; + left: 0; + line-height: 2.75em; + position: absolute; + text-align: center; + top: 0; + width: 2.5em; +} + +form.search > input:first-child { + padding-left: 2.5em; +} + +label { + color: #3c3b3b; + display: block; + font-size: 0.9em; + font-weight: 700; + margin: 0 0 1em 0; +} + +input[type="text"], +input[type="password"], +input[type="email"], +input[type="tel"], +select, +textarea { + -moz-appearance: none; + -webkit-appearance: none; + -ms-appearance: none; + appearance: none; + background: rgba(160, 160, 160, 0.075); + border: none; + border: solid 1px rgba(160, 160, 160, 0.3); + border-radius: 0; + color: inherit; + display: block; + outline: 0; + padding: 0 1em; + text-decoration: none; + width: 100%; +} + +input[type="text"]:invalid, +input[type="password"]:invalid, +input[type="email"]:invalid, +input[type="tel"]:invalid, +select:invalid, +textarea:invalid { + box-shadow: none; +} + +input[type="text"]:focus, +input[type="password"]:focus, +input[type="email"]:focus, +input[type="tel"]:focus, +select:focus, +textarea:focus { + border-color: #2ebaae; + box-shadow: inset 0 0 0 1px #2ebaae; +} + +.select-wrapper { + text-decoration: none; + display: block; + position: relative; +} + +.select-wrapper:before { + -moz-osx-font-smoothing: grayscale; + -webkit-font-smoothing: antialiased; + display: inline-block; + font-style: normal; + font-variant: normal; + text-rendering: auto; + line-height: 1; + text-transform: none !important; + font-family: 'Font Awesome 5 Free'; + font-weight: 900; +} + +.select-wrapper:before { + color: rgba(160, 160, 160, 0.3); + content: '\f078'; + display: block; + height: 2.75em; + line-height: 2.75em; + pointer-events: none; + position: absolute; + right: 0; + text-align: center; + top: 0; + width: 2.75em; +} + +.select-wrapper select::-ms-expand { + display: none; +} + +select { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' width='40' height='40' preserveAspectRatio='none' viewBox='0 0 40 40'%3E%3Cpath d='M9.4,12.3l10.4,10.4l10.4-10.4c0.2-0.2,0.5-0.4,0.9-0.4c0.3,0,0.6,0.1,0.9,0.4l3.3,3.3c0.2,0.2,0.4,0.5,0.4,0.9 c0,0.4-0.1,0.6-0.4,0.9L20.7,31.9c-0.2,0.2-0.5,0.4-0.9,0.4c-0.3,0-0.6-0.1-0.9-0.4L4.3,17.3c-0.2-0.2-0.4-0.5-0.4-0.9 c0-0.4,0.1-0.6,0.4-0.9l3.3-3.3c0.2-0.2,0.5-0.4,0.9-0.4S9.1,12.1,9.4,12.3z' fill='rgba(160, 160, 160, 0.3)' /%3E%3C/svg%3E"); + background-size: 1.25rem; + background-repeat: no-repeat; + background-position: calc(100% - 1rem) center; + height: 2.75em; + padding-right: 2.75em; + text-overflow: ellipsis; +} + +select option { + color: #3c3b3b; + background: #ffffff; +} + +select:focus::-ms-value { + background-color: transparent; +} + +select::-ms-expand { + display: none; +} + +input[type="text"], +input[type="password"], +input[type="email"], +select { + height: 2.75em; +} + +textarea { + padding: 0.75em 1em; +} + +input[type="checkbox"], +input[type="radio"] { + -moz-appearance: none; + -webkit-appearance: none; + -ms-appearance: none; + appearance: none; + display: block; + float: left; + margin-right: -2em; + opacity: 0; + width: 1em; + z-index: -1; +} + +input[type="checkbox"] + label, +input[type="radio"] + label { + text-decoration: none; + color: #646464; + cursor: pointer; + display: inline-block; + font-size: 1em; + font-weight: 400; + padding-left: 2.4em; + padding-right: 0.75em; + position: relative; +} + +input[type="checkbox"] + label:before, +input[type="radio"] + label:before { + -moz-osx-font-smoothing: grayscale; + -webkit-font-smoothing: antialiased; + display: inline-block; + font-style: normal; + font-variant: normal; + text-rendering: auto; + line-height: 1; + text-transform: none !important; + font-family: 'Font Awesome 5 Free'; + font-weight: 900; +} + +input[type="checkbox"] + label:before, +input[type="radio"] + label:before { + background: rgba(160, 160, 160, 0.075); + border: solid 1px rgba(160, 160, 160, 0.3); + content: ''; + display: inline-block; + font-size: 0.8em; + height: 2.0625em; + left: 0; + line-height: 2.0625em; + position: absolute; + text-align: center; + top: 0; + width: 2.0625em; +} + +input[type="checkbox"]:checked + label:before, +input[type="radio"]:checked + label:before { + background: #3c3b3b; + border-color: #3c3b3b; + color: #ffffff; + content: '\f00c'; +} + +input[type="checkbox"]:focus + label:before, +input[type="radio"]:focus + label:before { + border-color: #2ebaae; + box-shadow: 0 0 0 1px #2ebaae; +} + +input[type="radio"] + label:before { + border-radius: 100%; +} + +::-webkit-input-placeholder { + color: #aaaaaa !important; + opacity: 1.0; +} + +:-moz-placeholder { + color: #aaaaaa !important; + opacity: 1.0; +} + +::-moz-placeholder { + color: #aaaaaa !important; + opacity: 1.0; +} + +:-ms-input-placeholder { + color: #aaaaaa !important; + opacity: 1.0; +} + +/* Icon */ + +.icon { + text-decoration: none; + border-bottom: none; + position: relative; +} + +.icon:before { + -moz-osx-font-smoothing: grayscale; + -webkit-font-smoothing: antialiased; + display: inline-block; + font-style: normal; + font-variant: normal; + text-rendering: auto; + line-height: 1; + text-transform: none !important; + font-family: 'Font Awesome 5 Free'; + font-weight: 400; +} + +.icon > .label { + display: none; +} + +.icon:before { + line-height: inherit; +} + +.icon.solid:before { + font-weight: 900; +} + +.icon.brands:before { + font-family: 'Font Awesome 5 Brands'; +} + +.icon.suffix:before { + float: right; +} + +/* Image */ + +.image { + border: 0; + display: inline-block; + position: relative; +} + +.image img { + display: block; +} + +.image.left, .image.right { + max-width: 40%; +} + +.image.left img, .image.right img { + width: 100%; +} + +.image.left { + float: left; + padding: 0 1.5em 1em 0; + top: 0.25em; +} + +.image.right { + float: right; + padding: 0 0 1em 1.5em; + top: 0.25em; +} + +.image.fit { + display: block; + margin: 0 0 2em 0; + width: 100%; +} + +.image.fit img { + width: 100%; +} + +.image.featured { + display: block; + margin: 0 0 3em 0; + width: 100%; +} + +.image.featured img { + width: 100%; +} + +@media screen and (max-width: 736px) { + + .image.featured { + margin: 0 0 1.5em 0; + } + +} + +.image.main { + display: block; + margin: 0 0 3em 0; + width: 100%; +} + +.image.main img { + width: 100%; +} + +/* List */ + +ol { + list-style: decimal; + margin: 0 0 2em 0; + padding-left: 1.25em; +} + +ol li { + padding-left: 0.25em; +} + +ul { + list-style: disc; + margin: 0 0 2em 0; + padding-left: 1em; +} + +ul li { + padding-left: 0.5em; +} + +ul.alt { + list-style: none; + padding-left: 0; +} + +ul.alt li { + border-top: solid 1px rgba(160, 160, 160, 0.3); + padding: 0.5em 0; +} + +ul.alt li:first-child { + border-top: 0; + padding-top: 0; +} + +dl { + margin: 0 0 2em 0; +} + +dl dt { + display: block; + font-weight: 700; + margin: 0 0 0 0; +} + +dl dd { + margin-left: 2em; + margin-bottom: 1em; +} + +/* Actions */ + +ul.actions { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + cursor: default; + list-style: none; + margin-left: -1em; + padding-left: 0; +} + +ul.actions li { + padding: 0 0 0 1em; + vertical-align: middle; +} + +ul.actions.special { + -moz-justify-content: center; + -webkit-justify-content: center; + -ms-justify-content: center; + justify-content: center; + width: 100%; + margin-left: 0; +} + +ul.actions.special li:first-child { + padding-left: 0; +} + +ul.actions.stacked { + -moz-flex-direction: column; + -webkit-flex-direction: column; + -ms-flex-direction: column; + flex-direction: column; + margin-left: 0; +} + +ul.actions.stacked li { + padding: 1.3em 0 0 0; +} + +ul.actions.stacked li:first-child { + padding-top: 0; +} + +ul.actions.fit { + width: calc(100% + 1em); +} + +ul.actions.fit li { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; + -moz-flex-shrink: 1; + -webkit-flex-shrink: 1; + -ms-flex-shrink: 1; + flex-shrink: 1; + width: 100%; +} + +ul.actions.fit li > * { + width: 100%; +} + +ul.actions.fit.stacked { + width: 100%; +} + +@media screen and (max-width: 480px) { + + ul.actions:not(.fixed) { + -moz-flex-direction: column; + -webkit-flex-direction: column; + -ms-flex-direction: column; + flex-direction: column; + margin-left: 0; + width: 100% !important; + } + + ul.actions:not(.fixed) li { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; + -moz-flex-shrink: 1; + -webkit-flex-shrink: 1; + -ms-flex-shrink: 1; + flex-shrink: 1; + padding: 1em 0 0 0; + text-align: center; + width: 100%; + } + + ul.actions:not(.fixed) li > * { + width: 100%; + } + + ul.actions:not(.fixed) li:first-child { + padding-top: 0; + } + + ul.actions:not(.fixed) li input[type="submit"], + ul.actions:not(.fixed) li input[type="reset"], + ul.actions:not(.fixed) li input[type="button"], + ul.actions:not(.fixed) li button, + ul.actions:not(.fixed) li .button { + width: 100%; + } + + ul.actions:not(.fixed) li input[type="submit"].icon:before, + ul.actions:not(.fixed) li input[type="reset"].icon:before, + ul.actions:not(.fixed) li input[type="button"].icon:before, + ul.actions:not(.fixed) li button.icon:before, + ul.actions:not(.fixed) li .button.icon:before { + margin-left: -0.5em; + } + +} + +/* Icons */ + +ul.icons { + cursor: default; + list-style: none; + padding-left: 0; + margin-top: 1.5em; +} + +ul.icons li { + display: inline-block; + padding: 0 1em 0 0; +} + +ul.icons li:last-child { + padding-right: 0; +} + +ul.icons li > * { + border: 0; +} + +ul.icons li > * .label { + display: none; +} + +/* Posts */ + +ul.posts { + list-style: none; + padding: 0; +} + +ul.posts li { + border-top: dotted 1px rgba(160, 160, 160, 0.3); + margin: 1.5em 0 0 0; + padding: 1.5em 0 0 0; +} + +ul.posts li:first-child { + border-top: 0; + margin-top: 0; + padding-top: 0; +} + +ul.posts article { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-align-items: -moz-flex-start; + -webkit-align-items: -webkit-flex-start; + -ms-align-items: -ms-flex-start; + align-items: flex-start; + -moz-flex-direction: row-reverse; + -webkit-flex-direction: row-reverse; + -ms-flex-direction: row-reverse; + flex-direction: row-reverse; +} + +ul.posts article .image { + display: block; + margin-right: 1.5em; + min-width: 4em; + width: 4em; +} + +ul.posts article .image img { + width: 100%; +} + +ul.posts article header { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; + -ms-flex: 1; +} + +ul.posts article header h3 { + font-size: 0.7em; + margin-top: 0.125em; +} + +ul.posts article header .published { + display: block; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + margin: -0.625em 0 1.7em 0; + text-transform: uppercase; +} + +ul.posts article header > :last-child { + margin-bottom: 0; +} + +/* Mini Post */ + +.mini-post { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-flex-direction: column-reverse; + -webkit-flex-direction: column-reverse; + -ms-flex-direction: column-reverse; + flex-direction: column; + background: #ffffff; + border: solid 1px rgba(160, 160, 160, 0.3); + margin: 0 0 2em 0; +} + +.mini-post .image { + overflow: hidden; + width: 100%; +} + +.mini-post .image img { + -moz-transition: -moz-transform 0.2s ease-out; + -webkit-transition: -webkit-transform 0.2s ease-out; + -ms-transition: -ms-transform 0.2s ease-out; + transition: transform 0.2s ease-out; + width: 100%; +} + +.mini-post .image:hover img { + -moz-transform: scale(1.05); + -webkit-transform: scale(1.05); + -ms-transform: scale(1.05); + transform: scale(1.05); +} + +.mini-post header { + padding: 1.25em 4.25em 0.1em 1.25em; + min-height: 4em; + position: relative; + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; +} + +.mini-post header h3 { + font-size: 0.7em; +} + +.mini-post header .published { + display: block; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + margin: -0.625em 0 1.7em 0; + text-transform: uppercase; +} + +.mini-post header .author { + position: absolute; + right: 2em; + top: 2em; +} + +.mini-posts { + margin: 0 0 2em 0; +} + +@media screen and (max-width: 1280px) { + + .mini-posts { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-flex-wrap: wrap; + -webkit-flex-wrap: wrap; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + width: calc(100% + 2em); + } + + .mini-posts > * { + margin: 2em 2em 0 0; + width: calc(50% - 2em); + } + + .mini-posts > :nth-child(-n + 2) { + margin-top: 0; + } + +} + +@media screen and (max-width: 480px) { + + .mini-posts { + display: block; + width: 100%; + } + + .mini-posts > * { + margin: 0 0 2em 0; + width: 100%; + } + +} + +/* Post */ + +.post { + padding: 3em 3em 1em 3em; + background: #ffffff; + border: solid 1px rgba(160, 160, 160, 0.3); + margin: 0 0 3em 0; + position: relative; +} + +.post > header { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + border-bottom: solid 1px rgba(160, 160, 160, 0.3); + left: -3em; + margin: -3em 0 3em 0; + position: relative; + width: calc(100% + 6em); +} + +.post > header .title { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; + -ms-flex: 1; + padding: 3.75em 3em 3.3em 3em; +} + +.post > header .title h2 { + font-weight: 900; + font-size: 1.3em; +} + +.post > header .title > :last-child { + margin-bottom: 0; +} + +.post > header .meta { + padding: 3.75em 2em 1.75em 2em; + border-left: solid 1px rgba(160, 160, 160, 0.3); + min-width: 17em; + text-align: right; + width: 17em; +} + +.post > header .meta > * { + margin: 0 0 0 0; +} + +.post > header .meta > :last-child { + margin-bottom: 0; +} + +.post > header .meta .published { + color: #3c3b3b; + display: block; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.7em; + font-weight: 800; + letter-spacing: 0.25em; + margin-top: 0.5em; + text-transform: uppercase; + white-space: nowrap; +} + +.post .content a { + color: #4DABAC; +} + +.post > a.image.featured { + overflow: hidden; +} + +.post > a.image.featured img { + -moz-transition: -moz-transform 0.2s ease-out; + -webkit-transition: -webkit-transform 0.2s ease-out; + -ms-transition: -ms-transform 0.2s ease-out; + transition: transform 0.2s ease-out; +} + +.post > a.image.featured:hover img { + -moz-transform: scale(1.05); + -webkit-transform: scale(1.05); + -ms-transform: scale(1.05); + transform: scale(1.05); +} + +.post > footer { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-align-items: center; + -webkit-align-items: center; + -ms-align-items: center; + align-items: center; +} + +.post > footer .actions { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; +} + +.stats { + cursor: default; + list-style: none; + padding: 0; + text-align: right; + min-width: 20%; +} + +.stats li { + border-left: solid 1px rgba(160, 160, 160, 0.3); + display: inline-block; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + line-height: 1; + margin: 0 0 0 2em; + padding: 0 0 0 2em; + text-transform: uppercase; +} + +.stats li:first-child { + border-left: 0; + margin-left: 0; + padding-left: 0; +} + +.stats li .icon { + border-bottom: 0; +} + +.stats li .icon:before { + color: rgba(160, 160, 160, 0.3); + margin-right: 0.75em; +} + +.sys-stats { + text-align: left; + margin: 0; +} + +.list-stats { + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + line-height: 1.3em; + font-variant: small-caps; + color: #999; +} + +@media screen and (max-width: 980px) { + + .post { + border-left: 0; + border-right: 0; + left: -3em; + width: calc(100% + (3em * 2)); + } + + .post > header { + -moz-flex-direction: column; + -webkit-flex-direction: column; + -ms-flex-direction: column; + flex-direction: column; + padding: 3.75em 3em 1.25em 3em; + border-left: 0; + } + + .post > header .title { + -ms-flex: 0 1 auto; + margin: 0 0 2em 0; + padding: 0; + text-align: center; + } + + .post > header .meta { + -moz-align-items: center; + -webkit-align-items: center; + -ms-align-items: center; + align-items: center; + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-justify-content: center; + -webkit-justify-content: center; + -ms-justify-content: center; + justify-content: center; + border-left: 0; + margin: 0 0 2em 0; + padding-top: 0; + padding: 0; + text-align: left; + width: 100%; + } + + .post > header .meta > * { + border-left: solid 1px rgba(160, 160, 160, 0.3); + margin-left: 2em; + padding-left: 2em; + } + + .post > header .meta > :first-child { + border-left: 0; + margin-left: 0; + padding-left: 0; + } + + .post > header .meta .published { + margin-bottom: 0; + margin-top: 0; + } + + .post > header .meta .author { + -moz-flex-direction: row-reverse; + -webkit-flex-direction: row-reverse; + -ms-flex-direction: row-reverse; + flex-direction: row-reverse; + margin-bottom: 0; + } + + .post > header .meta .author .name { + margin: 0 0 0 1.5em; + } + + .post > header .meta .author img { + width: 3.5em; + } + +} + +@media screen and (max-width: 736px) { + + .post { + padding: 1.5em 1.5em 0.1em 1.5em; + left: -1.5em; + margin: 0 0 2em 0; + width: calc(100% + (1.5em * 2)); + } + + .post > header { + padding: 3em 1.5em 0.5em 1.5em; + left: -1.5em; + margin: -1.5em 0 1.5em 0; + width: calc(100% + 3em); + } + + .post > header .title h2 { + font-size: 1.1em; + } + +} + +@media screen and (max-width: 480px) { + + .post > header .meta { + -moz-align-items: center; + -webkit-align-items: center; + -ms-align-items: center; + align-items: center; + -moz-flex-direction: column; + -webkit-flex-direction: column; + -ms-flex-direction: column; + flex-direction: column; + } + + .post > header .meta > * { + border-left: 0; + margin: 1em 0 0 0; + padding-left: 0; + } + + .post > header .meta .author .name { + display: none; + } + + .post > .image.featured { + margin-left: -1.5em; + margin-top: calc(-1.5em - 1px); + width: calc(100% + 3em); + } + + .post > footer { + -moz-align-items: -moz-stretch; + -webkit-align-items: -webkit-stretch; + -ms-align-items: -ms-stretch; + align-items: stretch; + -moz-flex-direction: column-reverse; + -webkit-flex-direction: column-reverse; + -ms-flex-direction: column-reverse; + flex-direction: column-reverse; + } + + .post > footer .stats { + text-align: center; + } + + .post > footer .stats li { + margin: 0 0 0 1.25em; + padding: 0 0 0 1.25em; + } + +} + +/* Section/Article */ + +section.special, article.special { + text-align: center; +} + +header p { + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.7em; + font-weight: 400; + letter-spacing: 0.25em; + line-height: 2.5; + margin-top: -1em; + text-transform: uppercase; +} + +/* Table */ + +.table-wrapper { + -webkit-overflow-scrolling: touch; + overflow-x: auto; +} + +table { + margin: 0 0 2em 0; + width: 100%; +} + +table tbody tr { + border: solid 1px rgba(160, 160, 160, 0.3); + border-left: 0; + border-right: 0; +} + +table tbody tr:nth-child(2n + 1) { + background-color: rgba(160, 160, 160, 0.075); +} + +table td { + padding: 0.75em 0.75em; +} + +table th { + color: #3c3b3b; + font-size: 0.9em; + font-weight: 700; + padding: 0 0.75em 0.75em 0.75em; + text-align: left; +} + +table thead { + border-bottom: solid 2px rgba(160, 160, 160, 0.3); +} + +table tfoot { + border-top: solid 2px rgba(160, 160, 160, 0.3); +} + +table.alt { + border-collapse: separate; +} + +table.alt tbody tr td { + border: solid 1px rgba(160, 160, 160, 0.3); + border-left-width: 0; + border-top-width: 0; +} + +table.alt tbody tr td:first-child { + border-left-width: 1px; +} + +table.alt tbody tr:first-child td { + border-top-width: 1px; +} + +table.alt thead { + border-bottom: 0; +} + +table.alt tfoot { + border-top: 0; +} + +/* Header */ + +body { + padding-top: 3.5em; + background-image: url("images/intro.svg"); + background-position: top right; + background-repeat: no-repeat; + background-size: 100% 100%; +} + +#header { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-justify-content: space-between; + -webkit-justify-content: space-between; + -ms-justify-content: space-between; + justify-content: space-between; + background-color: #ffffff; + border-bottom: solid 1px rgba(160, 160, 160, 0.3); + height: 3.5em; + left: 0; + line-height: 3.5em; + position: fixed; + top: 0; + width: 100%; + z-index: 10000; +} + +#header a { + color: inherit; + text-decoration: none; +} + +#header ul { + list-style: none; + margin: 0; + padding-left: 0; +} + +#header ul li { + display: inline-block; + padding-left: 0; +} + +#header h1 { + height: inherit; + line-height: inherit; + padding: 0.3em 0 0 1.5em; + white-space: nowrap; +} + +#header h1 a { + font-size: 0.7em; +} + +#header .links { + -moz-flex: 1; + -webkit-flex: 1; + -ms-flex: 1; + flex: 1; + border-left: solid 1px rgba(160, 160, 160, 0.3); + height: inherit; + line-height: inherit; + margin-left: 1.5em; + /*overflow: hidden;*/ + padding-left: 1.5em; +} + +#header .links ul li { + border-left: solid 1px rgba(160, 160, 160, 0.3); + line-height: 1; + margin-left: 1em; + padding-left: 1em; +} + +#header .links ul li:first-child { + border-left: 0; + margin-left: 0; + padding-left: 0; +} + +#header .links ul li a { + border-bottom: 0; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.7em; + font-weight: 400; + letter-spacing: 0.25em; + text-transform: uppercase; +} + +#header .main { + height: inherit; + line-height: inherit; + text-align: right; +} + +#header .main ul { + height: inherit; + line-height: inherit; +} + +#header .main ul li { + /* border-left: solid 1px rgba(160, 160, 160, 0.3); */ + height: inherit; + line-height: inherit; + white-space: nowrap; +} + +#header .main ul li > * { + display: block; + float: left; +} + +#header .main ul li > a { + text-decoration: none; + border-bottom: 0; + color: #aaaaaa; + overflow: hidden; + position: relative; + text-indent: 4em; + width: 4em; +} + +#header .main ul li > a:before { + -moz-osx-font-smoothing: grayscale; + -webkit-font-smoothing: antialiased; + display: inline-block; + font-style: normal; + font-variant: normal; + text-rendering: auto; + line-height: 1; + text-transform: none !important; + font-family: 'Font Awesome 5 Free'; + font-weight: 900; +} + +#header .main ul li > a:before { + display: block; + height: inherit; + left: 0; + line-height: inherit; + position: absolute; + text-align: center; + text-indent: 0; + top: 0; + width: inherit; +} + +.getinvolved { + overflow: visible !important; + text-indent: 0 !important; + width: auto !important; + background-color: #EC762F; + color: #fff !important; + padding: 0 0.5em; +} + +.getinvolved:hover { + box-shadow: #8C471D inset 0 0 10px; + color: #fff !important; +} + +#header form { + margin: 0; +} + +#header form input { + display: inline-block; + height: 2.5em; + position: relative; + top: -2px; + vertical-align: middle; +} + +#header #search { + -moz-transition: all 0.5s ease; + -webkit-transition: all 0.5s ease; + -ms-transition: all 0.5s ease; + transition: all 0.5s ease; + max-width: 0; + opacity: 0; + overflow: hidden; + padding: 0; + white-space: nowrap; +} + +#header #search input { + width: 12em; +} + +#header #search.visible { + max-width: 12.5em; + opacity: 1; + padding: 0 0.5em 0 0; +} + +@media screen and (max-width: 980px) { + + #header .links { + display: none; + } + +} + +@media screen and (max-width: 736px) { + + #header { + height: 2.75em; + line-height: 2.75em; + } + + #header h1 { + padding: 0.3em 0 0 1em; + } + + #header .main .search { + display: none; + } + +} + +/* Wrapper */ + +#wrapper { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-flex-direction: row-reverse; + -webkit-flex-direction: row-reverse; + -ms-flex-direction: row-reverse; + flex-direction: row-reverse; + -moz-transition: opacity 0.5s ease; + -webkit-transition: opacity 0.5s ease; + -ms-transition: opacity 0.5s ease; + transition: opacity 0.5s ease; + margin: 0 auto; + max-width: 100%; + opacity: 1; + padding: 4.5em; + width: 90em; +} + +body.is-menu-visible #wrapper { + opacity: 0.15; +} + +@media screen and (max-width: 1680px) { + + #wrapper { + padding: 1em; + } + +} + +@media screen and (max-width: 1280px) { + + #wrapper { + display: block; + } + +} + +@media screen and (max-width: 736px) { + + #wrapper { + padding: 1.5em; + } + +} + +body.single #wrapper { + display: block; +} + +/* Main */ + +#main { + -moz-flex-grow: 1; + -webkit-flex-grow: 1; + -ms-flex-grow: 1; + flex-grow: 1; + -ms-flex: 1; + max-width: 100%; + min-width: 0; +} + +#main .bb-title { + margin-bottom: 0.5em; + font-size: 0.8em; + line-height: 1.3em; + text-align: center; +} + +#main .bb-text { + line-height: 1.3em; + color: #999; + text-align: center; + font-size: 0.9em; +} + +#main .pull-left { + margin-right: 0.5em; + text-align: center; + font-size: 2em; +} + +/* Sidebar */ + +#sidebar { + margin-right: 3em; + min-width: 22em; + width: 22em; +} + +#sidebar > * { + border-top: solid 1px rgba(160, 160, 160, 0.3); + margin: 3em 0 0 0; + padding: 3em 0 0 0; +} + +#sidebar > :first-child { + border-top: 0; + margin-top: 0; + padding-top: 0; +} + +#sidebar .release a, #main .release-box a { + background-color: #DB5C5F; + color: #fff; + text-align: center; + padding: 0.5em 0 0.5em; + border-radius: 0.5em; + vertical-align: top; + float: none; +} + +#sidebar .release a:hover, #main .release-box a:hover { + text-decoration: none; + background-color: #b64b4e; + color: #fff !important; +} + +#sidebar .release .title { + margin-bottom: 0.5em; + font-size: 0.9em; + font-weight: bold; +} + +#sidebar .release .released { + font-size: 0.8em; + font-style: italic; + text-align: right; + margin-right: 1em; + margin-top: 0.5em; +} + +@media screen and (max-width: 1280px) { + + #sidebar { + border-top: solid 1px rgba(160, 160, 160, 0.3); + margin: 3em 0 0 0; + min-width: 0; + padding: 3em 0 0 0; + width: 100%; + overflow-x: hidden; + } + +} + +/* Intro */ + +#intro { + text-align: center; +} + +#intro .logo { + border-bottom: 0; +} + +#intro .logo img { + width: 22em; +} + +#intro header h2 { + font-size: 0.8em; + font-weight: bold; + color: #666; + line-height: 1.5em; +} + +#intro header p { + font-size: 0.7em; +} + +@media screen and (max-width: 1280px) { + + #intro { + margin: 0 0 3em 0; + text-align: center; + } + + #intro header h2 { + font-size: 1.3em; + } + + #intro header p { + font-size: 0.7em; + } + +} + +@media screen and (max-width: 736px) { + + #intro { + margin: 0 0 1.5em 0; + padding: 1.25em 0; + } + + #intro > :last-child { + margin-bottom: 0; + } + + #intro .logo { + margin: 0 0 0.5em 0; + } + + #intro header h2 { + font-size: 1.25em; + } + + #intro header > :last-child { + margin-bottom: 0; + } + +} + +/* Footer */ + +#footer .icons { + color: #aaaaaa; +} + +#footer .copyright { + color: #999; + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.7em; + font-weight: 400; + letter-spacing: 0.25em; +} + +#footer .copyright img { + margin: 1em 2em 2em 0; + max-width: 13em; +} + +body.single #footer { + text-align: center; +} + +/* Menu */ + +#menu { + -moz-transform: translateX(25em); + -webkit-transform: translateX(25em); + -ms-transform: translateX(25em); + transform: translateX(25em); + -moz-transition: -moz-transform 0.5s ease, visibility 0.5s; + -webkit-transition: -webkit-transform 0.5s ease, visibility 0.5s; + -ms-transition: -ms-transform 0.5s ease, visibility 0.5s; + transition: transform 0.5s ease, visibility 0.5s; + -webkit-overflow-scrolling: touch; + background: #ffffff; + border-left: solid 1px rgba(160, 160, 160, 0.3); + box-shadow: none; + height: 100%; + max-width: 80%; + overflow-y: auto; + position: fixed; + right: 0; + top: 0; + visibility: hidden; + width: 25em; + z-index: 10002; +} + +#menu > * { + border-top: solid 1px rgba(160, 160, 160, 0.3); + padding: 3em; +} + +#menu > * > :last-child { + margin-bottom: 0; +} + +#menu > :first-child { + border-top: 0; +} + +#menu .links { + list-style: none; + padding: 0; +} + +#menu .links > li { + border: 0; + border-top: dotted 1px rgba(160, 160, 160, 0.3); + margin: 1.5em 0 0 0; + padding: 1.5em 0 0 0; +} + +#menu .links > li a { + display: block; + border-bottom: 0; +} + +#menu .links > li a h3 { + -moz-transition: color 0.2s ease; + -webkit-transition: color 0.2s ease; + -ms-transition: color 0.2s ease; + transition: color 0.2s ease; + font-size: 0.7em; +} + +#menu .links > li a p { + font-family: "Raleway", Helvetica, sans-serif; + font-size: 0.6em; + font-weight: 400; + letter-spacing: 0.25em; + margin-bottom: 0; + text-decoration: none; + text-transform: uppercase; +} + +#menu .links > li a:hover { + text-decoration: none; +} + +#menu .links > li a:hover h3 { + color: #2ebaae; +} + +#menu .links > li:first-child { + border-top: 0; + margin-top: 0; + padding-top: 0; +} + +body.is-menu-visible #menu { + -moz-transform: translateX(0); + -webkit-transform: translateX(0); + -ms-transform: translateX(0); + transform: translateX(0); + visibility: visible; +} + +@media screen and (max-width: 736px) { + + #menu > * { + padding: 1.5em; + } + +} + +.alumni { + border: 1px solid #ccc; + min-height: 4em; + max-height: 4em; + min-width: 15em; + max-width: 15em; + display: inline-block; + margin-right: 1em; + margin-bottom: 1em; + padding: 0.5em; +} + +.alumni img { + width: 2.5em; + float: left; + padding-top: 0.25em; + border-radius: 50%; +} + +.alumni .info { + padding-left: 0.5em; + float: left; + max-width: 11em; +} + +.alumni .title { + margin: 0; + font-size: 0.9em; +} + +.alumni .position { + text-transform: uppercase; + color: #999; + font-size: 0.7em; + line-height: 1.2em; +} + +.bib a { + border-bottom: 0 !important; + margin-right: 0.25em; + text-decoration: none !important; +} + +.collapse.in { + visibility: visible; + display: block; +} + +.bibliography li { + margin-bottom: 0.5em; +} + +.publications { + max-height: 36em; + overflow: auto; +} + +.publication { + border-bottom: 1px solid #ccc; + margin-bottom: 1em; + padding-bottom: 0.5em; +} + +.publication .authors { + font-size: 0.8em; + color: #999; + font-style: italic; +} + +.publication .desc { + font-size: 0.8em; + color: #666; +} + +.project { + border: 1px solid #ccc; + margin-right: 2em; + margin-bottom: 2em; + min-width: 15em; + max-width: 15em; + text-align: center; + padding: 0 !important; + display: block; +} + +.project:hover { + box-shadow: #ccc 3px 3px 3px; +} + +.project .header { + text-align: left; + background: rgba(100, 100, 100, 0.4); + min-height: 6em; + max-height: 6em; +} + +.project .header .funding { + padding: 0.5em; + font-size: 0.8em; + color: #fff; + opacity: 0.8; + line-height: 1.1em; +} + +.project .logo { + min-width: 7.5em; + max-width: 7.5em; + min-height: 7.5em; + max-height: 7.5em; + border-radius: 0.5em; + background-color: #fff; + margin: auto; + margin-top: -4em; + border: 3px solid #fff; + box-shadow: #ccc 2px 2px 2px; +} + +.project .logo img { + width: 7em; + padding: 0.5em; +} + +.project .title { + padding: 1em 1.5em; + line-height: 1.2em; + color: #666; + font-weight: bold; + min-height: 5.5em; +} + +.project .title a { + border-bottom: 0; +} + +.project .title a:hover { + text-decoration: none; +} + +.project .description { + color: #999; + font-size: 0.8em; + padding: 0.5em 1em; + text-align: left; + line-height: 1.2em; + min-height: 9em; +} + +.project .social { + padding: 1em 2em; +} + +.project .social ul { + margin: 0; +} + +.project .social ul li { + display: inline-block; + margin-right: 1em; +} + +.project .social ul li a { + color: #999; + border-bottom: 0; +} + +.past-project { + border-bottom: 1px solid #ccc; + margin-bottom: 1em; + padding-bottom: 0.5em; + min-height: 4em; +} + +.past-project .logo { + position: relative; + float: left; + padding-right: 1em; +} + +.past-project .logo img { + border-radius: 50%; + max-width: 3em; + max-height: 3em; + min-width: 3em; + min-height: 3em; + /*border: 1px solid #ccc;*/ + opacity: 0.8; + box-shadow: #ccc 2px 2px 2px; +} + +.past-project .title { + font-weight: bold; +} + +.past-project .title, .past-project .title a { + border-bottom: 0; + color: #777; +} + +.past-project .content { + font-size: 0.8em; + color: #999; +} + +.featured-project { + padding: 1em; + border: 1px solid #eee; + margin-bottom: 1em; + min-height: 8em; + cursor: pointer; + display: block; +} + +.featured-project:hover { + box-shadow: #ccc 3px 3px 3px; + text-decoration: none !important; +} + +.featured-project .logo { + text-align: center; + background-color: #fff; + border-radius: 0.2em; + max-width: 4em; + max-height: 4em; + min-width: 4em; + min-height: 4em; + box-shadow: #ccc 2px 2px 2px; + padding: 0.25em; + float: left; + margin-right: 1em; + margin-bottom: 0.25em; +} + +.featured-project .logo img { + max-width: 3.5em; + max-height: 3.5em; + min-width: 3.5em; + min-height: 3.5em; +} + +.featured-project .title { + line-height: 1.2em; + font-weight: bold; + color: #888; + font-size: 0.9em +} + +.featured-project .title a { + border-bottom: 0; + color: #888; +} + +.featured-project .description { + padding-top: 0.5em; + font-size: 0.8em; + color: #999; + line-height: 1.2em; +} + +.projects { + display: grid; + grid-template-columns: repeat(3, 1fr); + grid-gap: 1em; +} + +@media screen and (max-width: 900px) { + .projects, .news { + grid-template-columns: repeat(1, 1fr); + } +} + +@media screen and (max-width: 1600px) { + .projects { + grid-template-columns: repeat(2, 1fr); + } +} + +.projects a:hover, .news a:hover, .software:hover { + box-shadow: #ccc 2px 2px 2px; + text-decoration: none; +} + +.projects img { + max-height: 10em; +} + +.projects .card-text { + color: #666; + line-height: 1.3em; + font-size: 0.8em; +} + +.software { + border: 1px solid #ccc; + overflow: auto; + margin-bottom: 1em; +} + +.software .content { + position: relative; + padding: 1em; +} + +.software .logo { + position: relative; + float: left; + max-width: 6.5em; + min-width: 6.5em; + margin-left: 1em; + margin-top: 1em; +} + +.software .logo img { + max-width: 6em; +} + +.software .title { + font-weight: bold; +} + +.software .description { + display: block; + font-size: 0.9em; + line-height: 1.3em; + color: #666; +} + +.software .footer { + background-color: #f7f7f7; + padding: 1em; +} + +.software .label { + border-radius: 0.5em; + border: 2px solid #333; + padding-left: 0.25em; + background-color: #333; + cursor: pointer; + font-size: 0.8em; + text-decoration: none; +} + +.software .icon { + color: #fff; +} + +.software .text { + /*background-color: #fff;*/ + color: #fff; + font-weight: bold; + padding-left: 0.25em; + padding-right: 0.5em; + border-bottom-right-radius: 0.5em; + border-top-right-radius: 0.5em; +} + +.areas { + float: left; + font-size: 1.75em; + padding-right: 0.4em; + padding-bottom: 0.5em; +} + +.leader { + float: right; +} + +.leader img { + max-width: 1.5em; + border-radius: 50%; + margin-top: 0.3em; +} + +.leader .title { + float: right; + font-size: 0.8em; + margin-left: 0.5em; + font-weight: normal; + line-height: 1.2em; + padding: 0 !important; + text-align: left !important; +} + +.leader .title i { + font-size: 0.8em; +} + +.meta .leader img { + max-width: 4em !important; +} + +.meta .leader, .meta .title { + float: left !important; + text-align: center !important; +} + +.meta .leader .title { + text-align: center !important; +} + +.research-area { + border: 1px solid #ccc; + margin-bottom: 1em; + display: block; + cursor: pointer; +} + +.research-area:hover { + text-decoration: none; + box-shadow: #ccc 3px 3px 3px; +} + +.research-area .header { + padding: 1em; + font-weight: bold; + border-top: 5px solid #0b2e13; +} + +.research-area .description { + padding: 1em; + font-size: 0.9em; + line-height: 1.3em; +} + +.research-area .footer { + padding: 0.5em 1em; + background-color: #f7f7f7; + overflow: auto; +} + +.mini-menu { + display: -moz-flex; + display: -webkit-flex; + display: -ms-flex; + display: flex; + -moz-flex-direction: column-reverse; + -webkit-flex-direction: column-reverse; + -ms-flex-direction: column-reverse; + flex-direction: column-reverse; + background: #ffffff; + border: solid 1px rgba(160, 160, 160, 0.3); + padding: 1em; + margin: 0 0 2em 0; +} + +.mini-menu ul { + margin: 0; + padding: 0; +} + +.mini-menu ul li { + display: block; + list-style: none; + padding: 0.5em 0 0.5em 1em; + margin: 0; + border-bottom: 1px solid #eee; +} + +.mini-menu ul li:hover { + background-color: #f7f7f7; +} + +/* li:nth-child(n+1):nth-last-child(-n+1) { + border: none; +} */ + +.mini-menu ul li img, .dropdown-menu img { + max-width: 0.85em; + margin-right: 0.5em; +} + +.mini-menu ul li a { + text-decoration: none; + border-bottom: 0; +} + +.dropdown-menu { + top: 1em; +} + +.dropdown-item { + padding: 1em 1em 1em 2em; + text-transform: none !important; + font-weight: bold; + letter-spacing: 0.2em !important; +} + +.post .title img { + max-height: 4em; + max-width: 4em; + float: left; + margin-right: 1em; +} + +.color-1 { + color: #BED755; +} + +.color-2 { + color: #8CCA60; +} + +.color-3 { + color: #4CA171; +} + +.color-4 { + color: #4DABAC; +} + +.color-5 { + color: #4CA8A9; +} + +.color-6 { + color: #ED8D34; +} + +.color-7 { + color: #EA4727; +} + +.color-8 { + color: #FAAB03; +} + +.institution { + text-align: center; +} + +.institution img, .institution a { + max-height: 3em !important; + border-bottom: 0 !important; + margin-bottom: 1.5em; +} + +.post, .mini-post { + border: 0; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); + border-radius: 10px; +} + +.post > header .meta .date { + font-size: 0.9em; + letter-spacing: normal; + margin: 0; +} + +.post > header .meta .time { + font-size: 0.8em; + line-height: 1.2em !important; + text-transform: none; + letter-spacing: normal; + color: #999; + margin: 0; +} + +.post img { + max-width: 100%; +} + +.post > .message { + padding: 1em; + border: 1px solid #ccc; + border-radius: 0.5em; + line-height: 1.5em; + margin-top: 1em; + margin-bottom: 1.5em; + box-shadow: #ccc 3px 3px 3px; + background-color: #fafafa; +} + +.agenda { + font-size: 0.9em; + margin: 0; + line-height: 1.2em; +} + +.mini-box { + border: 0px solid #ccc; + border-radius: 10px; + background-color: #fff; + overflow: auto; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); + padding: 1em; +} + +.event, .framework, .group, .system, .job-item { + margin-bottom: 0.5em; + display: block; + text-decoration: none; + border-bottom: 0; + box-shadow: #ccc 0px 3px 3px -3px; + padding: 1em 0.5em; +} + +.event:hover, .framework:hover, .group:hover, .system:hover, .job-item:hover { + text-decoration: none; + background-color: #fafafa; + box-shadow: #ccc 3px 3px 3px; + border-radius: 0.5em; +} + +.event-date { + float: left; + flex: 1; + min-width: 6em; + max-width: 6em; + text-align: center; + line-height: 1.2em; + text-transform: uppercase; + padding-top: 0.2em; +} + +.event-date > .header { + font-size: 1.1em; + font-weight: 600; + color: #888; +} + +.event-date > .subheader { + font-size: 0.9em; + color: #999; +} + +.event-content { + position: relative; + line-height: 1.2em; +} + +.event-content > .time { + font-size: 0.9em; + color: #999; +} + +.event-content strong { + font-size: 1.1em; +} + +.events { + min-height: 30em; + max-height: 30em; +} + +.jobs { + min-height: 30em; + max-height: 30em; +} + +.framework, .system, .event { + padding: 1em 1em; + display: flex; +} + +.framework a { + border-bottom: 0; +} + +.framework a:hover { + text-decoration: none; + border-bottom: 0; +} + +.framework-icon { + flex: 1; + max-width: 3em; + max-height: 3em; + margin-top: 0.5em; + margin-right: 1em; +} + +.framework-content { + flex: 1; +} + +.framework-content > .description { + font-size: 0.9em; + color: #999; + line-height: 1.2em; + margin: 0; +} + +.badges > .badge { + border-radius: 1em; + border: 1px solid #999 !important; + background-color: #fff; + padding: 0.25em 0.75em; + font-size: 0.8em; + color: #555; + margin-right: 0.5em; + font-weight: normal; +} + +.badges > .badge:hover { + background-color: #555; + color: #fff !important; +} + +.gitlab:hover { + background-color: rgb(204, 110, 3) !important; + border: 1px solid rgb(204, 110, 3) !important; +} + +.documentation:hover { + background-color: #4EABAB !important; + border: 1px solid #4EABAB !important; +} + +.tags > .tag { + font-size: 0.7em; + border-radius: 1em; + padding: 0.25em 0.75em; + background-color: #EC8B34; + color: #fff; +} + +.amember { + border-top: 2px solid #999; + filter: grayscale(100%); + padding: 0; + margin-right: 3em; + margin-bottom: 3em; + max-width: 10em; +} + +.amember:hover { + filter: grayscale(0%); + color: #000; +} + +.amember>.header>.name { + font-size: 1em; + line-height: 1.2em; + margin: 0; + padding-top: 0.25em; + font-weight: 500; + color: #000 +} + +.amember>.header>.role { + font-size: 0.8em; + line-height: 1em; + margin: 0; + padding-bottom: 0.5em; + color: #666; + min-height: 2.5em; +} + +.amember a { + border-bottom: 0; +} + +.amember>.header>a img { + border-radius: 0.5em; + max-width: 10em; + min-width: 10em; +} + +.amember>.content { + line-height: 1.2em; + font-size: 0.9em; +} + +.amember>.content>a { + border-bottom: 0; +} + +.amember>.content>a>img { + max-height: 2em; +} + +.deadlines { + font-size: 0.8em; + color: #999; +} + +.deadlines strong { + font-size: 1em; + color: #777; +} + +.location { + color: #DB5C5F; +} + +.group-members { + columns: 3; + -webkit-columns: 3; + -moz-columns: 3; + list-style: none; +} + +.label { + border-radius: 1em; + background-color: #4CA8A9; + color: #fff; + padding: 0.5em 1em; + font-size: 0.8em; + text-transform: none; +} + +.label:hover { + text-decoration: none; + color: #fff !important; + font-weight: bold !important; +} + +.status { + font-size: 0.8em; + border-radius: 1em; + padding: 0.5em 1em; + border: 1px solid #ccc; +} + +.group-members li { + margin-right: 2em; +} + +.group-members>li>strong { + font-size: 0.8em; + color: #999; + font-variant: small-caps; +} + +.twitter-header { + font-size: 0.9em; + font-weight: bold; + text-align: center; + padding: 0.5em 0; +} + +#twitter-widget-0 { + border-radius: 10px; +} + +.contributors { + max-width: 75%; + min-width: 75%; +} + +.contributors a { + border-bottom: 0 !important; +} + +.contributors img { + border-radius: 0.5em; + margin-right: 0.5em; +} + +.system-avatar { + flex: 1; + min-width: 3em; + max-width: 3em; + max-height: 3em; + margin-top: 0.5em; + margin-right: 1em; +} + +.system-content { + line-height: 1.2em; +} + +.system-subtitle { + line-height: 1.5em; + letter-spacing: 0.1em; +} + +.system-subtitle a { + font-size: 0.9em; + text-transform: none; +} + +.system-info { + border: 1px solid #ddd; + border-radius: 0.5em; + margin-bottom: 2em; +} + +.system-info h1 { + text-align: center; + text-transform: uppercase; + letter-spacing: 0.2em; + color: #aaa; + font-weight: 400; + font-size: 0.9em; +} + +.system-info ul { + list-style: none; + display: flex; + padding: 0; + margin: auto; + flex-flow: wrap; +} + +.system-info li { + padding: 1em; + font-size: 0.9em; + text-align: center; + min-width: 8em; + margin: 0.25em; +} + +.system-info li:hover { + background-color: rgba(150, 150, 150, 0.1); + border-radius: 0.5em; +} + +.system-info i { + font-size: 1.3em; +} + +.system-info a { + border-bottom: 0; + text-decoration: none; + display: block; +} + +.system-info-sub { + margin: 0.5em 1em; +} + +.system-info-sub h2 { + font-size: 0.9em; + font-weight: 400; + text-transform: none; + letter-spacing: 0.1em; + margin-bottom: 0.5em; +} + +.list-tags li { + padding: 0 1em; + min-width: 0; + border: 1px solid #ddd; + border-radius: 0.5em; + font-size: 0.8em; +} + +.meta>.icons li { + padding: 0; +} + +.meta>.icons li>a { + font-size: 1.2em; +} + +.light-gray { + font-size: 0.8em; + color: #999; +} + +.release-button { + margin-top: 1em; + border: 1px solid #4DABAC; + border-radius: 0.5em; + padding: 0.25em 0.5em; + font-family: monospace; + font-size: 0.8em; +} + +.release-button:hover { + background-color: rgba(76, 161, 113, 0.3); + border: 1px solid #4DABAC; + text-decoration: none; +} + +main p { + margin-bottom: 1em; +} + +main h1 { + font-size: 1.2em; +} + +main h2 { + font-size: 1.1em; + letter-spacing: 0.15em; +} + +main h3 { + font-size: 1em; + letter-spacing: 0.1em; +} + +main a { + color:rgb(204, 110, 3) +} + +.top-button { + position: absolute; + z-index: 100; + top: 0; + left: 0; + width: 100%; + /* margin-right: 1.1em; */ + background-color: #4CA8A9; + color: #fff; + padding: 0.5em 1em; + /* font-size: 0.9em; */ + border-top-right-radius: 0.5em; + border-top-left-radius: 0.5em; +} + +.bottom-button { + position: absolute; + z-index: 100; + top: 0; + right: 0; + /* width: 100%; */ + /* margin-right: 1.1em; */ + background-color: #7CCBD0; + border: 0; + color: #fff; + padding: 0.1em 1em; + font-size: 0.8em; + border-top-right-radius: 0.5em; + border-bottom-left-radius: 0.5em; + text-align: center; +} + +.corner-button { + position: absolute; + z-index: 100; + top: 0; + right: 0; + background-color: #ED8D34; + color: #fff !important; + padding: 0.1em 1em; + font-size: 0.9em; + border-top-right-radius: 0.5em; + border-bottom-left-radius: 0.5em; + text-align: center; +} + +.corner-button:hover { + font-weight: 550 !important; +} + +.bottom-button:hover, .corner-button:hover { + color: #fff !important; + text-decoration: none; +} + +.systems { + overflow-x: auto; + margin: 2.5em -1em -3em -1em; + min-height: 10em; +} + +.systems-list { + padding-top: 1em; + display: flex; +} + +.jobs { + display: flex; + flex-direction: row; + flex-wrap: wrap; + max-width: 100%; +} + +.job { + display: block; + padding: 1em; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); + min-height: 16em; + max-height: 16em; + min-width: 17em; + max-width: 17em; + border-bottom: 0; + margin: 10px; + border-radius: 0.5em; +} + +.job:hover { + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.1), 0px 0px 2px rgba(0, 0, 0, 0.1), 0px 0px 1px rgba(0, 0, 0, 0.1); + text-decoration: none; +} + +.job .title { + font-weight: 510; + min-height: 6.5em; + line-height: 1.3em; +} + +.job .title p { + font-size: 0.8em; + font-weight: normal; + color: #999; +} + +.job .description { + border-top: 1px solid #eee; + color: #999; + font-size: 0.8em; +} + +.apply, .apply:hover { + background-color: #0A66C3; + color: #fff !important; + border-radius: 0.5em; + padding: 0.5em 1.5em; + border: 0; + text-decoration: none; +} + +.job-panel { + margin-left: 1em; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); + padding: 1em; + border-radius: 0.5em; + line-height: 1.2em; +} + +.job-item { + display: flex; + min-width: 100%; + line-height: 1.3em; +} + +.job-item img { + max-height: 2em; + max-width: 4em; +} + +.member { + line-height: 1em; + margin: 0; +} + +.member:hover { + text-decoration: none; +} + +.member-contents { + padding: 1em; +} + +.member-contents:hover, .ostats .nmembers:hover, .ostats .nsystems:hover, .ostats .nframeworks:hover, .ostats .nwg:hover { + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); + border-radius: 0.5em; +} + +.ostats { + display: flex; + margin-bottom: 1em; + flex-wrap: wrap; +} + +.ostats .nmembers, .ostats .nsystems, .ostats .nframeworks, .ostats .nwg { + flex: 1; + display: block; + min-width: 7em; + padding: 1em; + text-align: center; + line-height: 1.2em; + border-bottom: 0; + text-decoration: none; + cursor: pointer; +} + +.ostats .nmembers strong, .ostats .nsystems strong, .ostats .nframeworks strong, .ostats .nwg strong { + font-size: 1.75em; + color: #8CCA60; +} + +.ostats .nsystems strong { + color: #ED8D34; +} + +.ostats .nframeworks strong { + color: #FAAB03; +} + +.ostats .nwg strong { + color: #4CA8A9; +} + +.btn-primary { + background-color: steelblue; + font-size: 0.8em; + border: 0; +} + +.btn-primary:hover { + text-decoration: none; + color: #fff !important; +} + +.sub { + padding: 2em 3em 1em 3em !important; +} + +.contact-buttons { + display: flex; + flex-wrap: wrap; +} + +.contact-button { + border: 1px solid #ccc; + border-radius: 0.5em; + display: flex; + min-width: 0; + margin-right: 1em; + margin-bottom: 1em; +} + +.contact-button:hover { + text-decoration: none; + border: 1px solid #ccc; + font-weight: bold; +} + +.contact-button>.icon { + padding: 0.1em 1em; + background-color: #eee; + color: #666 !important; + border-top-left-radius: 0.5em; + border-bottom-left-radius: 0.5em; +} + +.contact-button>.content { + padding: 0.1em 1em; + color: #999; +} + +.story-date { + text-align: center; + line-height: 1.5em; +} + +.story-date .month-day { + font-size: 1.75em; +} + +.story-date .year { + color: #999; + font-size: 1.3em; +} + +.story-author { + text-align: left; + line-height: 1em; + margin-bottom: 2em; + padding-left: 0em; + float: left; +} + +.story-author img { + float: left; + margin-right: 1em; + margin-top: 0em; + max-height: 2em; + max-width: 2em; + border-radius: 50%; +} + +.story-author .institution { + color: #999; + font-style: italic; + font-size: 0.8em; +} + +.story-content img { + border-radius: 0.5em; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); +} + +.story-content .caption { + line-height: 1em; + color: #999; + font-size: 0.8em; + font-style: italic; +} + +.story-main { + min-height: 10em; +} + +.story-main .top-button { + background-color: #e7717d !important; background-attachment: fixed; +} + +.story-main .bottom-button { + background-color: #c0545f !important; +} + +.story-main h1 { + font-variant: normal; + text-transform: none; + line-height: 1.3em; + letter-spacing: 0.1em; +} + +.story-excerpt { + line-height: 1.2em; + color: #999; + margin-bottom: 1em; +} + +.story-main .author { + color: #999; + /* text-align: right; */ + font-size: 0.5em; + overflow-wrap: break-word; + justify-content: left; +} + +.story-image { + /* position: absolute; */ + margin-top: 2em; + /* left: 0; */ + width: 100%; + display: block; +} + +.story-image img, .story-image-thumb img { + height: 12em; + width: 100%; + object-fit: cover; + margin: 0; +} + +.story-image-thumb { + padding-right: 0.5em; +} + +.story-image-thumb img { + height: 3.5em; + width: 10em; + margin: 0; + border-radius: 0.25em; +} + +.see-all-button { + text-align: center; + color: steelblue; + border: 1px solid steelblue; + padding: 0.5em; + border-radius: 0.5em; + font-size: 0.8em; + font-weight: bold; +} + +.search-container i { + position: absolute; + padding: 1em; +} + +.search-container { + width: 100%; + margin-bottom: 10px; + text-align: left; +} + +.icon { + padding: 10px; + min-width: 40px; +} + +.input-field { + width: 100%; + padding-left: 2.5em !important; + text-align: left; + border-radius: 1em !important; +} + +#results-container { + border-radius: 0.5em; + box-shadow: 0px 4px 8px rgba(0, 0, 0, 0.04), 0px 0px 2px rgba(0, 0, 0, 0.06), 0px 0px 1px rgba(0, 0, 0, 0.04); +} + +#results-container a { + display: block; + padding: 0.5em 1em; + font-size: 0.9em; +} + +#results-container a:hover { + background-color: #fff; + text-decoration: none; + border-radius: 0.5em; +} + +.search-desc { + font-size: 0.9em; + font-style: italic; +} + +.search-cat { + float: right; + top: 0; + right: 0; + z-index: 1000; + font-size: 0.7em; + color: #fff; + padding: 0.1em 1em; + border-radius: 0.5em; +} + +.dark { + width: 12em !important; + min-width: 0 !important; + color: #fff !important; + padding: 3em 1em !important; +} \ No newline at end of file diff --git a/assets/css/open-iconic-bootstrap.min.css b/assets/css/open-iconic-bootstrap.min.css new file mode 100755 index 0000000000..6acaa870ce --- /dev/null +++ b/assets/css/open-iconic-bootstrap.min.css @@ -0,0 +1 @@ +@font-face{font-family:Icons;src:url(../fonts/open-iconic/open-iconic.eot);src:url(../fonts/open-iconic/open-iconic.eot?#iconic-sm) format('embedded-opentype'),url(../fonts/open-iconic/open-iconic.woff) format('woff'),url(../fonts/open-iconic/open-iconic.ttf) format('truetype'),url(../fonts/open-iconic/open-iconic.otf) format('opentype'),url(../fonts/open-iconic/open-iconic.svg#iconic-sm) format('svg');font-weight:400;font-style:normal}.oi{position:relative;top:1px;display:inline-block;speak:none;font-family:Icons;font-style:normal;font-weight:400;line-height:1;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale}.oi:empty:before{width:1em;text-align:center;box-sizing:content-box}.oi.oi-align-center:before{text-align:center}.oi.oi-align-left:before{text-align:left}.oi.oi-align-right:before{text-align:right}.oi.oi-flip-horizontal:before{-webkit-transform:scale(-1,1);-ms-transform:scale(-1,1);transform:scale(-1,1)}.oi.oi-flip-vertical:before{-webkit-transform:scale(1,-1);-ms-transform:scale(-1,1);transform:scale(1,-1)}.oi.oi-flip-horizontal-vertical:before{-webkit-transform:scale(-1,-1);-ms-transform:scale(-1,1);transform:scale(-1,-1)}.oi-account-login:before{content:'\e000'}.oi-account-logout:before{content:'\e001'}.oi-action-redo:before{content:'\e002'}.oi-action-undo:before{content:'\e003'}.oi-align-center:before{content:'\e004'}.oi-align-left:before{content:'\e005'}.oi-align-right:before{content:'\e006'}.oi-aperture:before{content:'\e007'}.oi-arrow-bottom:before{content:'\e008'}.oi-arrow-circle-bottom:before{content:'\e009'}.oi-arrow-circle-left:before{content:'\e00a'}.oi-arrow-circle-right:before{content:'\e00b'}.oi-arrow-circle-top:before{content:'\e00c'}.oi-arrow-left:before{content:'\e00d'}.oi-arrow-right:before{content:'\e00e'}.oi-arrow-thick-bottom:before{content:'\e00f'}.oi-arrow-thick-left:before{content:'\e010'}.oi-arrow-thick-right:before{content:'\e011'}.oi-arrow-thick-top:before{content:'\e012'}.oi-arrow-top:before{content:'\e013'}.oi-audio-spectrum:before{content:'\e014'}.oi-audio:before{content:'\e015'}.oi-badge:before{content:'\e016'}.oi-ban:before{content:'\e017'}.oi-bar-chart:before{content:'\e018'}.oi-basket:before{content:'\e019'}.oi-battery-empty:before{content:'\e01a'}.oi-battery-full:before{content:'\e01b'}.oi-beaker:before{content:'\e01c'}.oi-bell:before{content:'\e01d'}.oi-bluetooth:before{content:'\e01e'}.oi-bold:before{content:'\e01f'}.oi-bolt:before{content:'\e020'}.oi-book:before{content:'\e021'}.oi-bookmark:before{content:'\e022'}.oi-box:before{content:'\e023'}.oi-briefcase:before{content:'\e024'}.oi-british-pound:before{content:'\e025'}.oi-browser:before{content:'\e026'}.oi-brush:before{content:'\e027'}.oi-bug:before{content:'\e028'}.oi-bullhorn:before{content:'\e029'}.oi-calculator:before{content:'\e02a'}.oi-calendar:before{content:'\e02b'}.oi-camera-slr:before{content:'\e02c'}.oi-caret-bottom:before{content:'\e02d'}.oi-caret-left:before{content:'\e02e'}.oi-caret-right:before{content:'\e02f'}.oi-caret-top:before{content:'\e030'}.oi-cart:before{content:'\e031'}.oi-chat:before{content:'\e032'}.oi-check:before{content:'\e033'}.oi-chevron-bottom:before{content:'\e034'}.oi-chevron-left:before{content:'\e035'}.oi-chevron-right:before{content:'\e036'}.oi-chevron-top:before{content:'\e037'}.oi-circle-check:before{content:'\e038'}.oi-circle-x:before{content:'\e039'}.oi-clipboard:before{content:'\e03a'}.oi-clock:before{content:'\e03b'}.oi-cloud-download:before{content:'\e03c'}.oi-cloud-upload:before{content:'\e03d'}.oi-cloud:before{content:'\e03e'}.oi-cloudy:before{content:'\e03f'}.oi-code:before{content:'\e040'}.oi-cog:before{content:'\e041'}.oi-collapse-down:before{content:'\e042'}.oi-collapse-left:before{content:'\e043'}.oi-collapse-right:before{content:'\e044'}.oi-collapse-up:before{content:'\e045'}.oi-command:before{content:'\e046'}.oi-comment-square:before{content:'\e047'}.oi-compass:before{content:'\e048'}.oi-contrast:before{content:'\e049'}.oi-copywriting:before{content:'\e04a'}.oi-credit-card:before{content:'\e04b'}.oi-crop:before{content:'\e04c'}.oi-dashboard:before{content:'\e04d'}.oi-data-transfer-download:before{content:'\e04e'}.oi-data-transfer-upload:before{content:'\e04f'}.oi-delete:before{content:'\e050'}.oi-dial:before{content:'\e051'}.oi-document:before{content:'\e052'}.oi-dollar:before{content:'\e053'}.oi-double-quote-sans-left:before{content:'\e054'}.oi-double-quote-sans-right:before{content:'\e055'}.oi-double-quote-serif-left:before{content:'\e056'}.oi-double-quote-serif-right:before{content:'\e057'}.oi-droplet:before{content:'\e058'}.oi-eject:before{content:'\e059'}.oi-elevator:before{content:'\e05a'}.oi-ellipses:before{content:'\e05b'}.oi-envelope-closed:before{content:'\e05c'}.oi-envelope-open:before{content:'\e05d'}.oi-euro:before{content:'\e05e'}.oi-excerpt:before{content:'\e05f'}.oi-expand-down:before{content:'\e060'}.oi-expand-left:before{content:'\e061'}.oi-expand-right:before{content:'\e062'}.oi-expand-up:before{content:'\e063'}.oi-external-link:before{content:'\e064'}.oi-eye:before{content:'\e065'}.oi-eyedropper:before{content:'\e066'}.oi-file:before{content:'\e067'}.oi-fire:before{content:'\e068'}.oi-flag:before{content:'\e069'}.oi-flash:before{content:'\e06a'}.oi-folder:before{content:'\e06b'}.oi-fork:before{content:'\e06c'}.oi-fullscreen-enter:before{content:'\e06d'}.oi-fullscreen-exit:before{content:'\e06e'}.oi-globe:before{content:'\e06f'}.oi-graph:before{content:'\e070'}.oi-grid-four-up:before{content:'\e071'}.oi-grid-three-up:before{content:'\e072'}.oi-grid-two-up:before{content:'\e073'}.oi-hard-drive:before{content:'\e074'}.oi-header:before{content:'\e075'}.oi-headphones:before{content:'\e076'}.oi-heart:before{content:'\e077'}.oi-home:before{content:'\e078'}.oi-image:before{content:'\e079'}.oi-inbox:before{content:'\e07a'}.oi-infinity:before{content:'\e07b'}.oi-info:before{content:'\e07c'}.oi-italic:before{content:'\e07d'}.oi-justify-center:before{content:'\e07e'}.oi-justify-left:before{content:'\e07f'}.oi-justify-right:before{content:'\e080'}.oi-key:before{content:'\e081'}.oi-laptop:before{content:'\e082'}.oi-layers:before{content:'\e083'}.oi-lightbulb:before{content:'\e084'}.oi-link-broken:before{content:'\e085'}.oi-link-intact:before{content:'\e086'}.oi-list-rich:before{content:'\e087'}.oi-list:before{content:'\e088'}.oi-location:before{content:'\e089'}.oi-lock-locked:before{content:'\e08a'}.oi-lock-unlocked:before{content:'\e08b'}.oi-loop-circular:before{content:'\e08c'}.oi-loop-square:before{content:'\e08d'}.oi-loop:before{content:'\e08e'}.oi-magnifying-glass:before{content:'\e08f'}.oi-map-marker:before{content:'\e090'}.oi-map:before{content:'\e091'}.oi-media-pause:before{content:'\e092'}.oi-media-play:before{content:'\e093'}.oi-media-record:before{content:'\e094'}.oi-media-skip-backward:before{content:'\e095'}.oi-media-skip-forward:before{content:'\e096'}.oi-media-step-backward:before{content:'\e097'}.oi-media-step-forward:before{content:'\e098'}.oi-media-stop:before{content:'\e099'}.oi-medical-cross:before{content:'\e09a'}.oi-menu:before{content:'\e09b'}.oi-microphone:before{content:'\e09c'}.oi-minus:before{content:'\e09d'}.oi-monitor:before{content:'\e09e'}.oi-moon:before{content:'\e09f'}.oi-move:before{content:'\e0a0'}.oi-musical-note:before{content:'\e0a1'}.oi-paperclip:before{content:'\e0a2'}.oi-pencil:before{content:'\e0a3'}.oi-people:before{content:'\e0a4'}.oi-person:before{content:'\e0a5'}.oi-phone:before{content:'\e0a6'}.oi-pie-chart:before{content:'\e0a7'}.oi-pin:before{content:'\e0a8'}.oi-play-circle:before{content:'\e0a9'}.oi-plus:before{content:'\e0aa'}.oi-power-standby:before{content:'\e0ab'}.oi-print:before{content:'\e0ac'}.oi-project:before{content:'\e0ad'}.oi-pulse:before{content:'\e0ae'}.oi-puzzle-piece:before{content:'\e0af'}.oi-question-mark:before{content:'\e0b0'}.oi-rain:before{content:'\e0b1'}.oi-random:before{content:'\e0b2'}.oi-reload:before{content:'\e0b3'}.oi-resize-both:before{content:'\e0b4'}.oi-resize-height:before{content:'\e0b5'}.oi-resize-width:before{content:'\e0b6'}.oi-rss-alt:before{content:'\e0b7'}.oi-rss:before{content:'\e0b8'}.oi-script:before{content:'\e0b9'}.oi-share-boxed:before{content:'\e0ba'}.oi-share:before{content:'\e0bb'}.oi-shield:before{content:'\e0bc'}.oi-signal:before{content:'\e0bd'}.oi-signpost:before{content:'\e0be'}.oi-sort-ascending:before{content:'\e0bf'}.oi-sort-descending:before{content:'\e0c0'}.oi-spreadsheet:before{content:'\e0c1'}.oi-star:before{content:'\e0c2'}.oi-sun:before{content:'\e0c3'}.oi-tablet:before{content:'\e0c4'}.oi-tag:before{content:'\e0c5'}.oi-tags:before{content:'\e0c6'}.oi-target:before{content:'\e0c7'}.oi-task:before{content:'\e0c8'}.oi-terminal:before{content:'\e0c9'}.oi-text:before{content:'\e0ca'}.oi-thumb-down:before{content:'\e0cb'}.oi-thumb-up:before{content:'\e0cc'}.oi-timer:before{content:'\e0cd'}.oi-transfer:before{content:'\e0ce'}.oi-trash:before{content:'\e0cf'}.oi-underline:before{content:'\e0d0'}.oi-vertical-align-bottom:before{content:'\e0d1'}.oi-vertical-align-center:before{content:'\e0d2'}.oi-vertical-align-top:before{content:'\e0d3'}.oi-video:before{content:'\e0d4'}.oi-volume-high:before{content:'\e0d5'}.oi-volume-low:before{content:'\e0d6'}.oi-volume-off:before{content:'\e0d7'}.oi-warning:before{content:'\e0d8'}.oi-wifi:before{content:'\e0d9'}.oi-wrench:before{content:'\e0da'}.oi-x:before{content:'\e0db'}.oi-yen:before{content:'\e0dc'}.oi-zoom-in:before{content:'\e0dd'}.oi-zoom-out:before{content:'\e0de'} \ No newline at end of file diff --git a/assets/css/owl.carousel.min.css b/assets/css/owl.carousel.min.css new file mode 100755 index 0000000000..d0f21730ef --- /dev/null +++ b/assets/css/owl.carousel.min.css @@ -0,0 +1,6 @@ +/** + * Owl Carousel v2.3.0 + * Copyright 2013-2017 David Deutsch + * Licensed under () + */ +.owl-carousel,.owl-carousel .owl-item{-webkit-tap-highlight-color:transparent;position:relative}.owl-carousel{display:none;width:100%;z-index:1}.owl-carousel .owl-stage{position:relative;-ms-touch-action:pan-Y;touch-action:manipulation;-moz-backface-visibility:hidden}.owl-carousel .owl-stage:after{content:".";display:block;clear:both;visibility:hidden;line-height:0;height:0}.owl-carousel .owl-stage-outer{position:relative;overflow:hidden;-webkit-transform:translate3d(0,0,0)}.owl-carousel .owl-item,.owl-carousel .owl-wrapper{-webkit-backface-visibility:hidden;-moz-backface-visibility:hidden;-ms-backface-visibility:hidden;-webkit-transform:translate3d(0,0,0);-moz-transform:translate3d(0,0,0);-ms-transform:translate3d(0,0,0)}.owl-carousel .owl-item{min-height:1px;float:left;-webkit-backface-visibility:hidden;-webkit-touch-callout:none}.owl-carousel .owl-item img{display:block;width:100%}.owl-carousel .owl-dots.disabled,.owl-carousel .owl-nav.disabled{display:none}.no-js .owl-carousel,.owl-carousel.owl-loaded{display:block}.owl-carousel .owl-dot,.owl-carousel .owl-nav .owl-next,.owl-carousel .owl-nav .owl-prev{cursor:pointer;cursor:hand;-webkit-user-select:none;-khtml-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none}.owl-carousel .owl-nav button.owl-next,.owl-carousel .owl-nav button.owl-prev,.owl-carousel button.owl-dot{background:0 0;color:inherit;border:none;padding:0!important;font:inherit}.owl-carousel.owl-loading{opacity:0;display:block}.owl-carousel.owl-hidden{opacity:0}.owl-carousel.owl-refresh .owl-item{visibility:hidden}.owl-carousel.owl-drag .owl-item{-ms-touch-action:none;touch-action:none;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none}.owl-carousel.owl-grab{cursor:move;cursor:grab}.owl-carousel.owl-rtl{direction:rtl}.owl-carousel.owl-rtl .owl-item{float:right}.owl-carousel .animated{-webkit-animation-duration:1s;animation-duration:1s;-webkit-animation-fill-mode:both;animation-fill-mode:both}.owl-carousel .owl-animated-in{z-index:0}.owl-carousel .owl-animated-out{z-index:1}.owl-carousel .fadeOut{-webkit-animation-name:fadeOut;animation-name:fadeOut}@-webkit-keyframes fadeOut{0%{opacity:1}100%{opacity:0}}@keyframes fadeOut{0%{opacity:1}100%{opacity:0}}.owl-height{transition:height .5s ease-in-out}.owl-carousel .owl-item .owl-lazy{opacity:0;transition:opacity .4s ease}.owl-carousel .owl-item img.owl-lazy{-webkit-transform-style:preserve-3d;transform-style:preserve-3d}.owl-carousel .owl-video-wrapper{position:relative;height:100%;background:#000}.owl-carousel .owl-video-play-icon{position:absolute;height:80px;width:80px;left:50%;top:50%;margin-left:-40px;margin-top:-40px;background:url(owl.video.play.png) no-repeat;cursor:pointer;z-index:1;-webkit-backface-visibility:hidden;transition:-webkit-transform .1s ease;transition:transform .1s ease}.owl-carousel .owl-video-play-icon:hover{-webkit-transform:scale(1.3,1.3);-ms-transform:scale(1.3,1.3);transform:scale(1.3,1.3)}.owl-carousel .owl-video-playing .owl-video-play-icon,.owl-carousel .owl-video-playing .owl-video-tn{display:none}.owl-carousel .owl-video-tn{opacity:0;height:100%;background-position:center center;background-repeat:no-repeat;background-size:contain;transition:opacity .4s ease}.owl-carousel .owl-video-frame{position:relative;z-index:1;height:100%;width:100%} \ No newline at end of file diff --git a/assets/css/owl.theme.default.min.css b/assets/css/owl.theme.default.min.css new file mode 100755 index 0000000000..e15a77e8d4 --- /dev/null +++ b/assets/css/owl.theme.default.min.css @@ -0,0 +1,15 @@ +/** + * Owl Carousel v2.2.1 + * Copyright 2013-2017 David Deutsch + * Licensed under () + */ +.owl-theme .owl-dots, +.owl-theme .owl-nav{text-align:center;-webkit-tap-highlight-color:transparent} +.owl-theme .owl-nav{margin-top:10px} +.owl-theme .owl-nav [class*=owl-]{color:#FFF;font-size:14px;margin:5px;padding:4px 7px;background:#D6D6D6;display:inline-block;cursor:pointer;border-radius:3px;position: absolute;} +.owl-theme .owl-nav [class*=owl-]:hover{background:#869791;color:#FFF;text-decoration:none} +.owl-theme .owl-nav .disabled{opacity:.5;cursor:default} +.owl-theme .owl-nav.disabled+.owl-dots{margin-top:10px} +.owl-theme .owl-dots .owl-dot{display:inline-block;zoom:1} +.owl-theme .owl-dots .owl-dot span{width:10px;height:10px;margin:5px 7px;background:#D6D6D6;display:block;-webkit-backface-visibility:visible;transition:opacity .2s ease;border-radius:30px} +.owl-theme .owl-dots .owl-dot.active span,.owl-theme .owl-dots .owl-dot:hover span{background:#869791} \ No newline at end of file diff --git a/assets/css/style.css b/assets/css/style.css new file mode 100644 index 0000000000..8e5238d3d3 --- /dev/null +++ b/assets/css/style.css @@ -0,0 +1,9011 @@ +/*! + * Bootstrap v4.1.0 (https://getbootstrap.com/) + * Copyright 2011-2018 The Bootstrap Authors + * Copyright 2011-2018 Twitter, Inc. + * Licensed under MIT (https://github.com/twbs/bootstrap/blob/master/LICENSE) + */ +:root { + --bg-color-1: #ee76ad; + --bg-color-2: #efac78; + --blue: #007bff; + --indigo: #6610f2; + --purple: #6f42c1; + --pink: #e83e8c; + --red: #dc3545; + --orange: #fd7e14; + --yellow: #ffc107; + --green: #28a745; + --teal: #20c997; + --cyan: #17a2b8; + --white: #fff; + --gray: #6c757d; + --gray-dark: #343a40; + --primary: #78d5ef; + --secondary: #6c757d; + --success: #28a745; + --info: #17a2b8; + --warning: #ffc107; + --danger: #dc3545; + --light: #f8f9fa; + --dark: #343a40; + --breakpoint-xs: 0; + --breakpoint-sm: 576px; + --breakpoint-md: 768px; + --breakpoint-lg: 992px; + --breakpoint-xl: 1200px; + --font-family-sans-serif: "Work Sans", -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, "Helvetica Neue", Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol"; + --font-family-monospace: SFMono-Regular, Menlo, Monaco, Consolas, "Liberation Mono", "Courier New", monospace; } + +*, +*::before, +*::after { + -webkit-box-sizing: border-box; + box-sizing: border-box; } + +html { + font-family: sans-serif; + line-height: 1.15; + -webkit-text-size-adjust: 100%; + -ms-text-size-adjust: 100%; + -ms-overflow-style: scrollbar; + -webkit-tap-highlight-color: rgba(0, 0, 0, 0); } + +@-ms-viewport { + width: device-width; } + +article, aside, dialog, figcaption, figure, footer, header, hgroup, main, nav, section { + display: block; } + +body { + margin: 0; + font-family: "Work Sans", -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, "Helvetica Neue", Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol"; + font-size: 1rem; + font-weight: 400; + line-height: 1.5; + color: #212529; + text-align: left; + background-color: #fff; } + +[tabindex="-1"]:focus { + outline: 0 !important; } + +hr { + -webkit-box-sizing: content-box; + box-sizing: content-box; + height: 0; + overflow: visible; } + +h1, h2, h3, h4, h5, h6 { + margin-top: 0; + margin-bottom: 0.5rem; } + +p { + margin-top: 0; + margin-bottom: 1rem; } + +abbr[title], +abbr[data-original-title] { + text-decoration: underline; + -webkit-text-decoration: underline dotted; + text-decoration: underline dotted; + cursor: help; + border-bottom: 0; } + +address { + margin-bottom: 1rem; + font-style: normal; + line-height: inherit; } + +ol, +ul, +dl { + margin-top: 0; + margin-bottom: 1rem; } + +ol ol, +ul ul, +ol ul, +ul ol { + margin-bottom: 0; } + +dt { + font-weight: 700; } + +dd { + margin-bottom: .5rem; + margin-left: 0; } + +blockquote { + margin: 0 0 1rem; } + +dfn { + font-style: italic; } + +b, +strong { + font-weight: bolder; } + +small { + font-size: 80%; } + +sub, +sup { + position: relative; + font-size: 75%; + line-height: 0; + vertical-align: baseline; } + +sub { + bottom: -.25em; } + +sup { + top: -.5em; } + +a { + color: var(--bg-color-2); + text-decoration: none; + background-color: transparent; + -webkit-text-decoration-skip: objects; } + a:hover { + color: #34c0e7; + text-decoration: underline; } + +a:not([href]):not([tabindex]) { + color: inherit; + text-decoration: none; } + a:not([href]):not([tabindex]):hover, a:not([href]):not([tabindex]):focus { + color: inherit; + text-decoration: none; } + a:not([href]):not([tabindex]):focus { + outline: 0; } + +pre, +code, +kbd, +samp { + font-family: monospace, monospace; + font-size: 1em; } + +pre { + margin-top: 0; + margin-bottom: 1rem; + overflow: auto; + -ms-overflow-style: scrollbar; } + +figure { + margin: 0 0 1rem; } + +img { + vertical-align: middle; + border-style: none; } + +svg:not(:root) { + overflow: hidden; } + +table { + border-collapse: collapse; } + +caption { + padding-top: 0.75rem; + padding-bottom: 0.75rem; + color: #6c757d; + text-align: left; + caption-side: bottom; } + +th { + text-align: inherit; } + +label { + display: inline-block; + margin-bottom: 0.5rem; } + +button { + border-radius: 0; } + +button:focus { + outline: 1px dotted; + outline: 5px auto -webkit-focus-ring-color; } + +input, +button, +select, +optgroup, +textarea { + margin: 0; + font-family: inherit; + font-size: inherit; + line-height: inherit; } + +button, +input { + overflow: visible; } + +button, +select { + text-transform: none; } + +button, +html [type="button"], +[type="reset"], +[type="submit"] { + -webkit-appearance: button; } + +button::-moz-focus-inner, +[type="button"]::-moz-focus-inner, +[type="reset"]::-moz-focus-inner, +[type="submit"]::-moz-focus-inner { + padding: 0; + border-style: none; } + +input[type="radio"], +input[type="checkbox"] { + -webkit-box-sizing: border-box; + box-sizing: border-box; + padding: 0; } + +input[type="date"], +input[type="time"], +input[type="datetime-local"], +input[type="month"] { + -webkit-appearance: listbox; } + +textarea { + overflow: auto; + resize: vertical; } + +fieldset { + min-width: 0; + padding: 0; + margin: 0; + border: 0; } + +legend { + display: block; + width: 100%; + max-width: 100%; + padding: 0; + margin-bottom: .5rem; + font-size: 1.5rem; + line-height: inherit; + color: inherit; + white-space: normal; } + +progress { + vertical-align: baseline; } + +[type="number"]::-webkit-inner-spin-button, +[type="number"]::-webkit-outer-spin-button { + height: auto; } + +[type="search"] { + outline-offset: -2px; + -webkit-appearance: none; } + +[type="search"]::-webkit-search-cancel-button, +[type="search"]::-webkit-search-decoration { + -webkit-appearance: none; } + +::-webkit-file-upload-button { + font: inherit; + -webkit-appearance: button; } + +output { + display: inline-block; } + +summary { + display: list-item; + cursor: pointer; } + +template { + display: none; } + +[hidden] { + display: none !important; } + +h1, h2, h3, h4, h5, h6, +.h1, .h2, .h3, .h4, .h5, .h6 { + margin-bottom: 0.5rem; + font-family: inherit; + font-weight: 500; + line-height: 1.2; + color: inherit; } + +h1, .h1 { + font-size: 2.5rem; } + +h2, .h2 { + font-size: 2rem; } + +h3, .h3 { + font-size: 1.75rem; } + +h4, .h4 { + font-size: 1.5rem; } + +h5, .h5 { + font-size: 1.25rem; } + +h6, .h6 { + font-size: 1rem; } + +.lead { + font-size: 1.25rem; + font-weight: 300; } + +.display-1 { + font-size: 6rem; + font-weight: 300; + line-height: 1.2; } + +.display-2 { + font-size: 5.5rem; + font-weight: 300; + line-height: 1.2; } + +.display-3 { + font-size: 4.5rem; + font-weight: 300; + line-height: 1.2; } + +.display-4 { + font-size: 3.5rem; + font-weight: 300; + line-height: 1.2; } + +hr { + margin-top: 1rem; + margin-bottom: 1rem; + border: 0; + border-top: 1px solid rgba(0, 0, 0, 0.1); } + +small, +.small { + font-size: 80%; + font-weight: 400; } + +mark, +.mark { + padding: 0.2em; + background-color: #fcf8e3; } + +.list-unstyled { + padding-left: 0; + list-style: none; } + +.list-inline { + padding-left: 0; + list-style: none; } + +.list-inline-item { + display: inline-block; } + .list-inline-item:not(:last-child) { + margin-right: 0.5rem; } + +.initialism { + font-size: 90%; + text-transform: uppercase; } + +.blockquote { + margin-bottom: 1rem; + font-size: 1.25rem; } + +.blockquote-footer { + display: block; + font-size: 80%; + color: #6c757d; } + .blockquote-footer::before { + content: "\2014 \00A0"; } + +.img-fluid { + max-width: 100%; + height: auto; } + +.img-thumbnail { + padding: 0.25rem; + background-color: #fff; + border: 1px solid #dee2e6; + border-radius: 0.25rem; + max-width: 100%; + height: auto; } + +.figure { + display: inline-block; } + +.figure-img { + margin-bottom: 0.5rem; + line-height: 1; } + +.figure-caption { + font-size: 90%; + color: #6c757d; } + +code, +kbd, +pre, +samp { + font-family: SFMono-Regular, Menlo, Monaco, Consolas, "Liberation Mono", "Courier New", monospace; } + +code { + font-size: 87.5%; + color: #e83e8c; + word-break: break-word; } + a > code { + color: inherit; } + +kbd { + padding: 0.2rem 0.4rem; + font-size: 87.5%; + color: #fff; + background-color: #212529; + border-radius: 0.2rem; } + kbd kbd { + padding: 0; + font-size: 100%; + font-weight: 700; } + +pre { + display: block; + font-size: 87.5%; + color: #212529; } + pre code { + font-size: inherit; + color: inherit; + word-break: normal; } + +.pre-scrollable { + max-height: 340px; + overflow-y: scroll; } + +.container { + width: 100%; + padding-right: 15px; + padding-left: 15px; + margin-right: auto; + margin-left: auto; } + @media (min-width: 576px) { + .container { + max-width: 540px; } } + @media (min-width: 768px) { + .container { + max-width: 720px; } } + @media (min-width: 992px) { + .container { + max-width: 960px; } } + @media (min-width: 1200px) { + .container { + max-width: 1140px; } } + +.container-fluid { + width: 100%; + padding-right: 15px; + padding-left: 15px; + margin-right: auto; + margin-left: auto; } + +.row { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + margin-right: -15px; + margin-left: -15px; } + +.no-gutters { + margin-right: 0; + margin-left: 0; } + .no-gutters > .col, + .no-gutters > [class*="col-"] { + padding-right: 0; + padding-left: 0; } + +.col-1, .col-2, .col-3, .col-4, .col-5, .col-6, .col-7, .col-8, .col-9, .col-10, .col-11, .col-12, .col, +.col-auto, .col-sm-1, .col-sm-2, .col-sm-3, .col-sm-4, .col-sm-5, .col-sm-6, .col-sm-7, .col-sm-8, .col-sm-9, .col-sm-10, .col-sm-11, .col-sm-12, .col-sm, +.col-sm-auto, .col-md-1, .col-md-2, .col-md-3, .col-md-4, .col-md-5, .col-md-6, .col-md-7, .col-md-8, .col-md-9, .col-md-10, .col-md-11, .col-md-12, .col-md, +.col-md-auto, .col-lg-1, .col-lg-2, .col-lg-3, .col-lg-4, .col-lg-5, .col-lg-6, .col-lg-7, .col-lg-8, .col-lg-9, .col-lg-10, .col-lg-11, .col-lg-12, .col-lg, +.col-lg-auto, .col-xl-1, .col-xl-2, .col-xl-3, .col-xl-4, .col-xl-5, .col-xl-6, .col-xl-7, .col-xl-8, .col-xl-9, .col-xl-10, .col-xl-11, .col-xl-12, .col-xl, +.col-xl-auto { + position: relative; + width: 100%; + min-height: 1px; + padding-right: 15px; + padding-left: 15px; } + +.col { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + max-width: 100%; } + +.col-auto { + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + width: auto; + max-width: none; } + +.col-1 { + -webkit-box-flex: 0; + -ms-flex: 0 0 8.33333%; + flex: 0 0 8.33333%; + max-width: 8.33333%; } + +.col-2 { + -webkit-box-flex: 0; + -ms-flex: 0 0 16.66667%; + flex: 0 0 16.66667%; + max-width: 16.66667%; } + +.col-3 { + -webkit-box-flex: 0; + -ms-flex: 0 0 25%; + flex: 0 0 25%; + max-width: 25%; } + +.col-4 { + -webkit-box-flex: 0; + -ms-flex: 0 0 33.33333%; + flex: 0 0 33.33333%; + max-width: 33.33333%; } + +.col-5 { + -webkit-box-flex: 0; + -ms-flex: 0 0 41.66667%; + flex: 0 0 41.66667%; + max-width: 41.66667%; } + +.col-6 { + -webkit-box-flex: 0; + -ms-flex: 0 0 50%; + flex: 0 0 50%; + max-width: 50%; } + +.col-7 { + -webkit-box-flex: 0; + -ms-flex: 0 0 58.33333%; + flex: 0 0 58.33333%; + max-width: 58.33333%; } + +.col-8 { + -webkit-box-flex: 0; + -ms-flex: 0 0 66.66667%; + flex: 0 0 66.66667%; + max-width: 66.66667%; } + +.col-9 { + -webkit-box-flex: 0; + -ms-flex: 0 0 75%; + flex: 0 0 75%; + max-width: 75%; } + +.col-10 { + -webkit-box-flex: 0; + -ms-flex: 0 0 83.33333%; + flex: 0 0 83.33333%; + max-width: 83.33333%; } + +.col-11 { + -webkit-box-flex: 0; + -ms-flex: 0 0 91.66667%; + flex: 0 0 91.66667%; + max-width: 91.66667%; } + +.col-12 { + -webkit-box-flex: 0; + -ms-flex: 0 0 100%; + flex: 0 0 100%; + max-width: 100%; } + +.order-first { + -webkit-box-ordinal-group: 0; + -ms-flex-order: -1; + order: -1; } + +.order-last { + -webkit-box-ordinal-group: 14; + -ms-flex-order: 13; + order: 13; } + +.order-0 { + -webkit-box-ordinal-group: 1; + -ms-flex-order: 0; + order: 0; } + +.order-1 { + -webkit-box-ordinal-group: 2; + -ms-flex-order: 1; + order: 1; } + +.order-2 { + -webkit-box-ordinal-group: 3; + -ms-flex-order: 2; + order: 2; } + +.order-3 { + -webkit-box-ordinal-group: 4; + -ms-flex-order: 3; + order: 3; } + +.order-4 { + -webkit-box-ordinal-group: 5; + -ms-flex-order: 4; + order: 4; } + +.order-5 { + -webkit-box-ordinal-group: 6; + -ms-flex-order: 5; + order: 5; } + +.order-6 { + -webkit-box-ordinal-group: 7; + -ms-flex-order: 6; + order: 6; } + +.order-7 { + -webkit-box-ordinal-group: 8; + -ms-flex-order: 7; + order: 7; } + +.order-8 { + -webkit-box-ordinal-group: 9; + -ms-flex-order: 8; + order: 8; } + +.order-9 { + -webkit-box-ordinal-group: 10; + -ms-flex-order: 9; + order: 9; } + +.order-10 { + -webkit-box-ordinal-group: 11; + -ms-flex-order: 10; + order: 10; } + +.order-11 { + -webkit-box-ordinal-group: 12; + -ms-flex-order: 11; + order: 11; } + +.order-12 { + -webkit-box-ordinal-group: 13; + -ms-flex-order: 12; + order: 12; } + +.offset-1 { + margin-left: 8.33333%; } + +.offset-2 { + margin-left: 16.66667%; } + +.offset-3 { + margin-left: 25%; } + +.offset-4 { + margin-left: 33.33333%; } + +.offset-5 { + margin-left: 41.66667%; } + +.offset-6 { + margin-left: 50%; } + +.offset-7 { + margin-left: 58.33333%; } + +.offset-8 { + margin-left: 66.66667%; } + +.offset-9 { + margin-left: 75%; } + +.offset-10 { + margin-left: 83.33333%; } + +.offset-11 { + margin-left: 91.66667%; } + +@media (min-width: 576px) { + .col-sm { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + max-width: 100%; } + .col-sm-auto { + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + width: auto; + max-width: none; } + .col-sm-1 { + -webkit-box-flex: 0; + -ms-flex: 0 0 8.33333%; + flex: 0 0 8.33333%; + max-width: 8.33333%; } + .col-sm-2 { + -webkit-box-flex: 0; + -ms-flex: 0 0 16.66667%; + flex: 0 0 16.66667%; + max-width: 16.66667%; } + .col-sm-3 { + -webkit-box-flex: 0; + -ms-flex: 0 0 25%; + flex: 0 0 25%; + max-width: 25%; } + .col-sm-4 { + -webkit-box-flex: 0; + -ms-flex: 0 0 33.33333%; + flex: 0 0 33.33333%; + max-width: 33.33333%; } + .col-sm-5 { + -webkit-box-flex: 0; + -ms-flex: 0 0 41.66667%; + flex: 0 0 41.66667%; + max-width: 41.66667%; } + .col-sm-6 { + -webkit-box-flex: 0; + -ms-flex: 0 0 50%; + flex: 0 0 50%; + max-width: 50%; } + .col-sm-7 { + -webkit-box-flex: 0; + -ms-flex: 0 0 58.33333%; + flex: 0 0 58.33333%; + max-width: 58.33333%; } + .col-sm-8 { + -webkit-box-flex: 0; + -ms-flex: 0 0 66.66667%; + flex: 0 0 66.66667%; + max-width: 66.66667%; } + .col-sm-9 { + -webkit-box-flex: 0; + -ms-flex: 0 0 75%; + flex: 0 0 75%; + max-width: 75%; } + .col-sm-10 { + -webkit-box-flex: 0; + -ms-flex: 0 0 83.33333%; + flex: 0 0 83.33333%; + max-width: 83.33333%; } + .col-sm-11 { + -webkit-box-flex: 0; + -ms-flex: 0 0 91.66667%; + flex: 0 0 91.66667%; + max-width: 91.66667%; } + .col-sm-12 { + -webkit-box-flex: 0; + -ms-flex: 0 0 100%; + flex: 0 0 100%; + max-width: 100%; } + .order-sm-first { + -webkit-box-ordinal-group: 0; + -ms-flex-order: -1; + order: -1; } + .order-sm-last { + -webkit-box-ordinal-group: 14; + -ms-flex-order: 13; + order: 13; } + .order-sm-0 { + -webkit-box-ordinal-group: 1; + -ms-flex-order: 0; + order: 0; } + .order-sm-1 { + -webkit-box-ordinal-group: 2; + -ms-flex-order: 1; + order: 1; } + .order-sm-2 { + -webkit-box-ordinal-group: 3; + -ms-flex-order: 2; + order: 2; } + .order-sm-3 { + -webkit-box-ordinal-group: 4; + -ms-flex-order: 3; + order: 3; } + .order-sm-4 { + -webkit-box-ordinal-group: 5; + -ms-flex-order: 4; + order: 4; } + .order-sm-5 { + -webkit-box-ordinal-group: 6; + -ms-flex-order: 5; + order: 5; } + .order-sm-6 { + -webkit-box-ordinal-group: 7; + -ms-flex-order: 6; + order: 6; } + .order-sm-7 { + -webkit-box-ordinal-group: 8; + -ms-flex-order: 7; + order: 7; } + .order-sm-8 { + -webkit-box-ordinal-group: 9; + -ms-flex-order: 8; + order: 8; } + .order-sm-9 { + -webkit-box-ordinal-group: 10; + -ms-flex-order: 9; + order: 9; } + .order-sm-10 { + -webkit-box-ordinal-group: 11; + -ms-flex-order: 10; + order: 10; } + .order-sm-11 { + -webkit-box-ordinal-group: 12; + -ms-flex-order: 11; + order: 11; } + .order-sm-12 { + -webkit-box-ordinal-group: 13; + -ms-flex-order: 12; + order: 12; } + .offset-sm-0 { + margin-left: 0; } + .offset-sm-1 { + margin-left: 8.33333%; } + .offset-sm-2 { + margin-left: 16.66667%; } + .offset-sm-3 { + margin-left: 25%; } + .offset-sm-4 { + margin-left: 33.33333%; } + .offset-sm-5 { + margin-left: 41.66667%; } + .offset-sm-6 { + margin-left: 50%; } + .offset-sm-7 { + margin-left: 58.33333%; } + .offset-sm-8 { + margin-left: 66.66667%; } + .offset-sm-9 { + margin-left: 75%; } + .offset-sm-10 { + margin-left: 83.33333%; } + .offset-sm-11 { + margin-left: 91.66667%; } } + +@media (min-width: 768px) { + .col-md { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + max-width: 100%; } + .col-md-auto { + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + width: auto; + max-width: none; } + .col-md-1 { + -webkit-box-flex: 0; + -ms-flex: 0 0 8.33333%; + flex: 0 0 8.33333%; + max-width: 8.33333%; } + .col-md-2 { + -webkit-box-flex: 0; + -ms-flex: 0 0 16.66667%; + flex: 0 0 16.66667%; + max-width: 16.66667%; } + .col-md-3 { + -webkit-box-flex: 0; + -ms-flex: 0 0 25%; + flex: 0 0 25%; + max-width: 25%; } + .col-md-4 { + -webkit-box-flex: 0; + -ms-flex: 0 0 33.33333%; + flex: 0 0 33.33333%; + max-width: 33.33333%; } + .col-md-5 { + -webkit-box-flex: 0; + -ms-flex: 0 0 41.66667%; + flex: 0 0 41.66667%; + max-width: 41.66667%; } + .col-md-6 { + -webkit-box-flex: 0; + -ms-flex: 0 0 50%; + flex: 0 0 50%; + max-width: 50%; } + .col-md-7 { + -webkit-box-flex: 0; + -ms-flex: 0 0 58.33333%; + flex: 0 0 58.33333%; + max-width: 58.33333%; } + .col-md-8 { + -webkit-box-flex: 0; + -ms-flex: 0 0 66.66667%; + flex: 0 0 66.66667%; + max-width: 66.66667%; } + .col-md-9 { + -webkit-box-flex: 0; + -ms-flex: 0 0 75%; + flex: 0 0 75%; + max-width: 75%; } + .col-md-10 { + -webkit-box-flex: 0; + -ms-flex: 0 0 83.33333%; + flex: 0 0 83.33333%; + max-width: 83.33333%; } + .col-md-11 { + -webkit-box-flex: 0; + -ms-flex: 0 0 91.66667%; + flex: 0 0 91.66667%; + max-width: 91.66667%; } + .col-md-12 { + -webkit-box-flex: 0; + -ms-flex: 0 0 100%; + flex: 0 0 100%; + max-width: 100%; } + .order-md-first { + -webkit-box-ordinal-group: 0; + -ms-flex-order: -1; + order: -1; } + .order-md-last { + -webkit-box-ordinal-group: 14; + -ms-flex-order: 13; + order: 13; } + .order-md-0 { + -webkit-box-ordinal-group: 1; + -ms-flex-order: 0; + order: 0; } + .order-md-1 { + -webkit-box-ordinal-group: 2; + -ms-flex-order: 1; + order: 1; } + .order-md-2 { + -webkit-box-ordinal-group: 3; + -ms-flex-order: 2; + order: 2; } + .order-md-3 { + -webkit-box-ordinal-group: 4; + -ms-flex-order: 3; + order: 3; } + .order-md-4 { + -webkit-box-ordinal-group: 5; + -ms-flex-order: 4; + order: 4; } + .order-md-5 { + -webkit-box-ordinal-group: 6; + -ms-flex-order: 5; + order: 5; } + .order-md-6 { + -webkit-box-ordinal-group: 7; + -ms-flex-order: 6; + order: 6; } + .order-md-7 { + -webkit-box-ordinal-group: 8; + -ms-flex-order: 7; + order: 7; } + .order-md-8 { + -webkit-box-ordinal-group: 9; + -ms-flex-order: 8; + order: 8; } + .order-md-9 { + -webkit-box-ordinal-group: 10; + -ms-flex-order: 9; + order: 9; } + .order-md-10 { + -webkit-box-ordinal-group: 11; + -ms-flex-order: 10; + order: 10; } + .order-md-11 { + -webkit-box-ordinal-group: 12; + -ms-flex-order: 11; + order: 11; } + .order-md-12 { + -webkit-box-ordinal-group: 13; + -ms-flex-order: 12; + order: 12; } + .offset-md-0 { + margin-left: 0; } + .offset-md-1 { + margin-left: 8.33333%; } + .offset-md-2 { + margin-left: 16.66667%; } + .offset-md-3 { + margin-left: 25%; } + .offset-md-4 { + margin-left: 33.33333%; } + .offset-md-5 { + margin-left: 41.66667%; } + .offset-md-6 { + margin-left: 50%; } + .offset-md-7 { + margin-left: 58.33333%; } + .offset-md-8 { + margin-left: 66.66667%; } + .offset-md-9 { + margin-left: 75%; } + .offset-md-10 { + margin-left: 83.33333%; } + .offset-md-11 { + margin-left: 91.66667%; } } + +@media (min-width: 992px) { + .col-lg { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + max-width: 100%; } + .col-lg-auto { + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + width: auto; + max-width: none; } + .col-lg-1 { + -webkit-box-flex: 0; + -ms-flex: 0 0 8.33333%; + flex: 0 0 8.33333%; + max-width: 8.33333%; } + .col-lg-2 { + -webkit-box-flex: 0; + -ms-flex: 0 0 16.66667%; + flex: 0 0 16.66667%; + max-width: 16.66667%; } + .col-lg-3 { + -webkit-box-flex: 0; + -ms-flex: 0 0 25%; + flex: 0 0 25%; + max-width: 25%; } + .col-lg-4 { + -webkit-box-flex: 0; + -ms-flex: 0 0 33.33333%; + flex: 0 0 33.33333%; + max-width: 33.33333%; } + .col-lg-5 { + -webkit-box-flex: 0; + -ms-flex: 0 0 41.66667%; + flex: 0 0 41.66667%; + max-width: 41.66667%; } + .col-lg-6 { + -webkit-box-flex: 0; + -ms-flex: 0 0 50%; + flex: 0 0 50%; + max-width: 50%; } + .col-lg-7 { + -webkit-box-flex: 0; + -ms-flex: 0 0 58.33333%; + flex: 0 0 58.33333%; + max-width: 58.33333%; } + .col-lg-8 { + -webkit-box-flex: 0; + -ms-flex: 0 0 66.66667%; + flex: 0 0 66.66667%; + max-width: 66.66667%; } + .col-lg-9 { + -webkit-box-flex: 0; + -ms-flex: 0 0 75%; + flex: 0 0 75%; + max-width: 75%; } + .col-lg-10 { + -webkit-box-flex: 0; + -ms-flex: 0 0 83.33333%; + flex: 0 0 83.33333%; + max-width: 83.33333%; } + .col-lg-11 { + -webkit-box-flex: 0; + -ms-flex: 0 0 91.66667%; + flex: 0 0 91.66667%; + max-width: 91.66667%; } + .col-lg-12 { + -webkit-box-flex: 0; + -ms-flex: 0 0 100%; + flex: 0 0 100%; + max-width: 100%; } + .order-lg-first { + -webkit-box-ordinal-group: 0; + -ms-flex-order: -1; + order: -1; } + .order-lg-last { + -webkit-box-ordinal-group: 14; + -ms-flex-order: 13; + order: 13; } + .order-lg-0 { + -webkit-box-ordinal-group: 1; + -ms-flex-order: 0; + order: 0; } + .order-lg-1 { + -webkit-box-ordinal-group: 2; + -ms-flex-order: 1; + order: 1; } + .order-lg-2 { + -webkit-box-ordinal-group: 3; + -ms-flex-order: 2; + order: 2; } + .order-lg-3 { + -webkit-box-ordinal-group: 4; + -ms-flex-order: 3; + order: 3; } + .order-lg-4 { + -webkit-box-ordinal-group: 5; + -ms-flex-order: 4; + order: 4; } + .order-lg-5 { + -webkit-box-ordinal-group: 6; + -ms-flex-order: 5; + order: 5; } + .order-lg-6 { + -webkit-box-ordinal-group: 7; + -ms-flex-order: 6; + order: 6; } + .order-lg-7 { + -webkit-box-ordinal-group: 8; + -ms-flex-order: 7; + order: 7; } + .order-lg-8 { + -webkit-box-ordinal-group: 9; + -ms-flex-order: 8; + order: 8; } + .order-lg-9 { + -webkit-box-ordinal-group: 10; + -ms-flex-order: 9; + order: 9; } + .order-lg-10 { + -webkit-box-ordinal-group: 11; + -ms-flex-order: 10; + order: 10; } + .order-lg-11 { + -webkit-box-ordinal-group: 12; + -ms-flex-order: 11; + order: 11; } + .order-lg-12 { + -webkit-box-ordinal-group: 13; + -ms-flex-order: 12; + order: 12; } + .offset-lg-0 { + margin-left: 0; } + .offset-lg-1 { + margin-left: 8.33333%; } + .offset-lg-2 { + margin-left: 16.66667%; } + .offset-lg-3 { + margin-left: 25%; } + .offset-lg-4 { + margin-left: 33.33333%; } + .offset-lg-5 { + margin-left: 41.66667%; } + .offset-lg-6 { + margin-left: 50%; } + .offset-lg-7 { + margin-left: 58.33333%; } + .offset-lg-8 { + margin-left: 66.66667%; } + .offset-lg-9 { + margin-left: 75%; } + .offset-lg-10 { + margin-left: 83.33333%; } + .offset-lg-11 { + margin-left: 91.66667%; } } + +@media (min-width: 1200px) { + .col-xl { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + max-width: 100%; } + .col-xl-auto { + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + width: auto; + max-width: none; } + .col-xl-1 { + -webkit-box-flex: 0; + -ms-flex: 0 0 8.33333%; + flex: 0 0 8.33333%; + max-width: 8.33333%; } + .col-xl-2 { + -webkit-box-flex: 0; + -ms-flex: 0 0 16.66667%; + flex: 0 0 16.66667%; + max-width: 16.66667%; } + .col-xl-3 { + -webkit-box-flex: 0; + -ms-flex: 0 0 25%; + flex: 0 0 25%; + max-width: 25%; } + .col-xl-4 { + -webkit-box-flex: 0; + -ms-flex: 0 0 33.33333%; + flex: 0 0 33.33333%; + max-width: 33.33333%; } + .col-xl-5 { + -webkit-box-flex: 0; + -ms-flex: 0 0 41.66667%; + flex: 0 0 41.66667%; + max-width: 41.66667%; } + .col-xl-6 { + -webkit-box-flex: 0; + -ms-flex: 0 0 50%; + flex: 0 0 50%; + max-width: 50%; } + .col-xl-7 { + -webkit-box-flex: 0; + -ms-flex: 0 0 58.33333%; + flex: 0 0 58.33333%; + max-width: 58.33333%; } + .col-xl-8 { + -webkit-box-flex: 0; + -ms-flex: 0 0 66.66667%; + flex: 0 0 66.66667%; + max-width: 66.66667%; } + .col-xl-9 { + -webkit-box-flex: 0; + -ms-flex: 0 0 75%; + flex: 0 0 75%; + max-width: 75%; } + .col-xl-10 { + -webkit-box-flex: 0; + -ms-flex: 0 0 83.33333%; + flex: 0 0 83.33333%; + max-width: 83.33333%; } + .col-xl-11 { + -webkit-box-flex: 0; + -ms-flex: 0 0 91.66667%; + flex: 0 0 91.66667%; + max-width: 91.66667%; } + .col-xl-12 { + -webkit-box-flex: 0; + -ms-flex: 0 0 100%; + flex: 0 0 100%; + max-width: 100%; } + .order-xl-first { + -webkit-box-ordinal-group: 0; + -ms-flex-order: -1; + order: -1; } + .order-xl-last { + -webkit-box-ordinal-group: 14; + -ms-flex-order: 13; + order: 13; } + .order-xl-0 { + -webkit-box-ordinal-group: 1; + -ms-flex-order: 0; + order: 0; } + .order-xl-1 { + -webkit-box-ordinal-group: 2; + -ms-flex-order: 1; + order: 1; } + .order-xl-2 { + -webkit-box-ordinal-group: 3; + -ms-flex-order: 2; + order: 2; } + .order-xl-3 { + -webkit-box-ordinal-group: 4; + -ms-flex-order: 3; + order: 3; } + .order-xl-4 { + -webkit-box-ordinal-group: 5; + -ms-flex-order: 4; + order: 4; } + .order-xl-5 { + -webkit-box-ordinal-group: 6; + -ms-flex-order: 5; + order: 5; } + .order-xl-6 { + -webkit-box-ordinal-group: 7; + -ms-flex-order: 6; + order: 6; } + .order-xl-7 { + -webkit-box-ordinal-group: 8; + -ms-flex-order: 7; + order: 7; } + .order-xl-8 { + -webkit-box-ordinal-group: 9; + -ms-flex-order: 8; + order: 8; } + .order-xl-9 { + -webkit-box-ordinal-group: 10; + -ms-flex-order: 9; + order: 9; } + .order-xl-10 { + -webkit-box-ordinal-group: 11; + -ms-flex-order: 10; + order: 10; } + .order-xl-11 { + -webkit-box-ordinal-group: 12; + -ms-flex-order: 11; + order: 11; } + .order-xl-12 { + -webkit-box-ordinal-group: 13; + -ms-flex-order: 12; + order: 12; } + .offset-xl-0 { + margin-left: 0; } + .offset-xl-1 { + margin-left: 8.33333%; } + .offset-xl-2 { + margin-left: 16.66667%; } + .offset-xl-3 { + margin-left: 25%; } + .offset-xl-4 { + margin-left: 33.33333%; } + .offset-xl-5 { + margin-left: 41.66667%; } + .offset-xl-6 { + margin-left: 50%; } + .offset-xl-7 { + margin-left: 58.33333%; } + .offset-xl-8 { + margin-left: 66.66667%; } + .offset-xl-9 { + margin-left: 75%; } + .offset-xl-10 { + margin-left: 83.33333%; } + .offset-xl-11 { + margin-left: 91.66667%; } } + +.table { + width: 100%; + max-width: 100%; + margin-bottom: 1rem; + background-color: transparent; } + .table th, + .table td { + padding: 0.75rem; + vertical-align: top; + border-top: 1px solid #dee2e6; } + .table thead th { + vertical-align: bottom; + border-bottom: 2px solid #dee2e6; } + .table tbody + tbody { + border-top: 2px solid #dee2e6; } + .table .table { + background-color: #fff; } + +.table-sm th, +.table-sm td { + padding: 0.3rem; } + +.table-bordered { + border: 1px solid #dee2e6; } + .table-bordered th, + .table-bordered td { + border: 1px solid #dee2e6; } + .table-bordered thead th, + .table-bordered thead td { + border-bottom-width: 2px; } + +.table-borderless th, +.table-borderless td, +.table-borderless thead th, +.table-borderless tbody + tbody { + border: 0; } + +.table-striped tbody tr:nth-of-type(odd) { + background-color: rgba(0, 0, 0, 0.05); } + +.table-hover tbody tr:hover { + background-color: rgba(0, 0, 0, 0.075); } + +.table-primary, +.table-primary > th, +.table-primary > td { + background-color: #d9f3fb; } + +.table-hover .table-primary:hover { + background-color: #c2ecf9; } + .table-hover .table-primary:hover > td, + .table-hover .table-primary:hover > th { + background-color: #c2ecf9; } + +.table-secondary, +.table-secondary > th, +.table-secondary > td { + background-color: #d6d8db; } + +.table-hover .table-secondary:hover { + background-color: #c8cbcf; } + .table-hover .table-secondary:hover > td, + .table-hover .table-secondary:hover > th { + background-color: #c8cbcf; } + +.table-success, +.table-success > th, +.table-success > td { + background-color: #c3e6cb; } + +.table-hover .table-success:hover { + background-color: #b1dfbb; } + .table-hover .table-success:hover > td, + .table-hover .table-success:hover > th { + background-color: #b1dfbb; } + +.table-info, +.table-info > th, +.table-info > td { + background-color: #bee5eb; } + +.table-hover .table-info:hover { + background-color: #abdde5; } + .table-hover .table-info:hover > td, + .table-hover .table-info:hover > th { + background-color: #abdde5; } + +.table-warning, +.table-warning > th, +.table-warning > td { + background-color: #ffeeba; } + +.table-hover .table-warning:hover { + background-color: #ffe8a1; } + .table-hover .table-warning:hover > td, + .table-hover .table-warning:hover > th { + background-color: #ffe8a1; } + +.table-danger, +.table-danger > th, +.table-danger > td { + background-color: #f5c6cb; } + +.table-hover .table-danger:hover { + background-color: #f1b0b7; } + .table-hover .table-danger:hover > td, + .table-hover .table-danger:hover > th { + background-color: #f1b0b7; } + +.table-light, +.table-light > th, +.table-light > td { + background-color: #fdfdfe; } + +.table-hover .table-light:hover { + background-color: #ececf6; } + .table-hover .table-light:hover > td, + .table-hover .table-light:hover > th { + background-color: #ececf6; } + +.table-dark, +.table-dark > th, +.table-dark > td { + background-color: #c6c8ca; } + +.table-hover .table-dark:hover { + background-color: #b9bbbe; } + .table-hover .table-dark:hover > td, + .table-hover .table-dark:hover > th { + background-color: #b9bbbe; } + +.table-active, +.table-active > th, +.table-active > td { + background-color: rgba(0, 0, 0, 0.075); } + +.table-hover .table-active:hover { + background-color: rgba(0, 0, 0, 0.075); } + .table-hover .table-active:hover > td, + .table-hover .table-active:hover > th { + background-color: rgba(0, 0, 0, 0.075); } + +.table .thead-dark th { + color: #fff; + background-color: #212529; + border-color: #32383e; } + +.table .thead-light th { + color: #495057; + background-color: #e9ecef; + border-color: #dee2e6; } + +.table-dark { + color: #fff; + background-color: #212529; } + .table-dark th, + .table-dark td, + .table-dark thead th { + border-color: #32383e; } + .table-dark.table-bordered { + border: 0; } + .table-dark.table-striped tbody tr:nth-of-type(odd) { + background-color: rgba(255, 255, 255, 0.05); } + .table-dark.table-hover tbody tr:hover { + background-color: rgba(255, 255, 255, 0.075); } + +@media (max-width: 575.98px) { + .table-responsive-sm { + display: block; + width: 100%; + overflow-x: auto; + -webkit-overflow-scrolling: touch; + -ms-overflow-style: -ms-autohiding-scrollbar; } + .table-responsive-sm > .table-bordered { + border: 0; } } + +@media (max-width: 767.98px) { + .table-responsive-md { + display: block; + width: 100%; + overflow-x: auto; + -webkit-overflow-scrolling: touch; + -ms-overflow-style: -ms-autohiding-scrollbar; } + .table-responsive-md > .table-bordered { + border: 0; } } + +@media (max-width: 991.98px) { + .table-responsive-lg { + display: block; + width: 100%; + overflow-x: auto; + -webkit-overflow-scrolling: touch; + -ms-overflow-style: -ms-autohiding-scrollbar; } + .table-responsive-lg > .table-bordered { + border: 0; } } + +@media (max-width: 1199.98px) { + .table-responsive-xl { + display: block; + width: 100%; + overflow-x: auto; + -webkit-overflow-scrolling: touch; + -ms-overflow-style: -ms-autohiding-scrollbar; } + .table-responsive-xl > .table-bordered { + border: 0; } } + +.table-responsive { + display: block; + width: 100%; + overflow-x: auto; + -webkit-overflow-scrolling: touch; + -ms-overflow-style: -ms-autohiding-scrollbar; } + .table-responsive > .table-bordered { + border: 0; } + +.form-control { + display: block; + width: 100%; + padding: 0.375rem 0.75rem; + font-size: 1rem; + line-height: 1.5; + color: #495057; + background-color: #fff; + background-clip: padding-box; + border: 1px solid #ced4da; + border-radius: 0.25rem; + -webkit-transition: border-color 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; + transition: border-color 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; + -o-transition: border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out; + transition: border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out; + transition: border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; } + @media screen and (prefers-reduced-motion: reduce) { + .form-control { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + .form-control::-ms-expand { + background-color: transparent; + border: 0; } + .form-control:focus { + color: #495057; + background-color: #fff; + border-color: #eaf8fd; + outline: 0; + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .form-control::-webkit-input-placeholder { + color: #6c757d; + opacity: 1; } + .form-control:-ms-input-placeholder { + color: #6c757d; + opacity: 1; } + .form-control::-ms-input-placeholder { + color: #6c757d; + opacity: 1; } + .form-control::placeholder { + color: #6c757d; + opacity: 1; } + .form-control:disabled, .form-control[readonly] { + background-color: #e9ecef; + opacity: 1; } + +select.form-control:not([size]):not([multiple]) { + height: calc(2.25rem + 2px); } + +select.form-control:focus::-ms-value { + color: #495057; + background-color: #fff; } + +.form-control-file, +.form-control-range { + display: block; + width: 100%; } + +.col-form-label { + padding-top: calc(0.375rem + 1px); + padding-bottom: calc(0.375rem + 1px); + margin-bottom: 0; + font-size: inherit; + line-height: 1.5; } + +.col-form-label-lg { + padding-top: calc(0.5rem + 1px); + padding-bottom: calc(0.5rem + 1px); + font-size: 1.25rem; + line-height: 1.5; } + +.col-form-label-sm { + padding-top: calc(0.25rem + 1px); + padding-bottom: calc(0.25rem + 1px); + font-size: 0.875rem; + line-height: 1.5; } + +.form-control-plaintext { + display: block; + width: 100%; + padding-top: 0.375rem; + padding-bottom: 0.375rem; + margin-bottom: 0; + line-height: 1.5; + color: #212529; + background-color: transparent; + border: solid transparent; + border-width: 1px 0; } + .form-control-plaintext.form-control-sm, .input-group-sm > .form-control-plaintext.form-control, + .input-group-sm > .input-group-prepend > .form-control-plaintext.input-group-text, + .input-group-sm > .input-group-append > .form-control-plaintext.input-group-text, + .input-group-sm > .input-group-prepend > .form-control-plaintext.btn, + .input-group-sm > .input-group-append > .form-control-plaintext.btn, .form-control-plaintext.form-control-lg, .input-group-lg > .form-control-plaintext.form-control, + .input-group-lg > .input-group-prepend > .form-control-plaintext.input-group-text, + .input-group-lg > .input-group-append > .form-control-plaintext.input-group-text, + .input-group-lg > .input-group-prepend > .form-control-plaintext.btn, + .input-group-lg > .input-group-append > .form-control-plaintext.btn { + padding-right: 0; + padding-left: 0; } + +.form-control-sm, .input-group-sm > .form-control, +.input-group-sm > .input-group-prepend > .input-group-text, +.input-group-sm > .input-group-append > .input-group-text, +.input-group-sm > .input-group-prepend > .btn, +.input-group-sm > .input-group-append > .btn { + padding: 0.25rem 0.5rem; + font-size: 0.875rem; + line-height: 1.5; + border-radius: 0.2rem; } + +select.form-control-sm:not([size]):not([multiple]), .input-group-sm > select.form-control:not([size]):not([multiple]), +.input-group-sm > .input-group-prepend > select.input-group-text:not([size]):not([multiple]), +.input-group-sm > .input-group-append > select.input-group-text:not([size]):not([multiple]), +.input-group-sm > .input-group-prepend > select.btn:not([size]):not([multiple]), +.input-group-sm > .input-group-append > select.btn:not([size]):not([multiple]) { + height: calc(1.8125rem + 2px); } + +.form-control-lg, .input-group-lg > .form-control, +.input-group-lg > .input-group-prepend > .input-group-text, +.input-group-lg > .input-group-append > .input-group-text, +.input-group-lg > .input-group-prepend > .btn, +.input-group-lg > .input-group-append > .btn { + padding: 0.5rem 1rem; + font-size: 1.25rem; + line-height: 1.5; + border-radius: 0.3rem; } + +select.form-control-lg:not([size]):not([multiple]), .input-group-lg > select.form-control:not([size]):not([multiple]), +.input-group-lg > .input-group-prepend > select.input-group-text:not([size]):not([multiple]), +.input-group-lg > .input-group-append > select.input-group-text:not([size]):not([multiple]), +.input-group-lg > .input-group-prepend > select.btn:not([size]):not([multiple]), +.input-group-lg > .input-group-append > select.btn:not([size]):not([multiple]) { + height: calc(2.875rem + 2px); } + +.form-group { + margin-bottom: 1rem; } + +.form-text { + display: block; + margin-top: 0.25rem; } + +.form-row { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + margin-right: -5px; + margin-left: -5px; } + .form-row > .col, + .form-row > [class*="col-"] { + padding-right: 5px; + padding-left: 5px; } + +.form-check { + position: relative; + display: block; + padding-left: 1.25rem; } + +.form-check-input { + position: absolute; + margin-top: 0.3rem; + margin-left: -1.25rem; } + .form-check-input:disabled ~ .form-check-label { + color: #6c757d; } + +.form-check-label { + margin-bottom: 0; } + +.form-check-inline { + display: -webkit-inline-box; + display: -ms-inline-flexbox; + display: inline-flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + padding-left: 0; + margin-right: 0.75rem; } + .form-check-inline .form-check-input { + position: static; + margin-top: 0; + margin-right: 0.3125rem; + margin-left: 0; } + +.valid-feedback { + display: none; + width: 100%; + margin-top: 0.25rem; + font-size: 80%; + color: #28a745; } + +.valid-tooltip { + position: absolute; + top: 100%; + z-index: 5; + display: none; + max-width: 100%; + padding: .5rem; + margin-top: .1rem; + font-size: .875rem; + line-height: 1; + color: #fff; + background-color: rgba(40, 167, 69, 0.8); + border-radius: .2rem; } + +.was-validated .form-control:valid, .form-control.is-valid, .was-validated +.custom-select:valid, +.custom-select.is-valid { + border-color: #28a745; } + .was-validated .form-control:valid:focus, .form-control.is-valid:focus, .was-validated + .custom-select:valid:focus, + .custom-select.is-valid:focus { + border-color: #28a745; + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.25); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.25); } + .was-validated .form-control:valid ~ .valid-feedback, + .was-validated .form-control:valid ~ .valid-tooltip, .form-control.is-valid ~ .valid-feedback, + .form-control.is-valid ~ .valid-tooltip, .was-validated + .custom-select:valid ~ .valid-feedback, + .was-validated + .custom-select:valid ~ .valid-tooltip, + .custom-select.is-valid ~ .valid-feedback, + .custom-select.is-valid ~ .valid-tooltip { + display: block; } + +.was-validated .form-check-input:valid ~ .form-check-label, .form-check-input.is-valid ~ .form-check-label { + color: #28a745; } + +.was-validated .form-check-input:valid ~ .valid-feedback, +.was-validated .form-check-input:valid ~ .valid-tooltip, .form-check-input.is-valid ~ .valid-feedback, +.form-check-input.is-valid ~ .valid-tooltip { + display: block; } + +.was-validated .custom-control-input:valid ~ .custom-control-label, .custom-control-input.is-valid ~ .custom-control-label { + color: #28a745; } + .was-validated .custom-control-input:valid ~ .custom-control-label::before, .custom-control-input.is-valid ~ .custom-control-label::before { + background-color: #71dd8a; } + +.was-validated .custom-control-input:valid ~ .valid-feedback, +.was-validated .custom-control-input:valid ~ .valid-tooltip, .custom-control-input.is-valid ~ .valid-feedback, +.custom-control-input.is-valid ~ .valid-tooltip { + display: block; } + +.was-validated .custom-control-input:valid:checked ~ .custom-control-label::before, .custom-control-input.is-valid:checked ~ .custom-control-label::before { + background-color: #34ce57; } + +.was-validated .custom-control-input:valid:focus ~ .custom-control-label::before, .custom-control-input.is-valid:focus ~ .custom-control-label::before { + -webkit-box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(40, 167, 69, 0.25); + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(40, 167, 69, 0.25); } + +.was-validated .custom-file-input:valid ~ .custom-file-label, .custom-file-input.is-valid ~ .custom-file-label { + border-color: #28a745; } + .was-validated .custom-file-input:valid ~ .custom-file-label::before, .custom-file-input.is-valid ~ .custom-file-label::before { + border-color: inherit; } + +.was-validated .custom-file-input:valid ~ .valid-feedback, +.was-validated .custom-file-input:valid ~ .valid-tooltip, .custom-file-input.is-valid ~ .valid-feedback, +.custom-file-input.is-valid ~ .valid-tooltip { + display: block; } + +.was-validated .custom-file-input:valid:focus ~ .custom-file-label, .custom-file-input.is-valid:focus ~ .custom-file-label { + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.25); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.25); } + +.invalid-feedback { + display: none; + width: 100%; + margin-top: 0.25rem; + font-size: 80%; + color: #dc3545; } + +.invalid-tooltip { + position: absolute; + top: 100%; + z-index: 5; + display: none; + max-width: 100%; + padding: .5rem; + margin-top: .1rem; + font-size: .875rem; + line-height: 1; + color: #fff; + background-color: rgba(220, 53, 69, 0.8); + border-radius: .2rem; } + +.was-validated .form-control:invalid, .form-control.is-invalid, .was-validated +.custom-select:invalid, +.custom-select.is-invalid { + border-color: #dc3545; } + .was-validated .form-control:invalid:focus, .form-control.is-invalid:focus, .was-validated + .custom-select:invalid:focus, + .custom-select.is-invalid:focus { + border-color: #dc3545; + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.25); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.25); } + .was-validated .form-control:invalid ~ .invalid-feedback, + .was-validated .form-control:invalid ~ .invalid-tooltip, .form-control.is-invalid ~ .invalid-feedback, + .form-control.is-invalid ~ .invalid-tooltip, .was-validated + .custom-select:invalid ~ .invalid-feedback, + .was-validated + .custom-select:invalid ~ .invalid-tooltip, + .custom-select.is-invalid ~ .invalid-feedback, + .custom-select.is-invalid ~ .invalid-tooltip { + display: block; } + +.was-validated .form-check-input:invalid ~ .form-check-label, .form-check-input.is-invalid ~ .form-check-label { + color: #dc3545; } + +.was-validated .form-check-input:invalid ~ .invalid-feedback, +.was-validated .form-check-input:invalid ~ .invalid-tooltip, .form-check-input.is-invalid ~ .invalid-feedback, +.form-check-input.is-invalid ~ .invalid-tooltip { + display: block; } + +.was-validated .custom-control-input:invalid ~ .custom-control-label, .custom-control-input.is-invalid ~ .custom-control-label { + color: #dc3545; } + .was-validated .custom-control-input:invalid ~ .custom-control-label::before, .custom-control-input.is-invalid ~ .custom-control-label::before { + background-color: #efa2a9; } + +.was-validated .custom-control-input:invalid ~ .invalid-feedback, +.was-validated .custom-control-input:invalid ~ .invalid-tooltip, .custom-control-input.is-invalid ~ .invalid-feedback, +.custom-control-input.is-invalid ~ .invalid-tooltip { + display: block; } + +.was-validated .custom-control-input:invalid:checked ~ .custom-control-label::before, .custom-control-input.is-invalid:checked ~ .custom-control-label::before { + background-color: #e4606d; } + +.was-validated .custom-control-input:invalid:focus ~ .custom-control-label::before, .custom-control-input.is-invalid:focus ~ .custom-control-label::before { + -webkit-box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(220, 53, 69, 0.25); + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(220, 53, 69, 0.25); } + +.was-validated .custom-file-input:invalid ~ .custom-file-label, .custom-file-input.is-invalid ~ .custom-file-label { + border-color: #dc3545; } + .was-validated .custom-file-input:invalid ~ .custom-file-label::before, .custom-file-input.is-invalid ~ .custom-file-label::before { + border-color: inherit; } + +.was-validated .custom-file-input:invalid ~ .invalid-feedback, +.was-validated .custom-file-input:invalid ~ .invalid-tooltip, .custom-file-input.is-invalid ~ .invalid-feedback, +.custom-file-input.is-invalid ~ .invalid-tooltip { + display: block; } + +.was-validated .custom-file-input:invalid:focus ~ .custom-file-label, .custom-file-input.is-invalid:focus ~ .custom-file-label { + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.25); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.25); } + +.form-inline { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row wrap; + flex-flow: row wrap; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; } + .form-inline .form-check { + width: 100%; } + @media (min-width: 576px) { + .form-inline label { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; + margin-bottom: 0; } + .form-inline .form-group { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-flex: 0; + -ms-flex: 0 0 auto; + flex: 0 0 auto; + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row wrap; + flex-flow: row wrap; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + margin-bottom: 0; } + .form-inline .form-control { + display: inline-block; + width: auto; + vertical-align: middle; } + .form-inline .form-control-plaintext { + display: inline-block; } + .form-inline .input-group, + .form-inline .custom-select { + width: auto; } + .form-inline .form-check { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; + width: auto; + padding-left: 0; } + .form-inline .form-check-input { + position: relative; + margin-top: 0; + margin-right: 0.25rem; + margin-left: 0; } + .form-inline .custom-control { + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; } + .form-inline .custom-control-label { + margin-bottom: 0; } } + +.btn { + display: inline-block; + font-weight: 400; + text-align: center; + white-space: nowrap; + vertical-align: middle; + -webkit-user-select: none; + -moz-user-select: none; + -ms-user-select: none; + user-select: none; + border: 1px solid transparent; + padding: 0.375rem 0.75rem; + font-size: 1rem; + line-height: 1.5; + border-radius: 0.25rem; + -webkit-transition: color 0.15s ease-in-out, background-color 0.15s ease-in-out, border-color 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; + transition: color 0.15s ease-in-out, background-color 0.15s ease-in-out, border-color 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; + -o-transition: color 0.15s ease-in-out, background-color 0.15s ease-in-out, border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out; + transition: color 0.15s ease-in-out, background-color 0.15s ease-in-out, border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out; + transition: color 0.15s ease-in-out, background-color 0.15s ease-in-out, border-color 0.15s ease-in-out, box-shadow 0.15s ease-in-out, -webkit-box-shadow 0.15s ease-in-out; } + @media screen and (prefers-reduced-motion: reduce) { + .btn { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + .btn:hover, .btn:focus { + text-decoration: none; } + .btn:focus, .btn.focus { + outline: 0; + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .btn.disabled, .btn:disabled { + opacity: 0.65; } + .btn:not(:disabled):not(.disabled) { + cursor: pointer; } + .btn:not(:disabled):not(.disabled):active, .btn:not(:disabled):not(.disabled).active { + background-image: none; } + +a.btn.disabled, +fieldset:disabled a.btn { + pointer-events: none; } + +.btn-primary { + color: #212529; + background-color: #78d5ef; + border-color: #78d5ef; } + .btn-primary:hover { + color: #212529; + background-color: #56caeb; + border-color: #4ac7ea; } + .btn-primary:focus, .btn-primary.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); } + .btn-primary.disabled, .btn-primary:disabled { + color: #212529; + background-color: #78d5ef; + border-color: #78d5ef; } + .btn-primary:not(:disabled):not(.disabled):active, .btn-primary:not(:disabled):not(.disabled).active, + .show > .btn-primary.dropdown-toggle { + color: #212529; + background-color: #4ac7ea; + border-color: #3fc3e8; } + .btn-primary:not(:disabled):not(.disabled):active:focus, .btn-primary:not(:disabled):not(.disabled).active:focus, + .show > .btn-primary.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); } + +.btn-secondary { + color: #fff; + background-color: #6c757d; + border-color: #6c757d; } + .btn-secondary:hover { + color: #fff; + background-color: #5a6268; + border-color: #545b62; } + .btn-secondary:focus, .btn-secondary.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); + box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); } + .btn-secondary.disabled, .btn-secondary:disabled { + color: #fff; + background-color: #6c757d; + border-color: #6c757d; } + .btn-secondary:not(:disabled):not(.disabled):active, .btn-secondary:not(:disabled):not(.disabled).active, + .show > .btn-secondary.dropdown-toggle { + color: #fff; + background-color: #545b62; + border-color: #4e555b; } + .btn-secondary:not(:disabled):not(.disabled):active:focus, .btn-secondary:not(:disabled):not(.disabled).active:focus, + .show > .btn-secondary.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); + box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); } + +.btn-success { + color: #fff; + background-color: #28a745; + border-color: #28a745; } + .btn-success:hover { + color: #fff; + background-color: #218838; + border-color: #1e7e34; } + .btn-success:focus, .btn-success.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); } + .btn-success.disabled, .btn-success:disabled { + color: #fff; + background-color: #28a745; + border-color: #28a745; } + .btn-success:not(:disabled):not(.disabled):active, .btn-success:not(:disabled):not(.disabled).active, + .show > .btn-success.dropdown-toggle { + color: #fff; + background-color: #1e7e34; + border-color: #1c7430; } + .btn-success:not(:disabled):not(.disabled):active:focus, .btn-success:not(:disabled):not(.disabled).active:focus, + .show > .btn-success.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); } + +.btn-info { + color: #fff; + background-color: #17a2b8; + border-color: #17a2b8; } + .btn-info:hover { + color: #fff; + background-color: #138496; + border-color: #117a8b; } + .btn-info:focus, .btn-info.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); + box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); } + .btn-info.disabled, .btn-info:disabled { + color: #fff; + background-color: #17a2b8; + border-color: #17a2b8; } + .btn-info:not(:disabled):not(.disabled):active, .btn-info:not(:disabled):not(.disabled).active, + .show > .btn-info.dropdown-toggle { + color: #fff; + background-color: #117a8b; + border-color: #10707f; } + .btn-info:not(:disabled):not(.disabled):active:focus, .btn-info:not(:disabled):not(.disabled).active:focus, + .show > .btn-info.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); + box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); } + +.btn-warning { + color: #212529; + background-color: #ffc107; + border-color: #ffc107; } + .btn-warning:hover { + color: #212529; + background-color: #e0a800; + border-color: #d39e00; } + .btn-warning:focus, .btn-warning.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); + box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); } + .btn-warning.disabled, .btn-warning:disabled { + color: #212529; + background-color: #ffc107; + border-color: #ffc107; } + .btn-warning:not(:disabled):not(.disabled):active, .btn-warning:not(:disabled):not(.disabled).active, + .show > .btn-warning.dropdown-toggle { + color: #212529; + background-color: #d39e00; + border-color: #c69500; } + .btn-warning:not(:disabled):not(.disabled):active:focus, .btn-warning:not(:disabled):not(.disabled).active:focus, + .show > .btn-warning.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); + box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); } + +.btn-danger { + color: #fff; + background-color: #dc3545; + border-color: #dc3545; } + .btn-danger:hover { + color: #fff; + background-color: #c82333; + border-color: #bd2130; } + .btn-danger:focus, .btn-danger.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); } + .btn-danger.disabled, .btn-danger:disabled { + color: #fff; + background-color: #dc3545; + border-color: #dc3545; } + .btn-danger:not(:disabled):not(.disabled):active, .btn-danger:not(:disabled):not(.disabled).active, + .show > .btn-danger.dropdown-toggle { + color: #fff; + background-color: #bd2130; + border-color: #b21f2d; } + .btn-danger:not(:disabled):not(.disabled):active:focus, .btn-danger:not(:disabled):not(.disabled).active:focus, + .show > .btn-danger.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); } + +.btn-light { + color: #212529; + background-color: #f8f9fa; + border-color: #f8f9fa; } + .btn-light:hover { + color: #212529; + background-color: #e2e6ea; + border-color: #dae0e5; } + .btn-light:focus, .btn-light.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); + box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); } + .btn-light.disabled, .btn-light:disabled { + color: #212529; + background-color: #f8f9fa; + border-color: #f8f9fa; } + .btn-light:not(:disabled):not(.disabled):active, .btn-light:not(:disabled):not(.disabled).active, + .show > .btn-light.dropdown-toggle { + color: #212529; + background-color: #dae0e5; + border-color: #d3d9df; } + .btn-light:not(:disabled):not(.disabled):active:focus, .btn-light:not(:disabled):not(.disabled).active:focus, + .show > .btn-light.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); + box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); } + +.btn-dark { + color: #fff; + background-color: #343a40; + border-color: #343a40; } + .btn-dark:hover { + color: #fff; + background-color: #23272b; + border-color: #1d2124; } + .btn-dark:focus, .btn-dark.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); + box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); } + .btn-dark.disabled, .btn-dark:disabled { + color: #fff; + background-color: #343a40; + border-color: #343a40; } + .btn-dark:not(:disabled):not(.disabled):active, .btn-dark:not(:disabled):not(.disabled).active, + .show > .btn-dark.dropdown-toggle { + color: #fff; + background-color: #1d2124; + border-color: #171a1d; } + .btn-dark:not(:disabled):not(.disabled):active:focus, .btn-dark:not(:disabled):not(.disabled).active:focus, + .show > .btn-dark.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); + box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); } + +.btn-outline-primary { + color: #78d5ef; + background-color: transparent; + background-image: none; + border-color: #78d5ef; } + .btn-outline-primary:hover { + color: #212529; + background-color: #78d5ef; + border-color: #78d5ef; } + .btn-outline-primary:focus, .btn-outline-primary.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); } + .btn-outline-primary.disabled, .btn-outline-primary:disabled { + color: #78d5ef; + background-color: transparent; } + .btn-outline-primary:not(:disabled):not(.disabled):active, .btn-outline-primary:not(:disabled):not(.disabled).active, + .show > .btn-outline-primary.dropdown-toggle { + color: #212529; + background-color: #78d5ef; + border-color: #78d5ef; } + .btn-outline-primary:not(:disabled):not(.disabled):active:focus, .btn-outline-primary:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-primary.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.5); } + +.btn-outline-secondary { + color: #6c757d; + background-color: transparent; + background-image: none; + border-color: #6c757d; } + .btn-outline-secondary:hover { + color: #fff; + background-color: #6c757d; + border-color: #6c757d; } + .btn-outline-secondary:focus, .btn-outline-secondary.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); + box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); } + .btn-outline-secondary.disabled, .btn-outline-secondary:disabled { + color: #6c757d; + background-color: transparent; } + .btn-outline-secondary:not(:disabled):not(.disabled):active, .btn-outline-secondary:not(:disabled):not(.disabled).active, + .show > .btn-outline-secondary.dropdown-toggle { + color: #fff; + background-color: #6c757d; + border-color: #6c757d; } + .btn-outline-secondary:not(:disabled):not(.disabled):active:focus, .btn-outline-secondary:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-secondary.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); + box-shadow: 0 0 0 0.2rem rgba(108, 117, 125, 0.5); } + +.btn-outline-success { + color: #28a745; + background-color: transparent; + background-image: none; + border-color: #28a745; } + .btn-outline-success:hover { + color: #fff; + background-color: #28a745; + border-color: #28a745; } + .btn-outline-success:focus, .btn-outline-success.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); } + .btn-outline-success.disabled, .btn-outline-success:disabled { + color: #28a745; + background-color: transparent; } + .btn-outline-success:not(:disabled):not(.disabled):active, .btn-outline-success:not(:disabled):not(.disabled).active, + .show > .btn-outline-success.dropdown-toggle { + color: #fff; + background-color: #28a745; + border-color: #28a745; } + .btn-outline-success:not(:disabled):not(.disabled):active:focus, .btn-outline-success:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-success.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(40, 167, 69, 0.5); } + +.btn-outline-info { + color: #17a2b8; + background-color: transparent; + background-image: none; + border-color: #17a2b8; } + .btn-outline-info:hover { + color: #fff; + background-color: #17a2b8; + border-color: #17a2b8; } + .btn-outline-info:focus, .btn-outline-info.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); + box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); } + .btn-outline-info.disabled, .btn-outline-info:disabled { + color: #17a2b8; + background-color: transparent; } + .btn-outline-info:not(:disabled):not(.disabled):active, .btn-outline-info:not(:disabled):not(.disabled).active, + .show > .btn-outline-info.dropdown-toggle { + color: #fff; + background-color: #17a2b8; + border-color: #17a2b8; } + .btn-outline-info:not(:disabled):not(.disabled):active:focus, .btn-outline-info:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-info.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); + box-shadow: 0 0 0 0.2rem rgba(23, 162, 184, 0.5); } + +.btn-outline-warning { + color: #ffc107; + background-color: transparent; + background-image: none; + border-color: #ffc107; } + .btn-outline-warning:hover { + color: #212529; + background-color: #ffc107; + border-color: #ffc107; } + .btn-outline-warning:focus, .btn-outline-warning.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); + box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); } + .btn-outline-warning.disabled, .btn-outline-warning:disabled { + color: #ffc107; + background-color: transparent; } + .btn-outline-warning:not(:disabled):not(.disabled):active, .btn-outline-warning:not(:disabled):not(.disabled).active, + .show > .btn-outline-warning.dropdown-toggle { + color: #212529; + background-color: #ffc107; + border-color: #ffc107; } + .btn-outline-warning:not(:disabled):not(.disabled):active:focus, .btn-outline-warning:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-warning.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); + box-shadow: 0 0 0 0.2rem rgba(255, 193, 7, 0.5); } + +.btn-outline-danger { + color: #dc3545; + background-color: transparent; + background-image: none; + border-color: #dc3545; } + .btn-outline-danger:hover { + color: #fff; + background-color: #dc3545; + border-color: #dc3545; } + .btn-outline-danger:focus, .btn-outline-danger.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); } + .btn-outline-danger.disabled, .btn-outline-danger:disabled { + color: #dc3545; + background-color: transparent; } + .btn-outline-danger:not(:disabled):not(.disabled):active, .btn-outline-danger:not(:disabled):not(.disabled).active, + .show > .btn-outline-danger.dropdown-toggle { + color: #fff; + background-color: #dc3545; + border-color: #dc3545; } + .btn-outline-danger:not(:disabled):not(.disabled):active:focus, .btn-outline-danger:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-danger.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); + box-shadow: 0 0 0 0.2rem rgba(220, 53, 69, 0.5); } + +.btn-outline-light { + color: #f8f9fa; + background-color: transparent; + background-image: none; + border-color: #f8f9fa; } + .btn-outline-light:hover { + color: #212529; + background-color: #f8f9fa; + border-color: #f8f9fa; } + .btn-outline-light:focus, .btn-outline-light.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); + box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); } + .btn-outline-light.disabled, .btn-outline-light:disabled { + color: #f8f9fa; + background-color: transparent; } + .btn-outline-light:not(:disabled):not(.disabled):active, .btn-outline-light:not(:disabled):not(.disabled).active, + .show > .btn-outline-light.dropdown-toggle { + color: #212529; + background-color: #f8f9fa; + border-color: #f8f9fa; } + .btn-outline-light:not(:disabled):not(.disabled):active:focus, .btn-outline-light:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-light.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); + box-shadow: 0 0 0 0.2rem rgba(248, 249, 250, 0.5); } + +.btn-outline-dark { + color: #343a40; + background-color: transparent; + background-image: none; + border-color: #343a40; } + .btn-outline-dark:hover { + color: #fff; + background-color: #343a40; + border-color: #343a40; } + .btn-outline-dark:focus, .btn-outline-dark.focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); + box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); } + .btn-outline-dark.disabled, .btn-outline-dark:disabled { + color: #343a40; + background-color: transparent; } + .btn-outline-dark:not(:disabled):not(.disabled):active, .btn-outline-dark:not(:disabled):not(.disabled).active, + .show > .btn-outline-dark.dropdown-toggle { + color: #fff; + background-color: #343a40; + border-color: #343a40; } + .btn-outline-dark:not(:disabled):not(.disabled):active:focus, .btn-outline-dark:not(:disabled):not(.disabled).active:focus, + .show > .btn-outline-dark.dropdown-toggle:focus { + -webkit-box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); + box-shadow: 0 0 0 0.2rem rgba(52, 58, 64, 0.5); } + +.btn-link { + font-weight: 400; + color: #78d5ef; + background-color: transparent; } + .btn-link:hover { + color: #34c0e7; + text-decoration: underline; + background-color: transparent; + border-color: transparent; } + .btn-link:focus, .btn-link.focus { + text-decoration: underline; + border-color: transparent; + -webkit-box-shadow: none; + box-shadow: none; } + .btn-link:disabled, .btn-link.disabled { + color: #6c757d; + pointer-events: none; } + +.btn-lg, .btn-group-lg > .btn { + padding: 0.5rem 1rem; + font-size: 1.25rem; + line-height: 1.5; + border-radius: 0.3rem; } + +.btn-sm, .btn-group-sm > .btn { + padding: 0.25rem 0.5rem; + font-size: 0.875rem; + line-height: 1.5; + border-radius: 0.2rem; } + +.btn-block { + display: block; + width: 100%; } + .btn-block + .btn-block { + margin-top: 0.5rem; } + +input[type="submit"].btn-block, +input[type="reset"].btn-block, +input[type="button"].btn-block { + width: 100%; } + +.fade { + -webkit-transition: opacity 0.15s linear; + -o-transition: opacity 0.15s linear; + transition: opacity 0.15s linear; } + @media screen and (prefers-reduced-motion: reduce) { + .fade { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + .fade:not(.show) { + opacity: 0; } + +.collapse:not(.show) { + display: none; } + +.collapsing { + position: relative; + height: 0; + overflow: hidden; + -webkit-transition: height 0.35s ease; + -o-transition: height 0.35s ease; + transition: height 0.35s ease; } + @media screen and (prefers-reduced-motion: reduce) { + .collapsing { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + +.dropup, +.dropright, +.dropdown, +.dropleft { + position: relative; } + +.dropdown-toggle::after { + display: inline-block; + width: 0; + height: 0; + margin-left: 0.255em; + vertical-align: 0.255em; + content: ""; + border-top: 0.3em solid; + border-right: 0.3em solid transparent; + border-bottom: 0; + border-left: 0.3em solid transparent; } + +.dropdown-toggle:empty::after { + margin-left: 0; } + +.dropdown-menu { + position: absolute; + top: 100%; + left: 0; + z-index: 1000; + display: none; + float: left; + min-width: 10rem; + padding: 0.5rem 0; + margin: 0.125rem 0 0; + font-size: 1rem; + color: #212529; + text-align: left; + list-style: none; + background-color: #fff; + background-clip: padding-box; + border: 1px solid rgba(0, 0, 0, 0.15); + border-radius: 0.25rem; } + +.dropdown-menu-right { + right: 0; + left: auto; } + +.dropup .dropdown-menu { + top: auto; + bottom: 100%; + margin-top: 0; + margin-bottom: 0.125rem; } + +.dropup .dropdown-toggle::after { + display: inline-block; + width: 0; + height: 0; + margin-left: 0.255em; + vertical-align: 0.255em; + content: ""; + border-top: 0; + border-right: 0.3em solid transparent; + border-bottom: 0.3em solid; + border-left: 0.3em solid transparent; } + +.dropup .dropdown-toggle:empty::after { + margin-left: 0; } + +.dropright .dropdown-menu { + top: 0; + right: auto; + left: 100%; + margin-top: 0; + margin-left: 0.125rem; } + +.dropright .dropdown-toggle::after { + display: inline-block; + width: 0; + height: 0; + margin-left: 0.255em; + vertical-align: 0.255em; + content: ""; + border-top: 0.3em solid transparent; + border-right: 0; + border-bottom: 0.3em solid transparent; + border-left: 0.3em solid; } + +.dropright .dropdown-toggle:empty::after { + margin-left: 0; } + +.dropright .dropdown-toggle::after { + vertical-align: 0; } + +.dropleft .dropdown-menu { + top: 0; + right: 100%; + left: auto; + margin-top: 0; + margin-right: 0.125rem; } + +.dropleft .dropdown-toggle::after { + display: inline-block; + width: 0; + height: 0; + margin-left: 0.255em; + vertical-align: 0.255em; + content: ""; } + +.dropleft .dropdown-toggle::after { + display: none; } + +.dropleft .dropdown-toggle::before { + display: inline-block; + width: 0; + height: 0; + margin-right: 0.255em; + vertical-align: 0.255em; + content: ""; + border-top: 0.3em solid transparent; + border-right: 0.3em solid; + border-bottom: 0.3em solid transparent; } + +.dropleft .dropdown-toggle:empty::after { + margin-left: 0; } + +.dropleft .dropdown-toggle::before { + vertical-align: 0; } + +.dropdown-menu[x-placement^="top"], .dropdown-menu[x-placement^="right"], .dropdown-menu[x-placement^="bottom"], .dropdown-menu[x-placement^="left"] { + right: auto; + bottom: auto; } + +.dropdown-divider { + height: 0; + margin: 0.5rem 0; + overflow: hidden; + border-top: 1px solid #e9ecef; } + +.dropdown-item { + display: block; + width: 100%; + padding: 0.25rem 1.5rem; + clear: both; + font-weight: 400; + color: #212529; + text-align: inherit; + white-space: nowrap; + background-color: transparent; + border: 0; } + .dropdown-item:hover, .dropdown-item:focus { + color: #16181b; + text-decoration: none; + background-color: #f8f9fa; } + .dropdown-item.active, .dropdown-item:active { + color: #fff; + text-decoration: none; + background-color: #78d5ef; } + .dropdown-item.disabled, .dropdown-item:disabled { + color: #6c757d; + background-color: transparent; } + +.dropdown-menu.show { + display: block; } + +.dropdown-header { + display: block; + padding: 0.5rem 1.5rem; + margin-bottom: 0; + font-size: 0.875rem; + color: #6c757d; + white-space: nowrap; } + +.dropdown-item-text { + display: block; + padding: 0.25rem 1.5rem; + color: #212529; } + +.btn-group, +.btn-group-vertical { + position: relative; + display: -webkit-inline-box; + display: -ms-inline-flexbox; + display: inline-flex; + vertical-align: middle; } + .btn-group > .btn, + .btn-group-vertical > .btn { + position: relative; + -webkit-box-flex: 0; + -ms-flex: 0 1 auto; + flex: 0 1 auto; } + .btn-group > .btn:hover, + .btn-group-vertical > .btn:hover { + z-index: 1; } + .btn-group > .btn:focus, .btn-group > .btn:active, .btn-group > .btn.active, + .btn-group-vertical > .btn:focus, + .btn-group-vertical > .btn:active, + .btn-group-vertical > .btn.active { + z-index: 1; } + .btn-group .btn + .btn, + .btn-group .btn + .btn-group, + .btn-group .btn-group + .btn, + .btn-group .btn-group + .btn-group, + .btn-group-vertical .btn + .btn, + .btn-group-vertical .btn + .btn-group, + .btn-group-vertical .btn-group + .btn, + .btn-group-vertical .btn-group + .btn-group { + margin-left: -1px; } + +.btn-toolbar { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .btn-toolbar .input-group { + width: auto; } + +.btn-group > .btn:first-child { + margin-left: 0; } + +.btn-group > .btn:not(:last-child):not(.dropdown-toggle), +.btn-group > .btn-group:not(:last-child) > .btn { + border-top-right-radius: 0; + border-bottom-right-radius: 0; } + +.btn-group > .btn:not(:first-child), +.btn-group > .btn-group:not(:first-child) > .btn { + border-top-left-radius: 0; + border-bottom-left-radius: 0; } + +.dropdown-toggle-split { + padding-right: 0.5625rem; + padding-left: 0.5625rem; } + .dropdown-toggle-split::after, + .dropup .dropdown-toggle-split::after, + .dropright .dropdown-toggle-split::after { + margin-left: 0; } + .dropleft .dropdown-toggle-split::before { + margin-right: 0; } + +.btn-sm + .dropdown-toggle-split, .btn-group-sm > .btn + .dropdown-toggle-split { + padding-right: 0.375rem; + padding-left: 0.375rem; } + +.btn-lg + .dropdown-toggle-split, .btn-group-lg > .btn + .dropdown-toggle-split { + padding-right: 0.75rem; + padding-left: 0.75rem; } + +.btn-group-vertical { + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + -webkit-box-align: start; + -ms-flex-align: start; + align-items: flex-start; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; } + .btn-group-vertical .btn, + .btn-group-vertical .btn-group { + width: 100%; } + .btn-group-vertical > .btn + .btn, + .btn-group-vertical > .btn + .btn-group, + .btn-group-vertical > .btn-group + .btn, + .btn-group-vertical > .btn-group + .btn-group { + margin-top: -1px; + margin-left: 0; } + .btn-group-vertical > .btn:not(:last-child):not(.dropdown-toggle), + .btn-group-vertical > .btn-group:not(:last-child) > .btn { + border-bottom-right-radius: 0; + border-bottom-left-radius: 0; } + .btn-group-vertical > .btn:not(:first-child), + .btn-group-vertical > .btn-group:not(:first-child) > .btn { + border-top-left-radius: 0; + border-top-right-radius: 0; } + +.btn-group-toggle > .btn, +.btn-group-toggle > .btn-group > .btn { + margin-bottom: 0; } + .btn-group-toggle > .btn input[type="radio"], + .btn-group-toggle > .btn input[type="checkbox"], + .btn-group-toggle > .btn-group > .btn input[type="radio"], + .btn-group-toggle > .btn-group > .btn input[type="checkbox"] { + position: absolute; + clip: rect(0, 0, 0, 0); + pointer-events: none; } + +.input-group { + position: relative; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + -webkit-box-align: stretch; + -ms-flex-align: stretch; + align-items: stretch; + width: 100%; } + .input-group > .form-control, + .input-group > .custom-select, + .input-group > .custom-file { + position: relative; + -webkit-box-flex: 1; + -ms-flex: 1 1 auto; + flex: 1 1 auto; + width: 1%; + margin-bottom: 0; } + .input-group > .form-control:focus, + .input-group > .custom-select:focus, + .input-group > .custom-file:focus { + z-index: 3; } + .input-group > .form-control + .form-control, + .input-group > .form-control + .custom-select, + .input-group > .form-control + .custom-file, + .input-group > .custom-select + .form-control, + .input-group > .custom-select + .custom-select, + .input-group > .custom-select + .custom-file, + .input-group > .custom-file + .form-control, + .input-group > .custom-file + .custom-select, + .input-group > .custom-file + .custom-file { + margin-left: -1px; } + .input-group > .form-control:not(:last-child), + .input-group > .custom-select:not(:last-child) { + border-top-right-radius: 0; + border-bottom-right-radius: 0; } + .input-group > .form-control:not(:first-child), + .input-group > .custom-select:not(:first-child) { + border-top-left-radius: 0; + border-bottom-left-radius: 0; } + .input-group > .custom-file { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; } + .input-group > .custom-file:not(:last-child) .custom-file-label, + .input-group > .custom-file:not(:last-child) .custom-file-label::after { + border-top-right-radius: 0; + border-bottom-right-radius: 0; } + .input-group > .custom-file:not(:first-child) .custom-file-label, + .input-group > .custom-file:not(:first-child) .custom-file-label::after { + border-top-left-radius: 0; + border-bottom-left-radius: 0; } + +.input-group-prepend, +.input-group-append { + display: -webkit-box; + display: -ms-flexbox; + display: flex; } + .input-group-prepend .btn, + .input-group-append .btn { + position: relative; + z-index: 2; } + .input-group-prepend .btn + .btn, + .input-group-prepend .btn + .input-group-text, + .input-group-prepend .input-group-text + .input-group-text, + .input-group-prepend .input-group-text + .btn, + .input-group-append .btn + .btn, + .input-group-append .btn + .input-group-text, + .input-group-append .input-group-text + .input-group-text, + .input-group-append .input-group-text + .btn { + margin-left: -1px; } + +.input-group-prepend { + margin-right: -1px; } + +.input-group-append { + margin-left: -1px; } + +.input-group-text { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + padding: 0.375rem 0.75rem; + margin-bottom: 0; + font-size: 1rem; + font-weight: 400; + line-height: 1.5; + color: #495057; + text-align: center; + white-space: nowrap; + background-color: #e9ecef; + border: 1px solid #ced4da; + border-radius: 0.25rem; } + .input-group-text input[type="radio"], + .input-group-text input[type="checkbox"] { + margin-top: 0; } + +.input-group > .input-group-prepend > .btn, +.input-group > .input-group-prepend > .input-group-text, +.input-group > .input-group-append:not(:last-child) > .btn, +.input-group > .input-group-append:not(:last-child) > .input-group-text, +.input-group > .input-group-append:last-child > .btn:not(:last-child):not(.dropdown-toggle), +.input-group > .input-group-append:last-child > .input-group-text:not(:last-child) { + border-top-right-radius: 0; + border-bottom-right-radius: 0; } + +.input-group > .input-group-append > .btn, +.input-group > .input-group-append > .input-group-text, +.input-group > .input-group-prepend:not(:first-child) > .btn, +.input-group > .input-group-prepend:not(:first-child) > .input-group-text, +.input-group > .input-group-prepend:first-child > .btn:not(:first-child), +.input-group > .input-group-prepend:first-child > .input-group-text:not(:first-child) { + border-top-left-radius: 0; + border-bottom-left-radius: 0; } + +.custom-control { + position: relative; + display: block; + min-height: 1.5rem; + padding-left: 1.5rem; } + +.custom-control-inline { + display: -webkit-inline-box; + display: -ms-inline-flexbox; + display: inline-flex; + margin-right: 1rem; } + +.custom-control-input { + position: absolute; + z-index: -1; + opacity: 0; } + .custom-control-input:checked ~ .custom-control-label::before { + color: #fff; + background-color: #78d5ef; } + .custom-control-input:focus ~ .custom-control-label::before { + -webkit-box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .custom-control-input:active ~ .custom-control-label::before { + color: #fff; + background-color: white; } + .custom-control-input:disabled ~ .custom-control-label { + color: #6c757d; } + .custom-control-input:disabled ~ .custom-control-label::before { + background-color: #e9ecef; } + +.custom-control-label { + margin-bottom: 0; } + .custom-control-label::before { + position: absolute; + top: 0.25rem; + left: 0; + display: block; + width: 1rem; + height: 1rem; + pointer-events: none; + content: ""; + -webkit-user-select: none; + -moz-user-select: none; + -ms-user-select: none; + user-select: none; + background-color: #dee2e6; } + .custom-control-label::after { + position: absolute; + top: 0.25rem; + left: 0; + display: block; + width: 1rem; + height: 1rem; + content: ""; + background-repeat: no-repeat; + background-position: center center; + background-size: 50% 50%; } + +.custom-checkbox .custom-control-label::before { + border-radius: 0.25rem; } + +.custom-checkbox .custom-control-input:checked ~ .custom-control-label::before { + background-color: #78d5ef; } + +.custom-checkbox .custom-control-input:checked ~ .custom-control-label::after { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 8 8'%3E%3Cpath fill='%23fff' d='M6.564.75l-3.59 3.612-1.538-1.55L0 4.26 2.974 7.25 8 2.193z'/%3E%3C/svg%3E"); } + +.custom-checkbox .custom-control-input:indeterminate ~ .custom-control-label::before { + background-color: #78d5ef; } + +.custom-checkbox .custom-control-input:indeterminate ~ .custom-control-label::after { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 4 4'%3E%3Cpath stroke='%23fff' d='M0 2h4'/%3E%3C/svg%3E"); } + +.custom-checkbox .custom-control-input:disabled:checked ~ .custom-control-label::before { + background-color: rgba(120, 213, 239, 0.5); } + +.custom-checkbox .custom-control-input:disabled:indeterminate ~ .custom-control-label::before { + background-color: rgba(120, 213, 239, 0.5); } + +.custom-radio .custom-control-label::before { + border-radius: 50%; } + +.custom-radio .custom-control-input:checked ~ .custom-control-label::before { + background-color: #78d5ef; } + +.custom-radio .custom-control-input:checked ~ .custom-control-label::after { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='-4 -4 8 8'%3E%3Ccircle r='3' fill='%23fff'/%3E%3C/svg%3E"); } + +.custom-radio .custom-control-input:disabled:checked ~ .custom-control-label::before { + background-color: rgba(120, 213, 239, 0.5); } + +.custom-select { + display: inline-block; + width: 100%; + height: calc(2.25rem + 2px); + padding: 0.375rem 1.75rem 0.375rem 0.75rem; + line-height: 1.5; + color: #495057; + vertical-align: middle; + background: #fff url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 4 5'%3E%3Cpath fill='%23343a40' d='M2 0L0 2h4zm0 5L0 3h4z'/%3E%3C/svg%3E") no-repeat right 0.75rem center; + background-size: 8px 10px; + border: 1px solid #ced4da; + border-radius: 0.25rem; + -webkit-appearance: none; + -moz-appearance: none; + appearance: none; } + .custom-select:focus { + border-color: #eaf8fd; + outline: 0; + -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.075), 0 0 5px rgba(234, 248, 253, 0.5); + box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.075), 0 0 5px rgba(234, 248, 253, 0.5); } + .custom-select:focus::-ms-value { + color: #495057; + background-color: #fff; } + .custom-select[multiple], .custom-select[size]:not([size="1"]) { + height: auto; + padding-right: 0.75rem; + background-image: none; } + .custom-select:disabled { + color: #6c757d; + background-color: #e9ecef; } + .custom-select::-ms-expand { + opacity: 0; } + +.custom-select-sm { + height: calc(1.8125rem + 2px); + padding-top: 0.375rem; + padding-bottom: 0.375rem; + font-size: 75%; } + +.custom-select-lg { + height: calc(2.875rem + 2px); + padding-top: 0.375rem; + padding-bottom: 0.375rem; + font-size: 125%; } + +.custom-file { + position: relative; + display: inline-block; + width: 100%; + height: calc(2.25rem + 2px); + margin-bottom: 0; } + +.custom-file-input { + position: relative; + z-index: 2; + width: 100%; + height: calc(2.25rem + 2px); + margin: 0; + opacity: 0; } + .custom-file-input:focus ~ .custom-file-label { + border-color: #eaf8fd; + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .custom-file-input:focus ~ .custom-file-label::after { + border-color: #eaf8fd; } + .custom-file-input:lang(en) ~ .custom-file-label::after { + content: "Browse"; } + +.custom-file-label { + position: absolute; + top: 0; + right: 0; + left: 0; + z-index: 1; + height: calc(2.25rem + 2px); + padding: 0.375rem 0.75rem; + line-height: 1.5; + color: #495057; + background-color: #fff; + border: 1px solid #ced4da; + border-radius: 0.25rem; } + .custom-file-label::after { + position: absolute; + top: 0; + right: 0; + bottom: 0; + z-index: 3; + display: block; + height: calc(calc(2.25rem + 2px) - 1px * 2); + padding: 0.375rem 0.75rem; + line-height: 1.5; + color: #495057; + content: "Browse"; + background-color: #e9ecef; + border-left: 1px solid #ced4da; + border-radius: 0 0.25rem 0.25rem 0; } + +.custom-range { + width: 100%; + padding-left: 0; + background-color: transparent; + -webkit-appearance: none; + -moz-appearance: none; + appearance: none; } + .custom-range:focus { + outline: none; } + .custom-range::-moz-focus-outer { + border: 0; } + .custom-range::-webkit-slider-thumb { + width: 1rem; + height: 1rem; + margin-top: -0.25rem; + background-color: #78d5ef; + border: 0; + border-radius: 1rem; + -webkit-appearance: none; + appearance: none; } + .custom-range::-webkit-slider-thumb:focus { + outline: none; + -webkit-box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .custom-range::-webkit-slider-thumb:active { + background-color: white; } + .custom-range::-webkit-slider-runnable-track { + width: 100%; + height: 0.5rem; + color: transparent; + cursor: pointer; + background-color: #dee2e6; + border-color: transparent; + border-radius: 1rem; } + .custom-range::-moz-range-thumb { + width: 1rem; + height: 1rem; + background-color: #78d5ef; + border: 0; + border-radius: 1rem; + -moz-appearance: none; + appearance: none; } + .custom-range::-moz-range-thumb:focus { + outline: none; + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .custom-range::-moz-range-thumb:active { + background-color: white; } + .custom-range::-moz-range-track { + width: 100%; + height: 0.5rem; + color: transparent; + cursor: pointer; + background-color: #dee2e6; + border-color: transparent; + border-radius: 1rem; } + .custom-range::-ms-thumb { + width: 1rem; + height: 1rem; + background-color: #78d5ef; + border: 0; + border-radius: 1rem; + appearance: none; } + .custom-range::-ms-thumb:focus { + outline: none; + box-shadow: 0 0 0 1px #fff, 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .custom-range::-ms-thumb:active { + background-color: white; } + .custom-range::-ms-track { + width: 100%; + height: 0.5rem; + color: transparent; + cursor: pointer; + background-color: transparent; + border-color: transparent; + border-width: 0.5rem; } + .custom-range::-ms-fill-lower { + background-color: #dee2e6; + border-radius: 1rem; } + .custom-range::-ms-fill-upper { + margin-right: 15px; + background-color: #dee2e6; + border-radius: 1rem; } + +.nav { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + padding-left: 0; + margin-bottom: 0; + list-style: none; } + +.nav-link { + display: block; + padding: 0.5rem 1rem; } + .nav-link:hover, .nav-link:focus { + text-decoration: none; } + .nav-link.disabled { + color: #6c757d; } + +.nav-tabs { + border-bottom: 1px solid #dee2e6; } + .nav-tabs .nav-item { + margin-bottom: -1px; } + .nav-tabs .nav-link { + border: 1px solid transparent; + border-top-left-radius: 0.25rem; + border-top-right-radius: 0.25rem; } + .nav-tabs .nav-link:hover, .nav-tabs .nav-link:focus { + border-color: #e9ecef #e9ecef #dee2e6; } + .nav-tabs .nav-link.disabled { + color: #6c757d; + background-color: transparent; + border-color: transparent; } + .nav-tabs .nav-link.active, + .nav-tabs .nav-item.show .nav-link { + color: #495057; + background-color: #fff; + border-color: #dee2e6 #dee2e6 #fff; } + .nav-tabs .dropdown-menu { + margin-top: -1px; + border-top-left-radius: 0; + border-top-right-radius: 0; } + +.nav-pills .nav-link { + border-radius: 0.25rem; } + +.nav-pills .nav-link.active, +.nav-pills .show > .nav-link { + color: #fff; + background-color: #78d5ef; } + +.nav-fill .nav-item { + -webkit-box-flex: 1; + -ms-flex: 1 1 auto; + flex: 1 1 auto; + text-align: center; } + +.nav-justified .nav-item { + -ms-flex-preferred-size: 0; + flex-basis: 0; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + text-align: center; } + +.tab-content > .tab-pane { + display: none; } + +.tab-content > .active { + display: block; } + +.navbar { + position: relative; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: justify; + -ms-flex-pack: justify; + justify-content: space-between; + padding: 0.5rem 1rem; } + .navbar > .container, + .navbar > .container-fluid { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: justify; + -ms-flex-pack: justify; + justify-content: space-between; } + +.navbar-brand { + display: inline-block; + padding-top: 0.3125rem; + padding-bottom: 0.3125rem; + margin-right: 1rem; + font-size: 1.25rem; + line-height: inherit; + white-space: nowrap; } + .navbar-brand:hover, .navbar-brand:focus { + text-decoration: none; } + +.navbar-nav { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + padding-left: 0; + margin-bottom: 0; + list-style: none; } + .navbar-nav .nav-link { + padding-right: 0; + padding-left: 0; } + .navbar-nav .dropdown-menu { + position: static; + float: none; } + +.navbar-text { + display: inline-block; + padding-top: 0.5rem; + padding-bottom: 0.5rem; } + +.navbar-collapse { + -ms-flex-preferred-size: 100%; + flex-basis: 100%; + -webkit-box-flex: 1; + -ms-flex-positive: 1; + flex-grow: 1; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; } + +.navbar-toggler { + padding: 0.25rem 0.75rem; + font-size: 1.25rem; + line-height: 1; + background-color: transparent; + border: 1px solid transparent; + border-radius: 0.25rem; } + .navbar-toggler:hover, .navbar-toggler:focus { + text-decoration: none; } + .navbar-toggler:not(:disabled):not(.disabled) { + cursor: pointer; } + +.navbar-toggler-icon { + display: inline-block; + width: 1.5em; + height: 1.5em; + vertical-align: middle; + content: ""; + background: no-repeat center center; + background-size: 100% 100%; } + +@media (max-width: 575.98px) { + .navbar-expand-sm > .container, + .navbar-expand-sm > .container-fluid { + padding-right: 0; + padding-left: 0; } } + +@media (min-width: 576px) { + .navbar-expand-sm { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row nowrap; + flex-flow: row nowrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .navbar-expand-sm .navbar-nav { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-direction: row; + flex-direction: row; } + .navbar-expand-sm .navbar-nav .dropdown-menu { + position: absolute; } + .navbar-expand-sm .navbar-nav .nav-link { + padding-right: 0.5rem; + padding-left: 0.5rem; } + .navbar-expand-sm > .container, + .navbar-expand-sm > .container-fluid { + -ms-flex-wrap: nowrap; + flex-wrap: nowrap; } + .navbar-expand-sm .navbar-collapse { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; + -ms-flex-preferred-size: auto; + flex-basis: auto; } + .navbar-expand-sm .navbar-toggler { + display: none; } } + +@media (max-width: 767.98px) { + .navbar-expand-md > .container, + .navbar-expand-md > .container-fluid { + padding-right: 0; + padding-left: 0; } } + +@media (min-width: 768px) { + .navbar-expand-md { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row nowrap; + flex-flow: row nowrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .navbar-expand-md .navbar-nav { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-direction: row; + flex-direction: row; } + .navbar-expand-md .navbar-nav .dropdown-menu { + position: absolute; } + .navbar-expand-md .navbar-nav .nav-link { + padding-right: 0.5rem; + padding-left: 0.5rem; } + .navbar-expand-md > .container, + .navbar-expand-md > .container-fluid { + -ms-flex-wrap: nowrap; + flex-wrap: nowrap; } + .navbar-expand-md .navbar-collapse { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; + -ms-flex-preferred-size: auto; + flex-basis: auto; } + .navbar-expand-md .navbar-toggler { + display: none; } } + +@media (max-width: 991.98px) { + .navbar-expand-lg > .container, + .navbar-expand-lg > .container-fluid { + padding-right: 0; + padding-left: 0; } } + +@media (min-width: 992px) { + .navbar-expand-lg { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row nowrap; + flex-flow: row nowrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .navbar-expand-lg .navbar-nav { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-direction: row; + flex-direction: row; } + .navbar-expand-lg .navbar-nav .dropdown-menu { + position: absolute; } + .navbar-expand-lg .navbar-nav .nav-link { + padding-right: 0.5rem; + padding-left: 0.5rem; } + .navbar-expand-lg > .container, + .navbar-expand-lg > .container-fluid { + -ms-flex-wrap: nowrap; + flex-wrap: nowrap; } + .navbar-expand-lg .navbar-collapse { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; + -ms-flex-preferred-size: auto; + flex-basis: auto; } + .navbar-expand-lg .navbar-toggler { + display: none; } } + +@media (max-width: 1199.98px) { + .navbar-expand-xl > .container, + .navbar-expand-xl > .container-fluid { + padding-right: 0; + padding-left: 0; } } + +@media (min-width: 1200px) { + .navbar-expand-xl { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row nowrap; + flex-flow: row nowrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .navbar-expand-xl .navbar-nav { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-direction: row; + flex-direction: row; } + .navbar-expand-xl .navbar-nav .dropdown-menu { + position: absolute; } + .navbar-expand-xl .navbar-nav .nav-link { + padding-right: 0.5rem; + padding-left: 0.5rem; } + .navbar-expand-xl > .container, + .navbar-expand-xl > .container-fluid { + -ms-flex-wrap: nowrap; + flex-wrap: nowrap; } + .navbar-expand-xl .navbar-collapse { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; + -ms-flex-preferred-size: auto; + flex-basis: auto; } + .navbar-expand-xl .navbar-toggler { + display: none; } } + +.navbar-expand { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row nowrap; + flex-flow: row nowrap; + -webkit-box-pack: start; + -ms-flex-pack: start; + justify-content: flex-start; } + .navbar-expand > .container, + .navbar-expand > .container-fluid { + padding-right: 0; + padding-left: 0; } + .navbar-expand .navbar-nav { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-direction: row; + flex-direction: row; } + .navbar-expand .navbar-nav .dropdown-menu { + position: absolute; } + .navbar-expand .navbar-nav .nav-link { + padding-right: 0.5rem; + padding-left: 0.5rem; } + .navbar-expand > .container, + .navbar-expand > .container-fluid { + -ms-flex-wrap: nowrap; + flex-wrap: nowrap; } + .navbar-expand .navbar-collapse { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; + -ms-flex-preferred-size: auto; + flex-basis: auto; } + .navbar-expand .navbar-toggler { + display: none; } + +.navbar-light .navbar-brand { + color: rgba(0, 0, 0, 0.9); } + .navbar-light .navbar-brand:hover, .navbar-light .navbar-brand:focus { + color: rgba(0, 0, 0, 0.9); } + +.navbar-light .navbar-nav .nav-link { + color: rgba(0, 0, 0, 0.5); } + .navbar-light .navbar-nav .nav-link:hover, .navbar-light .navbar-nav .nav-link:focus { + color: rgba(0, 0, 0, 0.7); } + .navbar-light .navbar-nav .nav-link.disabled { + color: rgba(0, 0, 0, 0.3); } + +.navbar-light .navbar-nav .show > .nav-link, +.navbar-light .navbar-nav .active > .nav-link, +.navbar-light .navbar-nav .nav-link.show, +.navbar-light .navbar-nav .nav-link.active { + color: rgba(0, 0, 0, 0.9); } + +.navbar-light .navbar-toggler { + color: rgba(0, 0, 0, 0.5); + border-color: rgba(0, 0, 0, 0.1); } + +.navbar-light .navbar-toggler-icon { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg viewBox='0 0 30 30' xmlns='http://www.w3.org/2000/svg'%3E%3Cpath stroke='rgba(0, 0, 0, 0.5)' stroke-width='2' stroke-linecap='round' stroke-miterlimit='10' d='M4 7h22M4 15h22M4 23h22'/%3E%3C/svg%3E"); } + +.navbar-light .navbar-text { + color: rgba(0, 0, 0, 0.5); } + .navbar-light .navbar-text a { + color: rgba(0, 0, 0, 0.9); } + .navbar-light .navbar-text a:hover, .navbar-light .navbar-text a:focus { + color: rgba(0, 0, 0, 0.9); } + +.navbar-dark .navbar-brand { + color: #fff; } + .navbar-dark .navbar-brand:hover, .navbar-dark .navbar-brand:focus { + color: #fff; } + +.navbar-dark .navbar-nav .nav-link { + color: rgba(255, 255, 255, 0.5); } + .navbar-dark .navbar-nav .nav-link:hover, .navbar-dark .navbar-nav .nav-link:focus { + color: rgba(255, 255, 255, 0.75); } + .navbar-dark .navbar-nav .nav-link.disabled { + color: rgba(255, 255, 255, 0.25); } + +.navbar-dark .navbar-nav .show > .nav-link, +.navbar-dark .navbar-nav .active > .nav-link, +.navbar-dark .navbar-nav .nav-link.show, +.navbar-dark .navbar-nav .nav-link.active { + color: #fff; } + +.navbar-dark .navbar-toggler { + color: rgba(255, 255, 255, 0.5); + border-color: rgba(255, 255, 255, 0.1); } + +.navbar-dark .navbar-toggler-icon { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg viewBox='0 0 30 30' xmlns='http://www.w3.org/2000/svg'%3E%3Cpath stroke='rgba(255, 255, 255, 0.5)' stroke-width='2' stroke-linecap='round' stroke-miterlimit='10' d='M4 7h22M4 15h22M4 23h22'/%3E%3C/svg%3E"); } + +.navbar-dark .navbar-text { + color: rgba(255, 255, 255, 0.5); } + .navbar-dark .navbar-text a { + color: #fff; } + .navbar-dark .navbar-text a:hover, .navbar-dark .navbar-text a:focus { + color: #fff; } + +.card { + position: relative; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + min-width: 0; + word-wrap: break-word; + background-color: #fff; + background-clip: border-box; + border: 1px solid rgba(0, 0, 0, 0.125); + border-radius: 0.25rem; } + .card > hr { + margin-right: 0; + margin-left: 0; } + .card > .list-group:first-child .list-group-item:first-child { + border-top-left-radius: 0.25rem; + border-top-right-radius: 0.25rem; } + .card > .list-group:last-child .list-group-item:last-child { + border-bottom-right-radius: 0.25rem; + border-bottom-left-radius: 0.25rem; } + +.card-body { + -webkit-box-flex: 1; + -ms-flex: 1 1 auto; + flex: 1 1 auto; + padding: 1.25rem; } + +.card-title { + margin-bottom: 0.75rem; } + +.card-subtitle { + margin-top: -0.375rem; + margin-bottom: 0; } + +.card-text:last-child { + margin-bottom: 0; } + +.card-link:hover { + text-decoration: none; } + +.card-link + .card-link { + margin-left: 1.25rem; } + +.card-header { + padding: 0.75rem 1.25rem; + margin-bottom: 0; + background-color: rgba(0, 0, 0, 0.03); + border-bottom: 1px solid rgba(0, 0, 0, 0.125); } + .card-header:first-child { + border-radius: calc(0.25rem - 1px) calc(0.25rem - 1px) 0 0; } + .card-header + .list-group .list-group-item:first-child { + border-top: 0; } + +.card-footer { + padding: 0.75rem 1.25rem; + background-color: rgba(0, 0, 0, 0.03); + border-top: 1px solid rgba(0, 0, 0, 0.125); } + .card-footer:last-child { + border-radius: 0 0 calc(0.25rem - 1px) calc(0.25rem - 1px); } + +.card-header-tabs { + margin-right: -0.625rem; + margin-bottom: -0.75rem; + margin-left: -0.625rem; + border-bottom: 0; } + +.card-header-pills { + margin-right: -0.625rem; + margin-left: -0.625rem; } + +.card-img-overlay { + position: absolute; + top: 0; + right: 0; + bottom: 0; + left: 0; + padding: 1.25rem; } + +.card-img { + width: 100%; + border-radius: calc(0.25rem - 1px); } + +.card-img-top { + width: 100%; + border-top-left-radius: calc(0.25rem - 1px); + border-top-right-radius: calc(0.25rem - 1px); } + +.card-img-bottom { + width: 100%; + border-bottom-right-radius: calc(0.25rem - 1px); + border-bottom-left-radius: calc(0.25rem - 1px); } + +.card-deck { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; } + .card-deck .card { + margin-bottom: 15px; } + @media (min-width: 576px) { + .card-deck { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row wrap; + flex-flow: row wrap; + margin-right: -15px; + margin-left: -15px; } + .card-deck .card { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-flex: 1; + -ms-flex: 1 0 0%; + flex: 1 0 0%; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + margin-right: 15px; + margin-bottom: 0; + margin-left: 15px; } } + +.card-group { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; } + .card-group > .card { + margin-bottom: 15px; } + @media (min-width: 576px) { + .card-group { + -webkit-box-orient: horizontal; + -webkit-box-direction: normal; + -ms-flex-flow: row wrap; + flex-flow: row wrap; } + .card-group > .card { + -webkit-box-flex: 1; + -ms-flex: 1 0 0%; + flex: 1 0 0%; + margin-bottom: 0; } + .card-group > .card + .card { + margin-left: 0; + border-left: 0; } + .card-group > .card:first-child { + border-top-right-radius: 0; + border-bottom-right-radius: 0; } + .card-group > .card:first-child .card-img-top, + .card-group > .card:first-child .card-header { + border-top-right-radius: 0; } + .card-group > .card:first-child .card-img-bottom, + .card-group > .card:first-child .card-footer { + border-bottom-right-radius: 0; } + .card-group > .card:last-child { + border-top-left-radius: 0; + border-bottom-left-radius: 0; } + .card-group > .card:last-child .card-img-top, + .card-group > .card:last-child .card-header { + border-top-left-radius: 0; } + .card-group > .card:last-child .card-img-bottom, + .card-group > .card:last-child .card-footer { + border-bottom-left-radius: 0; } + .card-group > .card:only-child { + border-radius: 0.25rem; } + .card-group > .card:only-child .card-img-top, + .card-group > .card:only-child .card-header { + border-top-left-radius: 0.25rem; + border-top-right-radius: 0.25rem; } + .card-group > .card:only-child .card-img-bottom, + .card-group > .card:only-child .card-footer { + border-bottom-right-radius: 0.25rem; + border-bottom-left-radius: 0.25rem; } + .card-group > .card:not(:first-child):not(:last-child):not(:only-child) { + border-radius: 0; } + .card-group > .card:not(:first-child):not(:last-child):not(:only-child) .card-img-top, + .card-group > .card:not(:first-child):not(:last-child):not(:only-child) .card-img-bottom, + .card-group > .card:not(:first-child):not(:last-child):not(:only-child) .card-header, + .card-group > .card:not(:first-child):not(:last-child):not(:only-child) .card-footer { + border-radius: 0; } } + +.card-columns .card { + margin-bottom: 0.75rem; } + +@media (min-width: 576px) { + .card-columns { + -webkit-column-count: 3; + column-count: 3; + -webkit-column-gap: 1.25rem; + column-gap: 1.25rem; + orphans: 1; + widows: 1; } + .card-columns .card { + display: inline-block; + width: 100%; } } + +.accordion .card:not(:first-of-type):not(:last-of-type) { + border-bottom: 0; + border-radius: 0; } + +.accordion .card:not(:first-of-type) .card-header:first-child { + border-radius: 0; } + +.accordion .card:first-of-type { + border-bottom: 0; + border-bottom-right-radius: 0; + border-bottom-left-radius: 0; } + +.accordion .card:last-of-type { + border-top-left-radius: 0; + border-top-right-radius: 0; } + +.breadcrumb { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -ms-flex-wrap: wrap; + flex-wrap: wrap; + padding: 0.75rem 1rem; + margin-bottom: 1rem; + list-style: none; + background-color: #e9ecef; + border-radius: 0.25rem; } + +.breadcrumb-item + .breadcrumb-item { + padding-left: 0.5rem; } + .breadcrumb-item + .breadcrumb-item::before { + display: inline-block; + padding-right: 0.5rem; + color: #6c757d; + content: "/"; } + +.breadcrumb-item + .breadcrumb-item:hover::before { + text-decoration: underline; } + +.breadcrumb-item + .breadcrumb-item:hover::before { + text-decoration: none; } + +.breadcrumb-item.active { + color: #6c757d; } + +.pagination { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + padding-left: 0; + list-style: none; + border-radius: 0.25rem; } + +.page-link { + position: relative; + display: block; + padding: 0.5rem 0.75rem; + margin-left: -1px; + line-height: 1.25; + color: #78d5ef; + background-color: #fff; + border: 1px solid #dee2e6; } + .page-link:hover { + z-index: 2; + color: #34c0e7; + text-decoration: none; + background-color: #e9ecef; + border-color: #dee2e6; } + .page-link:focus { + z-index: 2; + outline: 0; + -webkit-box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); + box-shadow: 0 0 0 0.2rem rgba(120, 213, 239, 0.25); } + .page-link:not(:disabled):not(.disabled) { + cursor: pointer; } + +.page-item:first-child .page-link { + margin-left: 0; + border-top-left-radius: 0.25rem; + border-bottom-left-radius: 0.25rem; } + +.page-item:last-child .page-link { + border-top-right-radius: 0.25rem; + border-bottom-right-radius: 0.25rem; } + +.page-item.active .page-link { + z-index: 1; + color: #fff; + background-color: #78d5ef; + border-color: #78d5ef; } + +.page-item.disabled .page-link { + color: #6c757d; + pointer-events: none; + cursor: auto; + background-color: #fff; + border-color: #dee2e6; } + +.pagination-lg .page-link { + padding: 0.75rem 1.5rem; + font-size: 1.25rem; + line-height: 1.5; } + +.pagination-lg .page-item:first-child .page-link { + border-top-left-radius: 0.3rem; + border-bottom-left-radius: 0.3rem; } + +.pagination-lg .page-item:last-child .page-link { + border-top-right-radius: 0.3rem; + border-bottom-right-radius: 0.3rem; } + +.pagination-sm .page-link { + padding: 0.25rem 0.5rem; + font-size: 0.875rem; + line-height: 1.5; } + +.pagination-sm .page-item:first-child .page-link { + border-top-left-radius: 0.2rem; + border-bottom-left-radius: 0.2rem; } + +.pagination-sm .page-item:last-child .page-link { + border-top-right-radius: 0.2rem; + border-bottom-right-radius: 0.2rem; } + +.badge { + display: inline-block; + padding: 0.25em 0.4em; + font-size: 75%; + font-weight: 700; + line-height: 1; + text-align: center; + white-space: nowrap; + vertical-align: baseline; + border-radius: 0.25rem; } + .badge:empty { + display: none; } + +.btn .badge { + position: relative; + top: -1px; } + +.badge-pill { + padding-right: 0.6em; + padding-left: 0.6em; + border-radius: 10rem; } + +.badge-primary { + color: #212529; + background-color: #78d5ef; } + .badge-primary[href]:hover, .badge-primary[href]:focus { + color: #212529; + text-decoration: none; + background-color: #4ac7ea; } + +.badge-secondary { + color: #fff; + background-color: #6c757d; } + .badge-secondary[href]:hover, .badge-secondary[href]:focus { + color: #fff; + text-decoration: none; + background-color: #545b62; } + +.badge-success { + color: #fff; + background-color: #28a745; } + .badge-success[href]:hover, .badge-success[href]:focus { + color: #fff; + text-decoration: none; + background-color: #1e7e34; } + +.badge-info { + color: #fff; + background-color: #17a2b8; } + .badge-info[href]:hover, .badge-info[href]:focus { + color: #fff; + text-decoration: none; + background-color: #117a8b; } + +.badge-warning { + color: #212529; + background-color: #ffc107; } + .badge-warning[href]:hover, .badge-warning[href]:focus { + color: #212529; + text-decoration: none; + background-color: #d39e00; } + +.badge-danger { + color: #fff; + background-color: #dc3545; } + .badge-danger[href]:hover, .badge-danger[href]:focus { + color: #fff; + text-decoration: none; + background-color: #bd2130; } + +.badge-light { + color: #212529; + background-color: #f8f9fa; } + .badge-light[href]:hover, .badge-light[href]:focus { + color: #212529; + text-decoration: none; + background-color: #dae0e5; } + +.badge-dark { + color: #fff; + background-color: #343a40; } + .badge-dark[href]:hover, .badge-dark[href]:focus { + color: #fff; + text-decoration: none; + background-color: #1d2124; } + +.jumbotron { + padding: 2rem 1rem; + margin-bottom: 2rem; + background-color: #e9ecef; + border-radius: 0.3rem; } + @media (min-width: 576px) { + .jumbotron { + padding: 4rem 2rem; } } + +.jumbotron-fluid { + padding-right: 0; + padding-left: 0; + border-radius: 0; } + +.alert { + position: relative; + padding: 0.75rem 1.25rem; + margin-bottom: 1rem; + border: 1px solid transparent; + border-radius: 0.25rem; } + +.alert-heading { + color: inherit; } + +.alert-link { + font-weight: 700; } + +.alert-dismissible { + padding-right: 4rem; } + .alert-dismissible .close { + position: absolute; + top: 0; + right: 0; + padding: 0.75rem 1.25rem; + color: inherit; } + +.alert-primary { + color: #3e6f7c; + background-color: #e4f7fc; + border-color: #d9f3fb; } + .alert-primary hr { + border-top-color: #c2ecf9; } + .alert-primary .alert-link { + color: #2d515a; } + +.alert-secondary { + color: #383d41; + background-color: #e2e3e5; + border-color: #d6d8db; } + .alert-secondary hr { + border-top-color: #c8cbcf; } + .alert-secondary .alert-link { + color: #202326; } + +.alert-success { + color: #155724; + background-color: #d4edda; + border-color: #c3e6cb; } + .alert-success hr { + border-top-color: #b1dfbb; } + .alert-success .alert-link { + color: #0b2e13; } + +.alert-info { + color: #0c5460; + background-color: #d1ecf1; + border-color: #bee5eb; } + .alert-info hr { + border-top-color: #abdde5; } + .alert-info .alert-link { + color: #062c33; } + +.alert-warning { + color: #856404; + background-color: #fff3cd; + border-color: #ffeeba; } + .alert-warning hr { + border-top-color: #ffe8a1; } + .alert-warning .alert-link { + color: #533f03; } + +.alert-danger { + color: #721c24; + background-color: #f8d7da; + border-color: #f5c6cb; } + .alert-danger hr { + border-top-color: #f1b0b7; } + .alert-danger .alert-link { + color: #491217; } + +.alert-light { + color: #818182; + background-color: #fefefe; + border-color: #fdfdfe; } + .alert-light hr { + border-top-color: #ececf6; } + .alert-light .alert-link { + color: #686868; } + +.alert-dark { + color: #1b1e21; + background-color: #d6d8d9; + border-color: #c6c8ca; } + .alert-dark hr { + border-top-color: #b9bbbe; } + .alert-dark .alert-link { + color: #040505; } + +@-webkit-keyframes progress-bar-stripes { + from { + background-position: 1rem 0; } + to { + background-position: 0 0; } } + +@keyframes progress-bar-stripes { + from { + background-position: 1rem 0; } + to { + background-position: 0 0; } } + +.progress { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + height: 1rem; + overflow: hidden; + font-size: 0.75rem; + background-color: #e9ecef; + border-radius: 0.25rem; } + +.progress-bar { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; + color: #fff; + text-align: center; + white-space: nowrap; + background-color: #78d5ef; + -webkit-transition: width 0.6s ease; + -o-transition: width 0.6s ease; + transition: width 0.6s ease; } + @media screen and (prefers-reduced-motion: reduce) { + .progress-bar { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + +.progress-bar-striped { + background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); + background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); + background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); + background-size: 1rem 1rem; } + +.progress-bar-animated { + -webkit-animation: progress-bar-stripes 1s linear infinite; + animation: progress-bar-stripes 1s linear infinite; } + +.media { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: start; + -ms-flex-align: start; + align-items: flex-start; } + +.media-body { + -webkit-box-flex: 1; + -ms-flex: 1; + flex: 1; } + +.list-group { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + padding-left: 0; + margin-bottom: 0; } + +.list-group-item-action { + width: 100%; + color: #495057; + text-align: inherit; } + .list-group-item-action:hover, .list-group-item-action:focus { + color: #495057; + text-decoration: none; + background-color: #f8f9fa; } + .list-group-item-action:active { + color: #212529; + background-color: #e9ecef; } + +.list-group-item { + position: relative; + display: block; + padding: 0.75rem 1.25rem; + margin-bottom: -1px; + background-color: #fff; + border: 1px solid rgba(0, 0, 0, 0.125); } + .list-group-item:first-child { + border-top-left-radius: 0.25rem; + border-top-right-radius: 0.25rem; } + .list-group-item:last-child { + margin-bottom: 0; + border-bottom-right-radius: 0.25rem; + border-bottom-left-radius: 0.25rem; } + .list-group-item:hover, .list-group-item:focus { + z-index: 1; + text-decoration: none; } + .list-group-item.disabled, .list-group-item:disabled { + color: #6c757d; + background-color: #fff; } + .list-group-item.active { + z-index: 2; + color: #fff; + background-color: #78d5ef; + border-color: #78d5ef; } + +.list-group-flush .list-group-item { + border-right: 0; + border-left: 0; + border-radius: 0; } + +.list-group-flush:first-child .list-group-item:first-child { + border-top: 0; } + +.list-group-flush:last-child .list-group-item:last-child { + border-bottom: 0; } + +.list-group-item-primary { + color: #3e6f7c; + background-color: #d9f3fb; } + .list-group-item-primary.list-group-item-action:hover, .list-group-item-primary.list-group-item-action:focus { + color: #3e6f7c; + background-color: #c2ecf9; } + .list-group-item-primary.list-group-item-action.active { + color: #fff; + background-color: #3e6f7c; + border-color: #3e6f7c; } + +.list-group-item-secondary { + color: #383d41; + background-color: #d6d8db; } + .list-group-item-secondary.list-group-item-action:hover, .list-group-item-secondary.list-group-item-action:focus { + color: #383d41; + background-color: #c8cbcf; } + .list-group-item-secondary.list-group-item-action.active { + color: #fff; + background-color: #383d41; + border-color: #383d41; } + +.list-group-item-success { + color: #155724; + background-color: #c3e6cb; } + .list-group-item-success.list-group-item-action:hover, .list-group-item-success.list-group-item-action:focus { + color: #155724; + background-color: #b1dfbb; } + .list-group-item-success.list-group-item-action.active { + color: #fff; + background-color: #155724; + border-color: #155724; } + +.list-group-item-info { + color: #0c5460; + background-color: #bee5eb; } + .list-group-item-info.list-group-item-action:hover, .list-group-item-info.list-group-item-action:focus { + color: #0c5460; + background-color: #abdde5; } + .list-group-item-info.list-group-item-action.active { + color: #fff; + background-color: #0c5460; + border-color: #0c5460; } + +.list-group-item-warning { + color: #856404; + background-color: #ffeeba; } + .list-group-item-warning.list-group-item-action:hover, .list-group-item-warning.list-group-item-action:focus { + color: #856404; + background-color: #ffe8a1; } + .list-group-item-warning.list-group-item-action.active { + color: #fff; + background-color: #856404; + border-color: #856404; } + +.list-group-item-danger { + color: #721c24; + background-color: #f5c6cb; } + .list-group-item-danger.list-group-item-action:hover, .list-group-item-danger.list-group-item-action:focus { + color: #721c24; + background-color: #f1b0b7; } + .list-group-item-danger.list-group-item-action.active { + color: #fff; + background-color: #721c24; + border-color: #721c24; } + +.list-group-item-light { + color: #818182; + background-color: #fdfdfe; } + .list-group-item-light.list-group-item-action:hover, .list-group-item-light.list-group-item-action:focus { + color: #818182; + background-color: #ececf6; } + .list-group-item-light.list-group-item-action.active { + color: #fff; + background-color: #818182; + border-color: #818182; } + +.list-group-item-dark { + color: #1b1e21; + background-color: #c6c8ca; } + .list-group-item-dark.list-group-item-action:hover, .list-group-item-dark.list-group-item-action:focus { + color: #1b1e21; + background-color: #b9bbbe; } + .list-group-item-dark.list-group-item-action.active { + color: #fff; + background-color: #1b1e21; + border-color: #1b1e21; } + +.close { + float: right; + font-size: 1.5rem; + font-weight: 700; + line-height: 1; + color: #000; + text-shadow: 0 1px 0 #fff; + opacity: .5; } + .close:hover, .close:focus { + color: #000; + text-decoration: none; + opacity: .75; } + .close:not(:disabled):not(.disabled) { + cursor: pointer; } + +button.close { + padding: 0; + background-color: transparent; + border: 0; + -webkit-appearance: none; } + +.modal-open { + overflow: hidden; } + +.modal { + position: fixed; + top: 0; + right: 0; + bottom: 0; + left: 0; + z-index: 1050; + display: none; + overflow: hidden; + outline: 0; } + .modal-open .modal { + overflow-x: hidden; + overflow-y: auto; } + +.modal-dialog { + position: relative; + width: auto; + margin: 0.5rem; + pointer-events: none; } + .modal.fade .modal-dialog { + -webkit-transition: -webkit-transform 0.3s ease-out; + transition: -webkit-transform 0.3s ease-out; + -o-transition: transform 0.3s ease-out; + transition: transform 0.3s ease-out; + transition: transform 0.3s ease-out, -webkit-transform 0.3s ease-out; + -webkit-transform: translate(0, -25%); + -ms-transform: translate(0, -25%); + transform: translate(0, -25%); } + @media screen and (prefers-reduced-motion: reduce) { + .modal.fade .modal-dialog { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + .modal.show .modal-dialog { + -webkit-transform: translate(0, 0); + -ms-transform: translate(0, 0); + transform: translate(0, 0); } + +.modal-dialog-centered { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + min-height: calc(100% - (0.5rem * 2)); } + +.modal-content { + position: relative; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-orient: vertical; + -webkit-box-direction: normal; + -ms-flex-direction: column; + flex-direction: column; + width: 100%; + pointer-events: auto; + background-color: #fff; + background-clip: padding-box; + border: 1px solid rgba(0, 0, 0, 0.2); + border-radius: 0.3rem; + outline: 0; } + +.modal-backdrop { + position: fixed; + top: 0; + right: 0; + bottom: 0; + left: 0; + z-index: 1040; + background-color: #000; } + .modal-backdrop.fade { + opacity: 0; } + .modal-backdrop.show { + opacity: 0.5; } + +.modal-header { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: start; + -ms-flex-align: start; + align-items: flex-start; + -webkit-box-pack: justify; + -ms-flex-pack: justify; + justify-content: space-between; + padding: 1rem; + border-bottom: 1px solid #e9ecef; + border-top-left-radius: 0.3rem; + border-top-right-radius: 0.3rem; } + .modal-header .close { + padding: 1rem; + margin: -1rem -1rem -1rem auto; } + +.modal-title { + margin-bottom: 0; + line-height: 1.5; } + +.modal-body { + position: relative; + -webkit-box-flex: 1; + -ms-flex: 1 1 auto; + flex: 1 1 auto; + padding: 1rem; } + +.modal-footer { + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: end; + -ms-flex-pack: end; + justify-content: flex-end; + padding: 1rem; + border-top: 1px solid #e9ecef; } + .modal-footer > :not(:first-child) { + margin-left: .25rem; } + .modal-footer > :not(:last-child) { + margin-right: .25rem; } + +.modal-scrollbar-measure { + position: absolute; + top: -9999px; + width: 50px; + height: 50px; + overflow: scroll; } + +@media (min-width: 576px) { + .modal-dialog { + max-width: 500px; + margin: 1.75rem auto; } + .modal-dialog-centered { + min-height: calc(100% - (1.75rem * 2)); } + .modal-sm { + max-width: 300px; } } + +@media (min-width: 992px) { + .modal-lg { + max-width: 800px; } } + +.tooltip { + position: absolute; + z-index: 1070; + display: block; + margin: 0; + font-family: "Work Sans", -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, "Helvetica Neue", Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol"; + font-style: normal; + font-weight: 400; + line-height: 1.5; + text-align: left; + text-align: start; + text-decoration: none; + text-shadow: none; + text-transform: none; + letter-spacing: normal; + word-break: normal; + word-spacing: normal; + white-space: normal; + line-break: auto; + font-size: 0.875rem; + word-wrap: break-word; + opacity: 0; } + .tooltip.show { + opacity: 0.9; } + .tooltip .arrow { + position: absolute; + display: block; + width: 0.8rem; + height: 0.4rem; } + .tooltip .arrow::before { + position: absolute; + content: ""; + border-color: transparent; + border-style: solid; } + +.bs-tooltip-top, .bs-tooltip-auto[x-placement^="top"] { + padding: 0.4rem 0; } + .bs-tooltip-top .arrow, .bs-tooltip-auto[x-placement^="top"] .arrow { + bottom: 0; } + .bs-tooltip-top .arrow::before, .bs-tooltip-auto[x-placement^="top"] .arrow::before { + top: 0; + border-width: 0.4rem 0.4rem 0; + border-top-color: #000; } + +.bs-tooltip-right, .bs-tooltip-auto[x-placement^="right"] { + padding: 0 0.4rem; } + .bs-tooltip-right .arrow, .bs-tooltip-auto[x-placement^="right"] .arrow { + left: 0; + width: 0.4rem; + height: 0.8rem; } + .bs-tooltip-right .arrow::before, .bs-tooltip-auto[x-placement^="right"] .arrow::before { + right: 0; + border-width: 0.4rem 0.4rem 0.4rem 0; + border-right-color: #000; } + +.bs-tooltip-bottom, .bs-tooltip-auto[x-placement^="bottom"] { + padding: 0.4rem 0; } + .bs-tooltip-bottom .arrow, .bs-tooltip-auto[x-placement^="bottom"] .arrow { + top: 0; } + .bs-tooltip-bottom .arrow::before, .bs-tooltip-auto[x-placement^="bottom"] .arrow::before { + bottom: 0; + border-width: 0 0.4rem 0.4rem; + border-bottom-color: #000; } + +.bs-tooltip-left, .bs-tooltip-auto[x-placement^="left"] { + padding: 0 0.4rem; } + .bs-tooltip-left .arrow, .bs-tooltip-auto[x-placement^="left"] .arrow { + right: 0; + width: 0.4rem; + height: 0.8rem; } + .bs-tooltip-left .arrow::before, .bs-tooltip-auto[x-placement^="left"] .arrow::before { + left: 0; + border-width: 0.4rem 0 0.4rem 0.4rem; + border-left-color: #000; } + +.tooltip-inner { + max-width: 200px; + padding: 0.25rem 0.5rem; + color: #fff; + text-align: center; + background-color: #000; + border-radius: 0.25rem; } + +.popover { + position: absolute; + top: 0; + left: 0; + z-index: 1060; + display: block; + max-width: 276px; + font-family: "Work Sans", -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, "Helvetica Neue", Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol"; + font-style: normal; + font-weight: 400; + line-height: 1.5; + text-align: left; + text-align: start; + text-decoration: none; + text-shadow: none; + text-transform: none; + letter-spacing: normal; + word-break: normal; + word-spacing: normal; + white-space: normal; + line-break: auto; + font-size: 0.875rem; + word-wrap: break-word; + background-color: #fff; + background-clip: padding-box; + border: 1px solid rgba(0, 0, 0, 0.2); + border-radius: 0.3rem; } + .popover .arrow { + position: absolute; + display: block; + width: 1rem; + height: 0.5rem; + margin: 0 0.3rem; } + .popover .arrow::before, .popover .arrow::after { + position: absolute; + display: block; + content: ""; + border-color: transparent; + border-style: solid; } + +.bs-popover-top, .bs-popover-auto[x-placement^="top"] { + margin-bottom: 0.5rem; } + .bs-popover-top .arrow, .bs-popover-auto[x-placement^="top"] .arrow { + bottom: calc((0.5rem + 1px) * -1); } + .bs-popover-top .arrow::before, .bs-popover-auto[x-placement^="top"] .arrow::before, + .bs-popover-top .arrow::after, + .bs-popover-auto[x-placement^="top"] .arrow::after { + border-width: 0.5rem 0.5rem 0; } + .bs-popover-top .arrow::before, .bs-popover-auto[x-placement^="top"] .arrow::before { + bottom: 0; + border-top-color: rgba(0, 0, 0, 0.25); } + + .bs-popover-top .arrow::after, + .bs-popover-auto[x-placement^="top"] .arrow::after { + bottom: 1px; + border-top-color: #fff; } + +.bs-popover-right, .bs-popover-auto[x-placement^="right"] { + margin-left: 0.5rem; } + .bs-popover-right .arrow, .bs-popover-auto[x-placement^="right"] .arrow { + left: calc((0.5rem + 1px) * -1); + width: 0.5rem; + height: 1rem; + margin: 0.3rem 0; } + .bs-popover-right .arrow::before, .bs-popover-auto[x-placement^="right"] .arrow::before, + .bs-popover-right .arrow::after, + .bs-popover-auto[x-placement^="right"] .arrow::after { + border-width: 0.5rem 0.5rem 0.5rem 0; } + .bs-popover-right .arrow::before, .bs-popover-auto[x-placement^="right"] .arrow::before { + left: 0; + border-right-color: rgba(0, 0, 0, 0.25); } + + .bs-popover-right .arrow::after, + .bs-popover-auto[x-placement^="right"] .arrow::after { + left: 1px; + border-right-color: #fff; } + +.bs-popover-bottom, .bs-popover-auto[x-placement^="bottom"] { + margin-top: 0.5rem; } + .bs-popover-bottom .arrow, .bs-popover-auto[x-placement^="bottom"] .arrow { + top: calc((0.5rem + 1px) * -1); } + .bs-popover-bottom .arrow::before, .bs-popover-auto[x-placement^="bottom"] .arrow::before, + .bs-popover-bottom .arrow::after, + .bs-popover-auto[x-placement^="bottom"] .arrow::after { + border-width: 0 0.5rem 0.5rem 0.5rem; } + .bs-popover-bottom .arrow::before, .bs-popover-auto[x-placement^="bottom"] .arrow::before { + top: 0; + border-bottom-color: rgba(0, 0, 0, 0.25); } + + .bs-popover-bottom .arrow::after, + .bs-popover-auto[x-placement^="bottom"] .arrow::after { + top: 1px; + border-bottom-color: #fff; } + .bs-popover-bottom .popover-header::before, .bs-popover-auto[x-placement^="bottom"] .popover-header::before { + position: absolute; + top: 0; + left: 50%; + display: block; + width: 1rem; + margin-left: -0.5rem; + content: ""; + border-bottom: 1px solid #f7f7f7; } + +.bs-popover-left, .bs-popover-auto[x-placement^="left"] { + margin-right: 0.5rem; } + .bs-popover-left .arrow, .bs-popover-auto[x-placement^="left"] .arrow { + right: calc((0.5rem + 1px) * -1); + width: 0.5rem; + height: 1rem; + margin: 0.3rem 0; } + .bs-popover-left .arrow::before, .bs-popover-auto[x-placement^="left"] .arrow::before, + .bs-popover-left .arrow::after, + .bs-popover-auto[x-placement^="left"] .arrow::after { + border-width: 0.5rem 0 0.5rem 0.5rem; } + .bs-popover-left .arrow::before, .bs-popover-auto[x-placement^="left"] .arrow::before { + right: 0; + border-left-color: rgba(0, 0, 0, 0.25); } + + .bs-popover-left .arrow::after, + .bs-popover-auto[x-placement^="left"] .arrow::after { + right: 1px; + border-left-color: #fff; } + +.popover-header { + padding: 0.5rem 0.75rem; + margin-bottom: 0; + font-size: 1rem; + color: inherit; + background-color: #f7f7f7; + border-bottom: 1px solid #ebebeb; + border-top-left-radius: calc(0.3rem - 1px); + border-top-right-radius: calc(0.3rem - 1px); } + .popover-header:empty { + display: none; } + +.popover-body { + padding: 0.5rem 0.75rem; + color: #212529; } + +.carousel { + position: relative; } + +.carousel-inner { + position: relative; + width: 100%; + overflow: hidden; } + +.carousel-item { + position: relative; + display: none; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + width: 100%; + -webkit-transition: -webkit-transform 0.6s ease; + transition: -webkit-transform 0.6s ease; + -o-transition: transform 0.6s ease; + transition: transform 0.6s ease; + transition: transform 0.6s ease, -webkit-transform 0.6s ease; + -webkit-backface-visibility: hidden; + backface-visibility: hidden; + -webkit-perspective: 1000px; + perspective: 1000px; } + @media screen and (prefers-reduced-motion: reduce) { + .carousel-item { + -webkit-transition: none; + -o-transition: none; + transition: none; } } + +.carousel-item.active, +.carousel-item-next, +.carousel-item-prev { + display: block; } + +.carousel-item-next, +.carousel-item-prev { + position: absolute; + top: 0; } + +.carousel-item-next.carousel-item-left, +.carousel-item-prev.carousel-item-right { + -webkit-transform: translateX(0); + -ms-transform: translateX(0); + transform: translateX(0); } + @supports ((-webkit-transform-style: preserve-3d) or (transform-style: preserve-3d)) { + .carousel-item-next.carousel-item-left, + .carousel-item-prev.carousel-item-right { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); } } + +.carousel-item-next, +.active.carousel-item-right { + -webkit-transform: translateX(100%); + -ms-transform: translateX(100%); + transform: translateX(100%); } + @supports ((-webkit-transform-style: preserve-3d) or (transform-style: preserve-3d)) { + .carousel-item-next, + .active.carousel-item-right { + -webkit-transform: translate3d(100%, 0, 0); + transform: translate3d(100%, 0, 0); } } + +.carousel-item-prev, +.active.carousel-item-left { + -webkit-transform: translateX(-100%); + -ms-transform: translateX(-100%); + transform: translateX(-100%); } + @supports ((-webkit-transform-style: preserve-3d) or (transform-style: preserve-3d)) { + .carousel-item-prev, + .active.carousel-item-left { + -webkit-transform: translate3d(-100%, 0, 0); + transform: translate3d(-100%, 0, 0); } } + +.carousel-fade .carousel-item { + opacity: 0; + -webkit-transition-duration: .6s; + -o-transition-duration: .6s; + transition-duration: .6s; + -webkit-transition-property: opacity; + -o-transition-property: opacity; + transition-property: opacity; } + +.carousel-fade .carousel-item.active, +.carousel-fade .carousel-item-next.carousel-item-left, +.carousel-fade .carousel-item-prev.carousel-item-right { + opacity: 1; } + +.carousel-fade .active.carousel-item-left, +.carousel-fade .active.carousel-item-right { + opacity: 0; } + +.carousel-fade .carousel-item-next, +.carousel-fade .carousel-item-prev, +.carousel-fade .carousel-item.active, +.carousel-fade .active.carousel-item-left, +.carousel-fade .active.carousel-item-prev { + -webkit-transform: translateX(0); + -ms-transform: translateX(0); + transform: translateX(0); } + @supports ((-webkit-transform-style: preserve-3d) or (transform-style: preserve-3d)) { + .carousel-fade .carousel-item-next, + .carousel-fade .carousel-item-prev, + .carousel-fade .carousel-item.active, + .carousel-fade .active.carousel-item-left, + .carousel-fade .active.carousel-item-prev { + -webkit-transform: translate3d(0, 0, 0); + transform: translate3d(0, 0, 0); } } + +.carousel-control-prev, +.carousel-control-next { + position: absolute; + top: 0; + bottom: 0; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-align: center; + -ms-flex-align: center; + align-items: center; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; + width: 15%; + color: #fff; + text-align: center; + opacity: 0.5; } + .carousel-control-prev:hover, .carousel-control-prev:focus, + .carousel-control-next:hover, + .carousel-control-next:focus { + color: #fff; + text-decoration: none; + outline: 0; + opacity: .9; } + +.carousel-control-prev { + left: 0; } + +.carousel-control-next { + right: 0; } + +.carousel-control-prev-icon, +.carousel-control-next-icon { + display: inline-block; + width: 20px; + height: 20px; + background: transparent no-repeat center center; + background-size: 100% 100%; } + +.carousel-control-prev-icon { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' fill='%23fff' viewBox='0 0 8 8'%3E%3Cpath d='M5.25 0l-4 4 4 4 1.5-1.5-2.5-2.5 2.5-2.5-1.5-1.5z'/%3E%3C/svg%3E"); } + +.carousel-control-next-icon { + background-image: url("data:image/svg+xml;charset=utf8,%3Csvg xmlns='http://www.w3.org/2000/svg' fill='%23fff' viewBox='0 0 8 8'%3E%3Cpath d='M2.75 0l-1.5 1.5 2.5 2.5-2.5 2.5 1.5 1.5 4-4-4-4z'/%3E%3C/svg%3E"); } + +.carousel-indicators { + position: absolute; + right: 0; + bottom: 10px; + left: 0; + z-index: 15; + display: -webkit-box; + display: -ms-flexbox; + display: flex; + -webkit-box-pack: center; + -ms-flex-pack: center; + justify-content: center; + padding-left: 0; + margin-right: 15%; + margin-left: 15%; + list-style: none; } + .carousel-indicators li { + position: relative; + -webkit-box-flex: 0; + -ms-flex: 0 1 auto; + flex: 0 1 auto; + width: 30px; + height: 3px; + margin-right: 3px; + margin-left: 3px; + text-indent: -999px; + background-color: rgba(255, 255, 255, 0.5); } + .carousel-indicators li::before { + position: absolute; + top: -10px; + left: 0; + display: inline-block; + width: 100%; + height: 10px; + content: ""; } + .carousel-indicators li::after { + position: absolute; + bottom: -10px; + left: 0; + display: inline-block; + width: 100%; + height: 10px; + content: ""; } + .carousel-indicators .active { + background-color: #fff; } + +.carousel-caption { + position: absolute; + right: 15%; + bottom: 20px; + left: 15%; + z-index: 10; + padding-top: 20px; + padding-bottom: 20px; + color: #fff; + text-align: center; } + +.align-baseline { + vertical-align: baseline !important; } + +.align-top { + vertical-align: top !important; } + +.align-middle { + vertical-align: middle !important; } + +.align-bottom { + vertical-align: bottom !important; } + +.align-text-bottom { + vertical-align: text-bottom !important; } + +.align-text-top { + vertical-align: text-top !important; } + +.bg-primary { + background-color: #78d5ef !important; } + +a.bg-primary:hover, a.bg-primary:focus, +button.bg-primary:hover, +button.bg-primary:focus { + background-color: #4ac7ea !important; } + +.bg-secondary { + background-color: #6c757d !important; } + +a.bg-secondary:hover, a.bg-secondary:focus, +button.bg-secondary:hover, +button.bg-secondary:focus { + background-color: #545b62 !important; } + +.bg-success { + background-color: #28a745 !important; } + +a.bg-success:hover, a.bg-success:focus, +button.bg-success:hover, +button.bg-success:focus { + background-color: #1e7e34 !important; } + +.bg-info { + background-color: #17a2b8 !important; } + +a.bg-info:hover, a.bg-info:focus, +button.bg-info:hover, +button.bg-info:focus { + background-color: #117a8b !important; } + +.bg-warning { + background-color: #ffc107 !important; } + +a.bg-warning:hover, a.bg-warning:focus, +button.bg-warning:hover, +button.bg-warning:focus { + background-color: #d39e00 !important; } + +.bg-danger { + background-color: #dc3545 !important; } + +a.bg-danger:hover, a.bg-danger:focus, +button.bg-danger:hover, +button.bg-danger:focus { + background-color: #bd2130 !important; } + +.bg-light { + background-color: #f8f9fa !important; } + +a.bg-light:hover, a.bg-light:focus, +button.bg-light:hover, +button.bg-light:focus { + background-color: #dae0e5 !important; } + +.bg-dark { + background-color: #343a40 !important; } + +a.bg-dark:hover, a.bg-dark:focus, +button.bg-dark:hover, +button.bg-dark:focus { + background-color: #1d2124 !important; } + +.bg-white { + background-color: #fff !important; } + +.bg-transparent { + background-color: transparent !important; } + +.border { + border: 1px solid #dee2e6 !important; } + +.border-top { + border-top: 1px solid #dee2e6 !important; } + +.border-right { + border-right: 1px solid #dee2e6 !important; } + +.border-bottom { + border-bottom: 1px solid #dee2e6 !important; } + +.border-left { + border-left: 1px solid #dee2e6 !important; } + +.border-0 { + border: 0 !important; } + +.border-top-0 { + border-top: 0 !important; } + +.border-right-0 { + border-right: 0 !important; } + +.border-bottom-0 { + border-bottom: 0 !important; } + +.border-left-0 { + border-left: 0 !important; } + +.border-primary { + border-color: #78d5ef !important; } + +.border-secondary { + border-color: #6c757d !important; } + +.border-success { + border-color: #28a745 !important; } + +.border-info { + border-color: #17a2b8 !important; } + +.border-warning { + border-color: #ffc107 !important; } + +.border-danger { + border-color: #dc3545 !important; } + +.border-light { + border-color: #f8f9fa !important; } + +.border-dark { + border-color: #343a40 !important; } + +.border-white { + border-color: #fff !important; } + +.rounded { + border-radius: 0.25rem !important; } + +.rounded-top { + border-top-left-radius: 0.25rem !important; + border-top-right-radius: 0.25rem !important; } + +.rounded-right { + border-top-right-radius: 0.25rem !important; + border-bottom-right-radius: 0.25rem !important; } + +.rounded-bottom { + border-bottom-right-radius: 0.25rem !important; + border-bottom-left-radius: 0.25rem !important; } + +.rounded-left { + border-top-left-radius: 0.25rem !important; + border-bottom-left-radius: 0.25rem !important; } + +.rounded-circle { + border-radius: 50% !important; } + +.rounded-0 { + border-radius: 0 !important; } + +.clearfix::after { + display: block; + clear: both; + content: ""; } + +.d-none { + display: none !important; } + +.d-inline { + display: inline !important; } + +.d-inline-block { + display: inline-block !important; } + +.d-block { + display: block !important; } + +.d-table { + display: table !important; } + +.d-table-row { + display: table-row !important; } + +.d-table-cell { + display: table-cell !important; } + +.d-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + +.d-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } + +@media (min-width: 576px) { + .d-sm-none { + display: none !important; } + .d-sm-inline { + display: inline !important; } + .d-sm-inline-block { + display: inline-block !important; } + .d-sm-block { + display: block !important; } + .d-sm-table { + display: table !important; } + .d-sm-table-row { + display: table-row !important; } + .d-sm-table-cell { + display: table-cell !important; } + .d-sm-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + .d-sm-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } } + +@media (min-width: 768px) { + .d-md-none { + display: none !important; } + .d-md-inline { + display: inline !important; } + .d-md-inline-block { + display: inline-block !important; } + .d-md-block { + display: block !important; } + .d-md-table { + display: table !important; } + .d-md-table-row { + display: table-row !important; } + .d-md-table-cell { + display: table-cell !important; } + .d-md-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + .d-md-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } } + +@media (min-width: 992px) { + .d-lg-none { + display: none !important; } + .d-lg-inline { + display: inline !important; } + .d-lg-inline-block { + display: inline-block !important; } + .d-lg-block { + display: block !important; } + .d-lg-table { + display: table !important; } + .d-lg-table-row { + display: table-row !important; } + .d-lg-table-cell { + display: table-cell !important; } + .d-lg-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + .d-lg-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } } + +@media (min-width: 1200px) { + .d-xl-none { + display: none !important; } + .d-xl-inline { + display: inline !important; } + .d-xl-inline-block { + display: inline-block !important; } + .d-xl-block { + display: block !important; } + .d-xl-table { + display: table !important; } + .d-xl-table-row { + display: table-row !important; } + .d-xl-table-cell { + display: table-cell !important; } + .d-xl-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + .d-xl-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } } + +@media print { + .d-print-none { + display: none !important; } + .d-print-inline { + display: inline !important; } + .d-print-inline-block { + display: inline-block !important; } + .d-print-block { + display: block !important; } + .d-print-table { + display: table !important; } + .d-print-table-row { + display: table-row !important; } + .d-print-table-cell { + display: table-cell !important; } + .d-print-flex { + display: -webkit-box !important; + display: -ms-flexbox !important; + display: flex !important; } + .d-print-inline-flex { + display: -webkit-inline-box !important; + display: -ms-inline-flexbox !important; + display: inline-flex !important; } } + +.embed-responsive { + position: relative; + display: block; + width: 100%; + padding: 0; + overflow: hidden; } + .embed-responsive::before { + display: block; + content: ""; } + .embed-responsive .embed-responsive-item, + .embed-responsive iframe, + .embed-responsive embed, + .embed-responsive object, + .embed-responsive video { + position: absolute; + top: 0; + bottom: 0; + left: 0; + width: 100%; + height: 100%; + border: 0; } + +.embed-responsive-21by9::before { + padding-top: 42.85714%; } + +.embed-responsive-16by9::before { + padding-top: 56.25%; } + +.embed-responsive-4by3::before { + padding-top: 75%; } + +.embed-responsive-1by1::before { + padding-top: 100%; } + +.flex-row { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: row !important; + flex-direction: row !important; } + +.flex-column { + -webkit-box-orient: vertical !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: column !important; + flex-direction: column !important; } + +.flex-row-reverse { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: row-reverse !important; + flex-direction: row-reverse !important; } + +.flex-column-reverse { + -webkit-box-orient: vertical !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: column-reverse !important; + flex-direction: column-reverse !important; } + +.flex-wrap { + -ms-flex-wrap: wrap !important; + flex-wrap: wrap !important; } + +.flex-nowrap { + -ms-flex-wrap: nowrap !important; + flex-wrap: nowrap !important; } + +.flex-wrap-reverse { + -ms-flex-wrap: wrap-reverse !important; + flex-wrap: wrap-reverse !important; } + +.flex-fill { + -webkit-box-flex: 1 !important; + -ms-flex: 1 1 auto !important; + flex: 1 1 auto !important; } + +.flex-grow-0 { + -webkit-box-flex: 0 !important; + -ms-flex-positive: 0 !important; + flex-grow: 0 !important; } + +.flex-grow-1 { + -webkit-box-flex: 1 !important; + -ms-flex-positive: 1 !important; + flex-grow: 1 !important; } + +.flex-shrink-0 { + -ms-flex-negative: 0 !important; + flex-shrink: 0 !important; } + +.flex-shrink-1 { + -ms-flex-negative: 1 !important; + flex-shrink: 1 !important; } + +.justify-content-start { + -webkit-box-pack: start !important; + -ms-flex-pack: start !important; + justify-content: flex-start !important; } + +.justify-content-end { + -webkit-box-pack: end !important; + -ms-flex-pack: end !important; + justify-content: flex-end !important; } + +.justify-content-center { + -webkit-box-pack: center !important; + -ms-flex-pack: center !important; + justify-content: center !important; } + +.justify-content-between { + -webkit-box-pack: justify !important; + -ms-flex-pack: justify !important; + justify-content: space-between !important; } + +.justify-content-around { + -ms-flex-pack: distribute !important; + justify-content: space-around !important; } + +.align-items-start { + -webkit-box-align: start !important; + -ms-flex-align: start !important; + align-items: flex-start !important; } + +.align-items-end { + -webkit-box-align: end !important; + -ms-flex-align: end !important; + align-items: flex-end !important; } + +.align-items-center { + -webkit-box-align: center !important; + -ms-flex-align: center !important; + align-items: center !important; } + +.align-items-baseline { + -webkit-box-align: baseline !important; + -ms-flex-align: baseline !important; + align-items: baseline !important; } + +.align-items-stretch { + -webkit-box-align: stretch !important; + -ms-flex-align: stretch !important; + align-items: stretch !important; } + +.align-content-start { + -ms-flex-line-pack: start !important; + align-content: flex-start !important; } + +.align-content-end { + -ms-flex-line-pack: end !important; + align-content: flex-end !important; } + +.align-content-center { + -ms-flex-line-pack: center !important; + align-content: center !important; } + +.align-content-between { + -ms-flex-line-pack: justify !important; + align-content: space-between !important; } + +.align-content-around { + -ms-flex-line-pack: distribute !important; + align-content: space-around !important; } + +.align-content-stretch { + -ms-flex-line-pack: stretch !important; + align-content: stretch !important; } + +.align-self-auto { + -ms-flex-item-align: auto !important; + align-self: auto !important; } + +.align-self-start { + -ms-flex-item-align: start !important; + align-self: flex-start !important; } + +.align-self-end { + -ms-flex-item-align: end !important; + align-self: flex-end !important; } + +.align-self-center { + -ms-flex-item-align: center !important; + align-self: center !important; } + +.align-self-baseline { + -ms-flex-item-align: baseline !important; + align-self: baseline !important; } + +.align-self-stretch { + -ms-flex-item-align: stretch !important; + align-self: stretch !important; } + +@media (min-width: 576px) { + .flex-sm-row { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: row !important; + flex-direction: row !important; } + .flex-sm-column { + -webkit-box-orient: vertical !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: column !important; + flex-direction: column !important; } + .flex-sm-row-reverse { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: row-reverse !important; + flex-direction: row-reverse !important; } + .flex-sm-column-reverse { + -webkit-box-orient: vertical !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: column-reverse !important; + flex-direction: column-reverse !important; } + .flex-sm-wrap { + -ms-flex-wrap: wrap !important; + flex-wrap: wrap !important; } + .flex-sm-nowrap { + -ms-flex-wrap: nowrap !important; + flex-wrap: nowrap !important; } + .flex-sm-wrap-reverse { + -ms-flex-wrap: wrap-reverse !important; + flex-wrap: wrap-reverse !important; } + .flex-sm-fill { + -webkit-box-flex: 1 !important; + -ms-flex: 1 1 auto !important; + flex: 1 1 auto !important; } + .flex-sm-grow-0 { + -webkit-box-flex: 0 !important; + -ms-flex-positive: 0 !important; + flex-grow: 0 !important; } + .flex-sm-grow-1 { + -webkit-box-flex: 1 !important; + -ms-flex-positive: 1 !important; + flex-grow: 1 !important; } + .flex-sm-shrink-0 { + -ms-flex-negative: 0 !important; + flex-shrink: 0 !important; } + .flex-sm-shrink-1 { + -ms-flex-negative: 1 !important; + flex-shrink: 1 !important; } + .justify-content-sm-start { + -webkit-box-pack: start !important; + -ms-flex-pack: start !important; + justify-content: flex-start !important; } + .justify-content-sm-end { + -webkit-box-pack: end !important; + -ms-flex-pack: end !important; + justify-content: flex-end !important; } + .justify-content-sm-center { + -webkit-box-pack: center !important; + -ms-flex-pack: center !important; + justify-content: center !important; } + .justify-content-sm-between { + -webkit-box-pack: justify !important; + -ms-flex-pack: justify !important; + justify-content: space-between !important; } + .justify-content-sm-around { + -ms-flex-pack: distribute !important; + justify-content: space-around !important; } + .align-items-sm-start { + -webkit-box-align: start !important; + -ms-flex-align: start !important; + align-items: flex-start !important; } + .align-items-sm-end { + -webkit-box-align: end !important; + -ms-flex-align: end !important; + align-items: flex-end !important; } + .align-items-sm-center { + -webkit-box-align: center !important; + -ms-flex-align: center !important; + align-items: center !important; } + .align-items-sm-baseline { + -webkit-box-align: baseline !important; + -ms-flex-align: baseline !important; + align-items: baseline !important; } + .align-items-sm-stretch { + -webkit-box-align: stretch !important; + -ms-flex-align: stretch !important; + align-items: stretch !important; } + .align-content-sm-start { + -ms-flex-line-pack: start !important; + align-content: flex-start !important; } + .align-content-sm-end { + -ms-flex-line-pack: end !important; + align-content: flex-end !important; } + .align-content-sm-center { + -ms-flex-line-pack: center !important; + align-content: center !important; } + .align-content-sm-between { + -ms-flex-line-pack: justify !important; + align-content: space-between !important; } + .align-content-sm-around { + -ms-flex-line-pack: distribute !important; + align-content: space-around !important; } + .align-content-sm-stretch { + -ms-flex-line-pack: stretch !important; + align-content: stretch !important; } + .align-self-sm-auto { + -ms-flex-item-align: auto !important; + align-self: auto !important; } + .align-self-sm-start { + -ms-flex-item-align: start !important; + align-self: flex-start !important; } + .align-self-sm-end { + -ms-flex-item-align: end !important; + align-self: flex-end !important; } + .align-self-sm-center { + -ms-flex-item-align: center !important; + align-self: center !important; } + .align-self-sm-baseline { + -ms-flex-item-align: baseline !important; + align-self: baseline !important; } + .align-self-sm-stretch { + -ms-flex-item-align: stretch !important; + align-self: stretch !important; } } + +@media (min-width: 768px) { + .flex-md-row { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: row !important; + flex-direction: row !important; } + .flex-md-column { + -webkit-box-orient: vertical !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: column !important; + flex-direction: column !important; } + .flex-md-row-reverse { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: row-reverse !important; + flex-direction: row-reverse !important; } + .flex-md-column-reverse { + -webkit-box-orient: vertical !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: column-reverse !important; + flex-direction: column-reverse !important; } + .flex-md-wrap { + -ms-flex-wrap: wrap !important; + flex-wrap: wrap !important; } + .flex-md-nowrap { + -ms-flex-wrap: nowrap !important; + flex-wrap: nowrap !important; } + .flex-md-wrap-reverse { + -ms-flex-wrap: wrap-reverse !important; + flex-wrap: wrap-reverse !important; } + .flex-md-fill { + -webkit-box-flex: 1 !important; + -ms-flex: 1 1 auto !important; + flex: 1 1 auto !important; } + .flex-md-grow-0 { + -webkit-box-flex: 0 !important; + -ms-flex-positive: 0 !important; + flex-grow: 0 !important; } + .flex-md-grow-1 { + -webkit-box-flex: 1 !important; + -ms-flex-positive: 1 !important; + flex-grow: 1 !important; } + .flex-md-shrink-0 { + -ms-flex-negative: 0 !important; + flex-shrink: 0 !important; } + .flex-md-shrink-1 { + -ms-flex-negative: 1 !important; + flex-shrink: 1 !important; } + .justify-content-md-start { + -webkit-box-pack: start !important; + -ms-flex-pack: start !important; + justify-content: flex-start !important; } + .justify-content-md-end { + -webkit-box-pack: end !important; + -ms-flex-pack: end !important; + justify-content: flex-end !important; } + .justify-content-md-center { + -webkit-box-pack: center !important; + -ms-flex-pack: center !important; + justify-content: center !important; } + .justify-content-md-between { + -webkit-box-pack: justify !important; + -ms-flex-pack: justify !important; + justify-content: space-between !important; } + .justify-content-md-around { + -ms-flex-pack: distribute !important; + justify-content: space-around !important; } + .align-items-md-start { + -webkit-box-align: start !important; + -ms-flex-align: start !important; + align-items: flex-start !important; } + .align-items-md-end { + -webkit-box-align: end !important; + -ms-flex-align: end !important; + align-items: flex-end !important; } + .align-items-md-center { + -webkit-box-align: center !important; + -ms-flex-align: center !important; + align-items: center !important; } + .align-items-md-baseline { + -webkit-box-align: baseline !important; + -ms-flex-align: baseline !important; + align-items: baseline !important; } + .align-items-md-stretch { + -webkit-box-align: stretch !important; + -ms-flex-align: stretch !important; + align-items: stretch !important; } + .align-content-md-start { + -ms-flex-line-pack: start !important; + align-content: flex-start !important; } + .align-content-md-end { + -ms-flex-line-pack: end !important; + align-content: flex-end !important; } + .align-content-md-center { + -ms-flex-line-pack: center !important; + align-content: center !important; } + .align-content-md-between { + -ms-flex-line-pack: justify !important; + align-content: space-between !important; } + .align-content-md-around { + -ms-flex-line-pack: distribute !important; + align-content: space-around !important; } + .align-content-md-stretch { + -ms-flex-line-pack: stretch !important; + align-content: stretch !important; } + .align-self-md-auto { + -ms-flex-item-align: auto !important; + align-self: auto !important; } + .align-self-md-start { + -ms-flex-item-align: start !important; + align-self: flex-start !important; } + .align-self-md-end { + -ms-flex-item-align: end !important; + align-self: flex-end !important; } + .align-self-md-center { + -ms-flex-item-align: center !important; + align-self: center !important; } + .align-self-md-baseline { + -ms-flex-item-align: baseline !important; + align-self: baseline !important; } + .align-self-md-stretch { + -ms-flex-item-align: stretch !important; + align-self: stretch !important; } } + +@media (min-width: 992px) { + .flex-lg-row { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: row !important; + flex-direction: row !important; } + .flex-lg-column { + -webkit-box-orient: vertical !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: column !important; + flex-direction: column !important; } + .flex-lg-row-reverse { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: row-reverse !important; + flex-direction: row-reverse !important; } + .flex-lg-column-reverse { + -webkit-box-orient: vertical !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: column-reverse !important; + flex-direction: column-reverse !important; } + .flex-lg-wrap { + -ms-flex-wrap: wrap !important; + flex-wrap: wrap !important; } + .flex-lg-nowrap { + -ms-flex-wrap: nowrap !important; + flex-wrap: nowrap !important; } + .flex-lg-wrap-reverse { + -ms-flex-wrap: wrap-reverse !important; + flex-wrap: wrap-reverse !important; } + .flex-lg-fill { + -webkit-box-flex: 1 !important; + -ms-flex: 1 1 auto !important; + flex: 1 1 auto !important; } + .flex-lg-grow-0 { + -webkit-box-flex: 0 !important; + -ms-flex-positive: 0 !important; + flex-grow: 0 !important; } + .flex-lg-grow-1 { + -webkit-box-flex: 1 !important; + -ms-flex-positive: 1 !important; + flex-grow: 1 !important; } + .flex-lg-shrink-0 { + -ms-flex-negative: 0 !important; + flex-shrink: 0 !important; } + .flex-lg-shrink-1 { + -ms-flex-negative: 1 !important; + flex-shrink: 1 !important; } + .justify-content-lg-start { + -webkit-box-pack: start !important; + -ms-flex-pack: start !important; + justify-content: flex-start !important; } + .justify-content-lg-end { + -webkit-box-pack: end !important; + -ms-flex-pack: end !important; + justify-content: flex-end !important; } + .justify-content-lg-center { + -webkit-box-pack: center !important; + -ms-flex-pack: center !important; + justify-content: center !important; } + .justify-content-lg-between { + -webkit-box-pack: justify !important; + -ms-flex-pack: justify !important; + justify-content: space-between !important; } + .justify-content-lg-around { + -ms-flex-pack: distribute !important; + justify-content: space-around !important; } + .align-items-lg-start { + -webkit-box-align: start !important; + -ms-flex-align: start !important; + align-items: flex-start !important; } + .align-items-lg-end { + -webkit-box-align: end !important; + -ms-flex-align: end !important; + align-items: flex-end !important; } + .align-items-lg-center { + -webkit-box-align: center !important; + -ms-flex-align: center !important; + align-items: center !important; } + .align-items-lg-baseline { + -webkit-box-align: baseline !important; + -ms-flex-align: baseline !important; + align-items: baseline !important; } + .align-items-lg-stretch { + -webkit-box-align: stretch !important; + -ms-flex-align: stretch !important; + align-items: stretch !important; } + .align-content-lg-start { + -ms-flex-line-pack: start !important; + align-content: flex-start !important; } + .align-content-lg-end { + -ms-flex-line-pack: end !important; + align-content: flex-end !important; } + .align-content-lg-center { + -ms-flex-line-pack: center !important; + align-content: center !important; } + .align-content-lg-between { + -ms-flex-line-pack: justify !important; + align-content: space-between !important; } + .align-content-lg-around { + -ms-flex-line-pack: distribute !important; + align-content: space-around !important; } + .align-content-lg-stretch { + -ms-flex-line-pack: stretch !important; + align-content: stretch !important; } + .align-self-lg-auto { + -ms-flex-item-align: auto !important; + align-self: auto !important; } + .align-self-lg-start { + -ms-flex-item-align: start !important; + align-self: flex-start !important; } + .align-self-lg-end { + -ms-flex-item-align: end !important; + align-self: flex-end !important; } + .align-self-lg-center { + -ms-flex-item-align: center !important; + align-self: center !important; } + .align-self-lg-baseline { + -ms-flex-item-align: baseline !important; + align-self: baseline !important; } + .align-self-lg-stretch { + -ms-flex-item-align: stretch !important; + align-self: stretch !important; } } + +@media (min-width: 1200px) { + .flex-xl-row { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: row !important; + flex-direction: row !important; } + .flex-xl-column { + -webkit-box-orient: vertical !important; + -webkit-box-direction: normal !important; + -ms-flex-direction: column !important; + flex-direction: column !important; } + .flex-xl-row-reverse { + -webkit-box-orient: horizontal !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: row-reverse !important; + flex-direction: row-reverse !important; } + .flex-xl-column-reverse { + -webkit-box-orient: vertical !important; + -webkit-box-direction: reverse !important; + -ms-flex-direction: column-reverse !important; + flex-direction: column-reverse !important; } + .flex-xl-wrap { + -ms-flex-wrap: wrap !important; + flex-wrap: wrap !important; } + .flex-xl-nowrap { + -ms-flex-wrap: nowrap !important; + flex-wrap: nowrap !important; } + .flex-xl-wrap-reverse { + -ms-flex-wrap: wrap-reverse !important; + flex-wrap: wrap-reverse !important; } + .flex-xl-fill { + -webkit-box-flex: 1 !important; + -ms-flex: 1 1 auto !important; + flex: 1 1 auto !important; } + .flex-xl-grow-0 { + -webkit-box-flex: 0 !important; + -ms-flex-positive: 0 !important; + flex-grow: 0 !important; } + .flex-xl-grow-1 { + -webkit-box-flex: 1 !important; + -ms-flex-positive: 1 !important; + flex-grow: 1 !important; } + .flex-xl-shrink-0 { + -ms-flex-negative: 0 !important; + flex-shrink: 0 !important; } + .flex-xl-shrink-1 { + -ms-flex-negative: 1 !important; + flex-shrink: 1 !important; } + .justify-content-xl-start { + -webkit-box-pack: start !important; + -ms-flex-pack: start !important; + justify-content: flex-start !important; } + .justify-content-xl-end { + -webkit-box-pack: end !important; + -ms-flex-pack: end !important; + justify-content: flex-end !important; } + .justify-content-xl-center { + -webkit-box-pack: center !important; + -ms-flex-pack: center !important; + justify-content: center !important; } + .justify-content-xl-between { + -webkit-box-pack: justify !important; + -ms-flex-pack: justify !important; + justify-content: space-between !important; } + .justify-content-xl-around { + -ms-flex-pack: distribute !important; + justify-content: space-around !important; } + .align-items-xl-start { + -webkit-box-align: start !important; + -ms-flex-align: start !important; + align-items: flex-start !important; } + .align-items-xl-end { + -webkit-box-align: end !important; + -ms-flex-align: end !important; + align-items: flex-end !important; } + .align-items-xl-center { + -webkit-box-align: center !important; + -ms-flex-align: center !important; + align-items: center !important; } + .align-items-xl-baseline { + -webkit-box-align: baseline !important; + -ms-flex-align: baseline !important; + align-items: baseline !important; } + .align-items-xl-stretch { + -webkit-box-align: stretch !important; + -ms-flex-align: stretch !important; + align-items: stretch !important; } + .align-content-xl-start { + -ms-flex-line-pack: start !important; + align-content: flex-start !important; } + .align-content-xl-end { + -ms-flex-line-pack: end !important; + align-content: flex-end !important; } + .align-content-xl-center { + -ms-flex-line-pack: center !important; + align-content: center !important; } + .align-content-xl-between { + -ms-flex-line-pack: justify !important; + align-content: space-between !important; } + .align-content-xl-around { + -ms-flex-line-pack: distribute !important; + align-content: space-around !important; } + .align-content-xl-stretch { + -ms-flex-line-pack: stretch !important; + align-content: stretch !important; } + .align-self-xl-auto { + -ms-flex-item-align: auto !important; + align-self: auto !important; } + .align-self-xl-start { + -ms-flex-item-align: start !important; + align-self: flex-start !important; } + .align-self-xl-end { + -ms-flex-item-align: end !important; + align-self: flex-end !important; } + .align-self-xl-center { + -ms-flex-item-align: center !important; + align-self: center !important; } + .align-self-xl-baseline { + -ms-flex-item-align: baseline !important; + align-self: baseline !important; } + .align-self-xl-stretch { + -ms-flex-item-align: stretch !important; + align-self: stretch !important; } } + +.float-left { + float: left !important; } + +.float-right { + float: right !important; } + +.float-none { + float: none !important; } + +@media (min-width: 576px) { + .float-sm-left { + float: left !important; } + .float-sm-right { + float: right !important; } + .float-sm-none { + float: none !important; } } + +@media (min-width: 768px) { + .float-md-left { + float: left !important; } + .float-md-right { + float: right !important; } + .float-md-none { + float: none !important; } } + +@media (min-width: 992px) { + .float-lg-left { + float: left !important; } + .float-lg-right { + float: right !important; } + .float-lg-none { + float: none !important; } } + +@media (min-width: 1200px) { + .float-xl-left { + float: left !important; } + .float-xl-right { + float: right !important; } + .float-xl-none { + float: none !important; } } + +.position-static { + position: static !important; } + +.position-relative { + position: relative !important; } + +.position-absolute { + position: absolute !important; } + +.position-fixed { + position: fixed !important; } + +.position-sticky { + position: -webkit-sticky !important; + position: sticky !important; } + +.fixed-top { + position: fixed; + top: 0; + right: 0; + left: 0; + z-index: 1030; } + +.fixed-bottom { + position: fixed; + right: 0; + bottom: 0; + left: 0; + z-index: 1030; } + +@supports ((position: -webkit-sticky) or (position: sticky)) { + .sticky-top { + position: -webkit-sticky; + position: sticky; + top: 0; + z-index: 1020; } } + +.sr-only { + position: absolute; + width: 1px; + height: 1px; + padding: 0; + overflow: hidden; + clip: rect(0, 0, 0, 0); + white-space: nowrap; + border: 0; } + +.sr-only-focusable:active, .sr-only-focusable:focus { + position: static; + width: auto; + height: auto; + overflow: visible; + clip: auto; + white-space: normal; } + +.shadow-sm { + -webkit-box-shadow: 0 0.125rem 0.25rem rgba(0, 0, 0, 0.075) !important; + box-shadow: 0 0.125rem 0.25rem rgba(0, 0, 0, 0.075) !important; } + +.shadow { + -webkit-box-shadow: 0 0.5rem 1rem rgba(0, 0, 0, 0.15) !important; + box-shadow: 0 0.5rem 1rem rgba(0, 0, 0, 0.15) !important; } + +.shadow-lg { + -webkit-box-shadow: 0 1rem 3rem rgba(0, 0, 0, 0.175) !important; + box-shadow: 0 1rem 3rem rgba(0, 0, 0, 0.175) !important; } + +.shadow-none { + -webkit-box-shadow: none !important; + box-shadow: none !important; } + +.w-25 { + width: 25% !important; } + +.w-50 { + width: 50% !important; } + +.w-75 { + width: 75% !important; } + +.w-100 { + width: 100% !important; } + +.w-auto { + width: auto !important; } + +.h-25 { + height: 25% !important; } + +.h-50 { + height: 50% !important; } + +.h-75 { + height: 75% !important; } + +.h-100 { + height: 100% !important; } + +.h-auto { + height: auto !important; } + +.mw-100 { + max-width: 100% !important; } + +.mh-100 { + max-height: 100% !important; } + +.m-0 { + margin: 0 !important; } + +.mt-0, +.my-0 { + margin-top: 0 !important; } + +.mr-0, +.mx-0 { + margin-right: 0 !important; } + +.mb-0, +.my-0 { + margin-bottom: 0 !important; } + +.ml-0, +.mx-0 { + margin-left: 0 !important; } + +.m-1 { + margin: 0.25rem !important; } + +.mt-1, +.my-1 { + margin-top: 0.25rem !important; } + +.mr-1, +.mx-1 { + margin-right: 0.25rem !important; } + +.mb-1, +.my-1 { + margin-bottom: 0.25rem !important; } + +.ml-1, +.mx-1 { + margin-left: 0.25rem !important; } + +.m-2 { + margin: 0.5rem !important; } + +.mt-2, +.my-2 { + margin-top: 0.5rem !important; } + +.mr-2, +.mx-2 { + margin-right: 0.5rem !important; } + +.mb-2, +.my-2 { + margin-bottom: 0.5rem !important; } + +.ml-2, +.mx-2 { + margin-left: 0.5rem !important; } + +.m-3 { + margin: 1rem !important; } + +.mt-3, +.my-3 { + margin-top: 1rem !important; } + +.mr-3, +.mx-3 { + margin-right: 1rem !important; } + +.mb-3, +.my-3 { + margin-bottom: 1rem !important; } + +.ml-3, +.mx-3 { + margin-left: 1rem !important; } + +.m-4 { + margin: 1.5rem !important; } + +.mt-4, +.my-4 { + margin-top: 1.5rem !important; } + +.mr-4, +.mx-4 { + margin-right: 1.5rem !important; } + +.mb-4, +.my-4 { + margin-bottom: 1.5rem !important; } + +.ml-4, +.mx-4 { + margin-left: 1.5rem !important; } + +.m-5 { + margin: 3rem !important; } + +.mt-5, +.my-5 { + margin-top: 3rem !important; } + +.mr-5, +.mx-5 { + margin-right: 3rem !important; } + +.mb-5, +.my-5 { + margin-bottom: 3rem !important; } + +.ml-5, +.mx-5 { + margin-left: 3rem !important; } + +.p-0 { + padding: 0 !important; } + +.pt-0, +.py-0 { + padding-top: 0 !important; } + +.pr-0, +.px-0 { + padding-right: 0 !important; } + +.pb-0, +.py-0 { + padding-bottom: 0 !important; } + +.pl-0, +.px-0 { + padding-left: 0 !important; } + +.p-1 { + padding: 0.25rem !important; } + +.pt-1, +.py-1 { + padding-top: 0.25rem !important; } + +.pr-1, +.px-1 { + padding-right: 0.25rem !important; } + +.pb-1, +.py-1 { + padding-bottom: 0.25rem !important; } + +.pl-1, +.px-1 { + padding-left: 0.25rem !important; } + +.p-2 { + padding: 0.5rem !important; } + +.pt-2, +.py-2 { + padding-top: 0.5rem !important; } + +.pr-2, +.px-2 { + padding-right: 0.5rem !important; } + +.pb-2, +.py-2 { + padding-bottom: 0.5rem !important; } + +.pl-2, +.px-2 { + padding-left: 0.5rem !important; } + +.p-3 { + padding: 1rem !important; } + +.pt-3, +.py-3 { + padding-top: 1rem !important; } + +.pr-3, +.px-3 { + padding-right: 1rem !important; } + +.pb-3, +.py-3 { + padding-bottom: 1rem !important; } + +.pl-3, +.px-3 { + padding-left: 1rem !important; } + +.p-4 { + padding: 1.5rem !important; } + +.pt-4, +.py-4 { + padding-top: 1.5rem !important; } + +.pr-4, +.px-4 { + padding-right: 1.5rem !important; } + +.pb-4, +.py-4 { + padding-bottom: 1.5rem !important; } + +.pl-4, +.px-4 { + padding-left: 1.5rem !important; } + +.p-5 { + padding: 3rem !important; } + +.pt-5, +.py-5 { + padding-top: 3rem !important; } + +.pr-5, +.px-5 { + padding-right: 3rem !important; } + +.pb-5, +.py-5 { + padding-bottom: 3rem !important; } + +.pl-5, +.px-5 { + padding-left: 3rem !important; } + +.m-auto { + margin: auto !important; } + +.mt-auto, +.my-auto { + margin-top: auto !important; } + +.mr-auto, +.mx-auto { + margin-right: auto !important; } + +.mb-auto, +.my-auto { + margin-bottom: auto !important; } + +.ml-auto, +.mx-auto { + margin-left: auto !important; } + +@media (min-width: 576px) { + .m-sm-0 { + margin: 0 !important; } + .mt-sm-0, + .my-sm-0 { + margin-top: 0 !important; } + .mr-sm-0, + .mx-sm-0 { + margin-right: 0 !important; } + .mb-sm-0, + .my-sm-0 { + margin-bottom: 0 !important; } + .ml-sm-0, + .mx-sm-0 { + margin-left: 0 !important; } + .m-sm-1 { + margin: 0.25rem !important; } + .mt-sm-1, + .my-sm-1 { + margin-top: 0.25rem !important; } + .mr-sm-1, + .mx-sm-1 { + margin-right: 0.25rem !important; } + .mb-sm-1, + .my-sm-1 { + margin-bottom: 0.25rem !important; } + .ml-sm-1, + .mx-sm-1 { + margin-left: 0.25rem !important; } + .m-sm-2 { + margin: 0.5rem !important; } + .mt-sm-2, + .my-sm-2 { + margin-top: 0.5rem !important; } + .mr-sm-2, + .mx-sm-2 { + margin-right: 0.5rem !important; } + .mb-sm-2, + .my-sm-2 { + margin-bottom: 0.5rem !important; } + .ml-sm-2, + .mx-sm-2 { + margin-left: 0.5rem !important; } + .m-sm-3 { + margin: 1rem !important; } + .mt-sm-3, + .my-sm-3 { + margin-top: 1rem !important; } + .mr-sm-3, + .mx-sm-3 { + margin-right: 1rem !important; } + .mb-sm-3, + .my-sm-3 { + margin-bottom: 1rem !important; } + .ml-sm-3, + .mx-sm-3 { + margin-left: 1rem !important; } + .m-sm-4 { + margin: 1.5rem !important; } + .mt-sm-4, + .my-sm-4 { + margin-top: 1.5rem !important; } + .mr-sm-4, + .mx-sm-4 { + margin-right: 1.5rem !important; } + .mb-sm-4, + .my-sm-4 { + margin-bottom: 1.5rem !important; } + .ml-sm-4, + .mx-sm-4 { + margin-left: 1.5rem !important; } + .m-sm-5 { + margin: 3rem !important; } + .mt-sm-5, + .my-sm-5 { + margin-top: 3rem !important; } + .mr-sm-5, + .mx-sm-5 { + margin-right: 3rem !important; } + .mb-sm-5, + .my-sm-5 { + margin-bottom: 3rem !important; } + .ml-sm-5, + .mx-sm-5 { + margin-left: 3rem !important; } + .p-sm-0 { + padding: 0 !important; } + .pt-sm-0, + .py-sm-0 { + padding-top: 0 !important; } + .pr-sm-0, + .px-sm-0 { + padding-right: 0 !important; } + .pb-sm-0, + .py-sm-0 { + padding-bottom: 0 !important; } + .pl-sm-0, + .px-sm-0 { + padding-left: 0 !important; } + .p-sm-1 { + padding: 0.25rem !important; } + .pt-sm-1, + .py-sm-1 { + padding-top: 0.25rem !important; } + .pr-sm-1, + .px-sm-1 { + padding-right: 0.25rem !important; } + .pb-sm-1, + .py-sm-1 { + padding-bottom: 0.25rem !important; } + .pl-sm-1, + .px-sm-1 { + padding-left: 0.25rem !important; } + .p-sm-2 { + padding: 0.5rem !important; } + .pt-sm-2, + .py-sm-2 { + padding-top: 0.5rem !important; } + .pr-sm-2, + .px-sm-2 { + padding-right: 0.5rem !important; } + .pb-sm-2, + .py-sm-2 { + padding-bottom: 0.5rem !important; } + .pl-sm-2, + .px-sm-2 { + padding-left: 0.5rem !important; } + .p-sm-3 { + padding: 1rem !important; } + .pt-sm-3, + .py-sm-3 { + padding-top: 1rem !important; } + .pr-sm-3, + .px-sm-3 { + padding-right: 1rem !important; } + .pb-sm-3, + .py-sm-3 { + padding-bottom: 1rem !important; } + .pl-sm-3, + .px-sm-3 { + padding-left: 1rem !important; } + .p-sm-4 { + padding: 1.5rem !important; } + .pt-sm-4, + .py-sm-4 { + padding-top: 1.5rem !important; } + .pr-sm-4, + .px-sm-4 { + padding-right: 1.5rem !important; } + .pb-sm-4, + .py-sm-4 { + padding-bottom: 1.5rem !important; } + .pl-sm-4, + .px-sm-4 { + padding-left: 1.5rem !important; } + .p-sm-5 { + padding: 3rem !important; } + .pt-sm-5, + .py-sm-5 { + padding-top: 3rem !important; } + .pr-sm-5, + .px-sm-5 { + padding-right: 3rem !important; } + .pb-sm-5, + .py-sm-5 { + padding-bottom: 3rem !important; } + .pl-sm-5, + .px-sm-5 { + padding-left: 3rem !important; } + .m-sm-auto { + margin: auto !important; } + .mt-sm-auto, + .my-sm-auto { + margin-top: auto !important; } + .mr-sm-auto, + .mx-sm-auto { + margin-right: auto !important; } + .mb-sm-auto, + .my-sm-auto { + margin-bottom: auto !important; } + .ml-sm-auto, + .mx-sm-auto { + margin-left: auto !important; } } + +@media (min-width: 768px) { + .m-md-0 { + margin: 0 !important; } + .mt-md-0, + .my-md-0 { + margin-top: 0 !important; } + .mr-md-0, + .mx-md-0 { + margin-right: 0 !important; } + .mb-md-0, + .my-md-0 { + margin-bottom: 0 !important; } + .ml-md-0, + .mx-md-0 { + margin-left: 0 !important; } + .m-md-1 { + margin: 0.25rem !important; } + .mt-md-1, + .my-md-1 { + margin-top: 0.25rem !important; } + .mr-md-1, + .mx-md-1 { + margin-right: 0.25rem !important; } + .mb-md-1, + .my-md-1 { + margin-bottom: 0.25rem !important; } + .ml-md-1, + .mx-md-1 { + margin-left: 0.25rem !important; } + .m-md-2 { + margin: 0.5rem !important; } + .mt-md-2, + .my-md-2 { + margin-top: 0.5rem !important; } + .mr-md-2, + .mx-md-2 { + margin-right: 0.5rem !important; } + .mb-md-2, + .my-md-2 { + margin-bottom: 0.5rem !important; } + .ml-md-2, + .mx-md-2 { + margin-left: 0.5rem !important; } + .m-md-3 { + margin: 1rem !important; } + .mt-md-3, + .my-md-3 { + margin-top: 1rem !important; } + .mr-md-3, + .mx-md-3 { + margin-right: 1rem !important; } + .mb-md-3, + .my-md-3 { + margin-bottom: 1rem !important; } + .ml-md-3, + .mx-md-3 { + margin-left: 1rem !important; } + .m-md-4 { + margin: 1.5rem !important; } + .mt-md-4, + .my-md-4 { + margin-top: 1.5rem !important; } + .mr-md-4, + .mx-md-4 { + margin-right: 1.5rem !important; } + .mb-md-4, + .my-md-4 { + margin-bottom: 1.5rem !important; } + .ml-md-4, + .mx-md-4 { + margin-left: 1.5rem !important; } + .m-md-5 { + margin: 3rem !important; } + .mt-md-5, + .my-md-5 { + margin-top: 3rem !important; } + .mr-md-5, + .mx-md-5 { + margin-right: 3rem !important; } + .mb-md-5, + .my-md-5 { + margin-bottom: 3rem !important; } + .ml-md-5, + .mx-md-5 { + margin-left: 3rem !important; } + .p-md-0 { + padding: 0 !important; } + .pt-md-0, + .py-md-0 { + padding-top: 0 !important; } + .pr-md-0, + .px-md-0 { + padding-right: 0 !important; } + .pb-md-0, + .py-md-0 { + padding-bottom: 0 !important; } + .pl-md-0, + .px-md-0 { + padding-left: 0 !important; } + .p-md-1 { + padding: 0.25rem !important; } + .pt-md-1, + .py-md-1 { + padding-top: 0.25rem !important; } + .pr-md-1, + .px-md-1 { + padding-right: 0.25rem !important; } + .pb-md-1, + .py-md-1 { + padding-bottom: 0.25rem !important; } + .pl-md-1, + .px-md-1 { + padding-left: 0.25rem !important; } + .p-md-2 { + padding: 0.5rem !important; } + .pt-md-2, + .py-md-2 { + padding-top: 0.5rem !important; } + .pr-md-2, + .px-md-2 { + padding-right: 0.5rem !important; } + .pb-md-2, + .py-md-2 { + padding-bottom: 0.5rem !important; } + .pl-md-2, + .px-md-2 { + padding-left: 0.5rem !important; } + .p-md-3 { + padding: 1rem !important; } + .pt-md-3, + .py-md-3 { + padding-top: 1rem !important; } + .pr-md-3, + .px-md-3 { + padding-right: 1rem !important; } + .pb-md-3, + .py-md-3 { + padding-bottom: 1rem !important; } + .pl-md-3, + .px-md-3 { + padding-left: 1rem !important; } + .p-md-4 { + padding: 1.5rem !important; } + .pt-md-4, + .py-md-4 { + padding-top: 1.5rem !important; } + .pr-md-4, + .px-md-4 { + padding-right: 1.5rem !important; } + .pb-md-4, + .py-md-4 { + padding-bottom: 1.5rem !important; } + .pl-md-4, + .px-md-4 { + padding-left: 1.5rem !important; } + .p-md-5 { + padding: 3rem !important; } + .pt-md-5, + .py-md-5 { + padding-top: 3rem !important; } + .pr-md-5, + .px-md-5 { + padding-right: 3rem !important; } + .pb-md-5, + .py-md-5 { + padding-bottom: 3rem !important; } + .pl-md-5, + .px-md-5 { + padding-left: 3rem !important; } + .m-md-auto { + margin: auto !important; } + .mt-md-auto, + .my-md-auto { + margin-top: auto !important; } + .mr-md-auto, + .mx-md-auto { + margin-right: auto !important; } + .mb-md-auto, + .my-md-auto { + margin-bottom: auto !important; } + .ml-md-auto, + .mx-md-auto { + margin-left: auto !important; } } + +@media (min-width: 992px) { + .m-lg-0 { + margin: 0 !important; } + .mt-lg-0, + .my-lg-0 { + margin-top: 0 !important; } + .mr-lg-0, + .mx-lg-0 { + margin-right: 0 !important; } + .mb-lg-0, + .my-lg-0 { + margin-bottom: 0 !important; } + .ml-lg-0, + .mx-lg-0 { + margin-left: 0 !important; } + .m-lg-1 { + margin: 0.25rem !important; } + .mt-lg-1, + .my-lg-1 { + margin-top: 0.25rem !important; } + .mr-lg-1, + .mx-lg-1 { + margin-right: 0.25rem !important; } + .mb-lg-1, + .my-lg-1 { + margin-bottom: 0.25rem !important; } + .ml-lg-1, + .mx-lg-1 { + margin-left: 0.25rem !important; } + .m-lg-2 { + margin: 0.5rem !important; } + .mt-lg-2, + .my-lg-2 { + margin-top: 0.5rem !important; } + .mr-lg-2, + .mx-lg-2 { + margin-right: 0.5rem !important; } + .mb-lg-2, + .my-lg-2 { + margin-bottom: 0.5rem !important; } + .ml-lg-2, + .mx-lg-2 { + margin-left: 0.5rem !important; } + .m-lg-3 { + margin: 1rem !important; } + .mt-lg-3, + .my-lg-3 { + margin-top: 1rem !important; } + .mr-lg-3, + .mx-lg-3 { + margin-right: 1rem !important; } + .mb-lg-3, + .my-lg-3 { + margin-bottom: 1rem !important; } + .ml-lg-3, + .mx-lg-3 { + margin-left: 1rem !important; } + .m-lg-4 { + margin: 1.5rem !important; } + .mt-lg-4, + .my-lg-4 { + margin-top: 1.5rem !important; } + .mr-lg-4, + .mx-lg-4 { + margin-right: 1.5rem !important; } + .mb-lg-4, + .my-lg-4 { + margin-bottom: 1.5rem !important; } + .ml-lg-4, + .mx-lg-4 { + margin-left: 1.5rem !important; } + .m-lg-5 { + margin: 3rem !important; } + .mt-lg-5, + .my-lg-5 { + margin-top: 3rem !important; } + .mr-lg-5, + .mx-lg-5 { + margin-right: 3rem !important; } + .mb-lg-5, + .my-lg-5 { + margin-bottom: 3rem !important; } + .ml-lg-5, + .mx-lg-5 { + margin-left: 3rem !important; } + .p-lg-0 { + padding: 0 !important; } + .pt-lg-0, + .py-lg-0 { + padding-top: 0 !important; } + .pr-lg-0, + .px-lg-0 { + padding-right: 0 !important; } + .pb-lg-0, + .py-lg-0 { + padding-bottom: 0 !important; } + .pl-lg-0, + .px-lg-0 { + padding-left: 0 !important; } + .p-lg-1 { + padding: 0.25rem !important; } + .pt-lg-1, + .py-lg-1 { + padding-top: 0.25rem !important; } + .pr-lg-1, + .px-lg-1 { + padding-right: 0.25rem !important; } + .pb-lg-1, + .py-lg-1 { + padding-bottom: 0.25rem !important; } + .pl-lg-1, + .px-lg-1 { + padding-left: 0.25rem !important; } + .p-lg-2 { + padding: 0.5rem !important; } + .pt-lg-2, + .py-lg-2 { + padding-top: 0.5rem !important; } + .pr-lg-2, + .px-lg-2 { + padding-right: 0.5rem !important; } + .pb-lg-2, + .py-lg-2 { + padding-bottom: 0.5rem !important; } + .pl-lg-2, + .px-lg-2 { + padding-left: 0.5rem !important; } + .p-lg-3 { + padding: 1rem !important; } + .pt-lg-3, + .py-lg-3 { + padding-top: 1rem !important; } + .pr-lg-3, + .px-lg-3 { + padding-right: 1rem !important; } + .pb-lg-3, + .py-lg-3 { + padding-bottom: 1rem !important; } + .pl-lg-3, + .px-lg-3 { + padding-left: 1rem !important; } + .p-lg-4 { + padding: 1.5rem !important; } + .pt-lg-4, + .py-lg-4 { + padding-top: 1.5rem !important; } + .pr-lg-4, + .px-lg-4 { + padding-right: 1.5rem !important; } + .pb-lg-4, + .py-lg-4 { + padding-bottom: 1.5rem !important; } + .pl-lg-4, + .px-lg-4 { + padding-left: 1.5rem !important; } + .p-lg-5 { + padding: 3rem !important; } + .pt-lg-5, + .py-lg-5 { + padding-top: 3rem !important; } + .pr-lg-5, + .px-lg-5 { + padding-right: 3rem !important; } + .pb-lg-5, + .py-lg-5 { + padding-bottom: 3rem !important; } + .pl-lg-5, + .px-lg-5 { + padding-left: 3rem !important; } + .m-lg-auto { + margin: auto !important; } + .mt-lg-auto, + .my-lg-auto { + margin-top: auto !important; } + .mr-lg-auto, + .mx-lg-auto { + margin-right: auto !important; } + .mb-lg-auto, + .my-lg-auto { + margin-bottom: auto !important; } + .ml-lg-auto, + .mx-lg-auto { + margin-left: auto !important; } } + +@media (min-width: 1200px) { + .m-xl-0 { + margin: 0 !important; } + .mt-xl-0, + .my-xl-0 { + margin-top: 0 !important; } + .mr-xl-0, + .mx-xl-0 { + margin-right: 0 !important; } + .mb-xl-0, + .my-xl-0 { + margin-bottom: 0 !important; } + .ml-xl-0, + .mx-xl-0 { + margin-left: 0 !important; } + .m-xl-1 { + margin: 0.25rem !important; } + .mt-xl-1, + .my-xl-1 { + margin-top: 0.25rem !important; } + .mr-xl-1, + .mx-xl-1 { + margin-right: 0.25rem !important; } + .mb-xl-1, + .my-xl-1 { + margin-bottom: 0.25rem !important; } + .ml-xl-1, + .mx-xl-1 { + margin-left: 0.25rem !important; } + .m-xl-2 { + margin: 0.5rem !important; } + .mt-xl-2, + .my-xl-2 { + margin-top: 0.5rem !important; } + .mr-xl-2, + .mx-xl-2 { + margin-right: 0.5rem !important; } + .mb-xl-2, + .my-xl-2 { + margin-bottom: 0.5rem !important; } + .ml-xl-2, + .mx-xl-2 { + margin-left: 0.5rem !important; } + .m-xl-3 { + margin: 1rem !important; } + .mt-xl-3, + .my-xl-3 { + margin-top: 1rem !important; } + .mr-xl-3, + .mx-xl-3 { + margin-right: 1rem !important; } + .mb-xl-3, + .my-xl-3 { + margin-bottom: 1rem !important; } + .ml-xl-3, + .mx-xl-3 { + margin-left: 1rem !important; } + .m-xl-4 { + margin: 1.5rem !important; } + .mt-xl-4, + .my-xl-4 { + margin-top: 1.5rem !important; } + .mr-xl-4, + .mx-xl-4 { + margin-right: 1.5rem !important; } + .mb-xl-4, + .my-xl-4 { + margin-bottom: 1.5rem !important; } + .ml-xl-4, + .mx-xl-4 { + margin-left: 1.5rem !important; } + .m-xl-5 { + margin: 3rem !important; } + .mt-xl-5, + .my-xl-5 { + margin-top: 3rem !important; } + .mr-xl-5, + .mx-xl-5 { + margin-right: 3rem !important; } + .mb-xl-5, + .my-xl-5 { + margin-bottom: 3rem !important; } + .ml-xl-5, + .mx-xl-5 { + margin-left: 3rem !important; } + .p-xl-0 { + padding: 0 !important; } + .pt-xl-0, + .py-xl-0 { + padding-top: 0 !important; } + .pr-xl-0, + .px-xl-0 { + padding-right: 0 !important; } + .pb-xl-0, + .py-xl-0 { + padding-bottom: 0 !important; } + .pl-xl-0, + .px-xl-0 { + padding-left: 0 !important; } + .p-xl-1 { + padding: 0.25rem !important; } + .pt-xl-1, + .py-xl-1 { + padding-top: 0.25rem !important; } + .pr-xl-1, + .px-xl-1 { + padding-right: 0.25rem !important; } + .pb-xl-1, + .py-xl-1 { + padding-bottom: 0.25rem !important; } + .pl-xl-1, + .px-xl-1 { + padding-left: 0.25rem !important; } + .p-xl-2 { + padding: 0.5rem !important; } + .pt-xl-2, + .py-xl-2 { + padding-top: 0.5rem !important; } + .pr-xl-2, + .px-xl-2 { + padding-right: 0.5rem !important; } + .pb-xl-2, + .py-xl-2 { + padding-bottom: 0.5rem !important; } + .pl-xl-2, + .px-xl-2 { + padding-left: 0.5rem !important; } + .p-xl-3 { + padding: 1rem !important; } + .pt-xl-3, + .py-xl-3 { + padding-top: 1rem !important; } + .pr-xl-3, + .px-xl-3 { + padding-right: 1rem !important; } + .pb-xl-3, + .py-xl-3 { + padding-bottom: 1rem !important; } + .pl-xl-3, + .px-xl-3 { + padding-left: 1rem !important; } + .p-xl-4 { + padding: 1.5rem !important; } + .pt-xl-4, + .py-xl-4 { + padding-top: 1.5rem !important; } + .pr-xl-4, + .px-xl-4 { + padding-right: 1.5rem !important; } + .pb-xl-4, + .py-xl-4 { + padding-bottom: 1.5rem !important; } + .pl-xl-4, + .px-xl-4 { + padding-left: 1.5rem !important; } + .p-xl-5 { + padding: 3rem !important; } + .pt-xl-5, + .py-xl-5 { + padding-top: 3rem !important; } + .pr-xl-5, + .px-xl-5 { + padding-right: 3rem !important; } + .pb-xl-5, + .py-xl-5 { + padding-bottom: 3rem !important; } + .pl-xl-5, + .px-xl-5 { + padding-left: 3rem !important; } + .m-xl-auto { + margin: auto !important; } + .mt-xl-auto, + .my-xl-auto { + margin-top: auto !important; } + .mr-xl-auto, + .mx-xl-auto { + margin-right: auto !important; } + .mb-xl-auto, + .my-xl-auto { + margin-bottom: auto !important; } + .ml-xl-auto, + .mx-xl-auto { + margin-left: auto !important; } } + +.text-monospace { + font-family: SFMono-Regular, Menlo, Monaco, Consolas, "Liberation Mono", "Courier New", monospace; } + +.text-justify { + text-align: justify !important; } + +.text-nowrap { + white-space: nowrap !important; } + +.text-truncate { + overflow: hidden; + -o-text-overflow: ellipsis; + text-overflow: ellipsis; + white-space: nowrap; } + +.text-left { + text-align: left !important; } + +.text-right { + text-align: right !important; } + +.text-center { + text-align: center !important; } + +@media (min-width: 576px) { + .text-sm-left { + text-align: left !important; } + .text-sm-right { + text-align: right !important; } + .text-sm-center { + text-align: center !important; } } + +@media (min-width: 768px) { + .text-md-left { + text-align: left !important; } + .text-md-right { + text-align: right !important; } + .text-md-center { + text-align: center !important; } } + +@media (min-width: 992px) { + .text-lg-left { + text-align: left !important; } + .text-lg-right { + text-align: right !important; } + .text-lg-center { + text-align: center !important; } } + +@media (min-width: 1200px) { + .text-xl-left { + text-align: left !important; } + .text-xl-right { + text-align: right !important; } + .text-xl-center { + text-align: center !important; } } + +.text-lowercase { + text-transform: lowercase !important; } + +.text-uppercase { + text-transform: uppercase !important; } + +.text-capitalize { + text-transform: capitalize !important; } + +.font-weight-light { + font-weight: 300 !important; } + +.font-weight-normal { + font-weight: 400 !important; } + +.font-weight-bold { + font-weight: 700 !important; } + +.font-italic { + font-style: italic !important; } + +.text-white { + color: #fff !important; } + +.text-primary { + color: #78d5ef !important; } + +a.text-primary:hover, a.text-primary:focus { + color: #4ac7ea !important; } + +.text-secondary { + color: #6c757d !important; } + +a.text-secondary:hover, a.text-secondary:focus { + color: #545b62 !important; } + +.text-success { + color: #28a745 !important; } + +a.text-success:hover, a.text-success:focus { + color: #1e7e34 !important; } + +.text-info { + color: #17a2b8 !important; } + +a.text-info:hover, a.text-info:focus { + color: #117a8b !important; } + +.text-warning { + color: #ffc107 !important; } + +a.text-warning:hover, a.text-warning:focus { + color: #d39e00 !important; } + +.text-danger { + color: #dc3545 !important; } + +a.text-danger:hover, a.text-danger:focus { + color: #bd2130 !important; } + +.text-light { + color: #f8f9fa !important; } + +a.text-light:hover, a.text-light:focus { + color: #dae0e5 !important; } + +.text-dark { + color: #343a40 !important; } + +a.text-dark:hover, a.text-dark:focus { + color: #1d2124 !important; } + +.text-body { + color: #212529 !important; } + +.text-muted { + color: #6c757d !important; } + +.text-black-50 { + color: rgba(0, 0, 0, 0.5) !important; } + +.text-white-50 { + color: rgba(255, 255, 255, 0.5) !important; } + +.text-hide { + font: 0/0 a; + color: transparent; + text-shadow: none; + background-color: transparent; + border: 0; } + +.visible { + visibility: visible !important; } + +.invisible { + visibility: hidden !important; } + +@media print { + *, + *::before, + *::after { + text-shadow: none !important; + -webkit-box-shadow: none !important; + box-shadow: none !important; } + a:not(.btn) { + text-decoration: underline; } + abbr[title]::after { + content: " (" attr(title) ")"; } + pre { + white-space: pre-wrap !important; } + pre, + blockquote { + border: 1px solid #adb5bd; + page-break-inside: avoid; } + thead { + display: table-header-group; } + tr, + img { + page-break-inside: avoid; } + p, + h2, + h3 { + orphans: 3; + widows: 3; } + h2, + h3 { + page-break-after: avoid; } + @page { + size: a3; } + body { + min-width: 992px !important; } + .container { + min-width: 992px !important; } + .navbar { + display: none; } + .badge { + border: 1px solid #000; } + .table { + border-collapse: collapse !important; } + .table td, + .table th { + background-color: #fff !important; } + .table-bordered th, + .table-bordered td { + border: 1px solid #dee2e6 !important; } } + +body { + font-family: "Work Sans", Arial, sans-serif; + background: #fff; + font-size: 16px; + line-height: 1.8; + font-weight: 300; + color: #8b8b92; } + body.menu-show { + overflow: hidden; + position: fixed; + height: 100%; + width: 100%; } + +a { + -webkit-transition: .3s all ease; + -o-transition: .3s all ease; + transition: .3s all ease; + color: var(--bg-color-2); } + a:hover { + text-decoration: none; + color: #ee76ad; } + +h1, h2, h3, h4, h5, +.h1, .h2, .h3, .h4, .h5 { + line-height: 1.5; + color: #404044; + font-weight: 400; } + +.text-primary { + color: #ee76ad !important; } + +.ftco-navbar-light { + background: transparent !important; + position: absolute; + left: 0; + right: 0; + z-index: 3; + top: 30px; } + @media (max-width: 991.98px) { + .ftco-navbar-light { + background: #404044 !important; + top: 0; + position: relative; } } + .ftco-navbar-light .navbar-brand { + color: #fff; } + .ftco-navbar-light .navbar-nav > .nav-item > .nav-link { + font-size: 16px; + padding-top: .9rem; + padding-bottom: .9rem; + padding-left: 20px; + padding-right: 20px; + color: #f0f0f0; + font-weight: 400; + opacity: 1 !important; } + .ftco-navbar-light .navbar-nav > .nav-item > .nav-link:hover { + color: #fff; } + .ftco-navbar-light .navbar-nav > .nav-item .dropdown-menu { + border: none; + background: #fff; + -webkit-box-shadow: 0px 10px 34px -20px rgba(0, 0, 0, 0.41); + -moz-box-shadow: 0px 10px 34px -20px rgba(0, 0, 0, 0.41); + box-shadow: 0px 10px 34px -20px rgba(0, 0, 0, 0.41); } + .ftco-navbar-light .navbar-nav > .nav-item.ftco-seperator { + position: relative; + margin-left: 20px; + padding-left: 20px; } + @media (max-width: 991.98px) { + .ftco-navbar-light .navbar-nav > .nav-item.ftco-seperator { + padding-left: 0; + margin-left: 0; } } + .ftco-navbar-light .navbar-nav > .nav-item.ftco-seperator:before { + position: absolute; + content: ""; + top: 10px; + bottom: 10px; + left: 0; + width: 2px; + background: rgba(255, 255, 255, 0.05); } + @media (max-width: 991.98px) { + .ftco-navbar-light .navbar-nav > .nav-item.ftco-seperator:before { + display: none; } } + .ftco-navbar-light .navbar-nav > .nav-item.cta > a { + color: #fff; + border: 1px solid rgba(255, 255, 255, 0.3); + padding-top: .5rem; + padding-bottom: .5rem; + padding-left: 20px; + padding-right: 20px; + margin-top: 4px; + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; } + .ftco-navbar-light .navbar-nav > .nav-item.cta > a span { + display: inline-block; } + .ftco-navbar-light .navbar-nav > .nav-item.cta.cta-colored span { + border-color: #ee76ad; } + .ftco-navbar-light .navbar-nav > .nav-item.active > a { + color: rgba(255, 255, 255, 0.5); } + .ftco-navbar-light .navbar-toggler { + border: none; + color: rgba(255, 255, 255, 0.5) !important; + cursor: pointer; + padding-right: 0; + text-transform: uppercase; + font-size: 16px; + letter-spacing: .1em; } + .ftco-navbar-light.scrolled { + position: fixed; + right: 0; + left: 0; + top: 0; + margin-top: -130px; + background: #fff !important; + -webkit-box-shadow: 0 0 10px 0 rgba(0, 0, 0, 0.1); + box-shadow: 0 0 10px 0 rgba(0, 0, 0, 0.1); } + .ftco-navbar-light.scrolled .nav-item.active > a { + color: #ee76ad !important; } + .ftco-navbar-light.scrolled .nav-item.cta > a { + color: #fff !important; + background: var(--bg-color-2); + border: none !important; + padding-top: 0.5rem !important; + padding-bottom: .5rem !important; + padding-left: 20px; + padding-right: 20px; + margin-top: 6px !important; + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; } + .ftco-navbar-light.scrolled .nav-item.cta > a span { + display: inline-block; } + .ftco-navbar-light.scrolled .nav-item.cta.cta-colored span { + border-color: #ee76ad; } + @media (max-width: 991.98px) { + .ftco-navbar-light.scrolled .navbar-nav { + background: none; + border-radius: 0px; + padding-left: 0rem !important; + padding-right: 0rem !important; } } + @media (max-width: 767.98px) { + .ftco-navbar-light.scrolled .navbar-nav { + background: none; + padding-left: 0 !important; + padding-right: 0 !important; } } + .ftco-navbar-light.scrolled .navbar-toggler { + border: none; + color: rgba(0, 0, 0, 0.5) !important; + border-color: rgba(0, 0, 0, 0.5) !important; + cursor: pointer; + padding-right: 0; + text-transform: uppercase; + font-size: 16px; + letter-spacing: .1em; } + .ftco-navbar-light.scrolled .nav-link { + padding-top: 0.9rem !important; + padding-bottom: 0.9rem !important; + color: #404044 !important; } + .ftco-navbar-light.scrolled .nav-link.active { + color: #ee76ad !important; } + .ftco-navbar-light.scrolled.awake { + margin-top: 0px; + -webkit-transition: .3s all ease-out; + -o-transition: .3s all ease-out; + transition: .3s all ease-out; } + .ftco-navbar-light.scrolled.sleep { + -webkit-transition: .3s all ease-out; + -o-transition: .3s all ease-out; + transition: .3s all ease-out; } + .ftco-navbar-light.scrolled .navbar-brand { + color: #404044; } + +.navbar-brand { + font-weight: 700; + line-height: 1; + font-size: 20px; + text-transform: uppercase; } + +.hero-wrap { + width: 100%; + height: 100%; + position: inherit; + z-index: 0; } + .hero-wrap .overlay { + position: absolute; + top: 0; + left: 0; + right: 0; + bottom: 0; + content: ''; + opacity: .97; + background: #ee76ad; + background: -moz-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -webkit-gradient(left bottom, right top, color-stop(0%, var(--bg-color-1)), color-stop(100%, var(--bg-color-2))); + background: -webkit-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -o-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -ms-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + filter: progid:DXImageTransform.Microsoft.gradient( startColorstr=var(--bg-color-1), endColorstr=var(--bg-color-2), GradientType=1 ); } + +#particles-js { + position: absolute; + top: 0; + left: 0; + bottom: 0; + right: 0; + width: 100%; + height: 100%; } + +.slider-text { + position: absolute; + top: 0; + left: 0; + right: 0; + bottom: 0; + color: #fff; } + .slider-text h1 { + font-size: 55px; + color: #fff; + line-height: 1.2; + font-weight: 200; } + @media (max-width: 991.98px) { + .slider-text h1 { + font-size: 40px; } } + .slider-text h1 strong { + font-weight: 800; } + .slider-text p { + font-size: 20px; + line-height: 1.5; + font-weight: 300; + color: rgba(0, 0, 0, 0.8); } + .slider-text p strong { + font-weight: 700; } + .slider-text p strong a { + color: #404044; } + .slider-text .breadcrumbs { + text-transform: uppercase; + font-size: 13px; + letter-spacing: 1px; + margin-bottom: 20px; + z-index: 99; } + .slider-text .breadcrumbs span { + border-bottom: 2px solid rgba(255, 255, 255, 0.1); + color: rgba(255, 255, 255, 0.7); } + .slider-text .breadcrumbs span a { + color: #fff; } + .slider-text .bread { + font-weight: 700 !important; } + .slider-text .btn-primary { + border: 1px solid rgba(255, 255, 255, 0.4); + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; } + .slider-text .btn-primary:hover, .slider-text .btn-primary:focus { + background: #fff !important; + color: #404044; } + +.owl-carousel { + position: relative; } + .owl-carousel .owl-item { + opacity: .4; } + .owl-carousel .owl-item.active { + opacity: 1; } + .owl-carousel .owl-nav { + position: absolute; + top: 50%; + width: 100%; } + .owl-carousel .owl-nav .owl-prev, + .owl-carousel .owl-nav .owl-next { + position: absolute; + -webkit-transform: translateY(-50%); + -ms-transform: translateY(-50%); + transform: translateY(-50%); + margin-top: -10px; + -moz-transition: all 0.7s ease; + -o-transition: all 0.7s ease; + -webkit-transition: all 0.7s ease; + -ms-transition: all 0.7s ease; + transition: all 0.7s ease; + opacity: 0; } + .owl-carousel .owl-nav .owl-prev span:before, + .owl-carousel .owl-nav .owl-next span:before { + font-size: 40px; } + .owl-carousel .owl-nav .owl-prev { + left: 0; } + .owl-carousel .owl-nav .owl-next { + right: 0; } + .owl-carousel .owl-dots { + text-align: center; } + .owl-carousel .owl-dots .owl-dot { + width: 10px; + height: 10px; + margin: 5px; + border-radius: 50%; + background: #dadadc; } + .owl-carousel .owl-dots .owl-dot.active { + background: #efac78; } + .owl-carousel:hover .owl-nav .owl-prev, + .owl-carousel:hover .owl-nav .owl-next { + opacity: 1; } + .owl-carousel:hover .owl-nav .owl-prev { + left: -20px; } + .owl-carousel:hover .owl-nav .owl-next { + right: -20px; } + +.owl-custom-nav { + float: right; + position: relative; + z-index: 10; + border: 1px solid red; } + .owl-custom-nav .owl-custom-prev, + .owl-custom-nav .owl-custom-next { + padding: 10px; + font-size: 30px; + background: #ccc; + line-height: 0; + width: 60px; + text-align: center; + display: inline-block; } + +.bg-light { + background: #f8faff !important; } + +.bg-primary { + background: #ee76ad; } + +.btn { + cursor: pointer; + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; + -webkit-box-shadow: none !important; + box-shadow: none !important; } + .btn:hover, .btn:active, .btn:focus { + outline: none; } + .btn.btn-primary { + background: #fce7f1; + border: 2px solid #fce7f1; + color: #ee76ad; } + .btn.btn-primary:hover { + border: 2px solid #ee76ad; + background: transparent; + color: #ee76ad; } + .btn.btn-primary.btn-outline-primary { + border: 2px solid #ee76ad; + background: transparent; + color: #ee76ad; } + .btn.btn-primary.btn-outline-primary:hover { + border: 2px solid transparent; + background: #ee76ad; + color: #fff; } + .btn.btn-outline-white { + border-color: rgba(255, 255, 255, 0.8); + background: none; + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; + border-width: 2px; + color: #fff; } + .btn.btn-outline-white:hover, .btn.btn-outline-white:focus, .btn.btn-outline-white:active { + background: #fff; + border-color: #fff; + color: #ee76ad; } + +.ftco-section-featured { + margin-top: -250px; + padding-bottom: 7em; } + .ftco-section-featured .container { + z-index: 2; + position: relative; } + .ftco-section-featured .heading-section h2 { + font-weight: 300 !important; } + .ftco-section-featured .heading-section h2 strong { + font-weight: 700; + color: #efac78; + background: #fdf2ea; } + .ftco-section-featured.ftco-section-featured-2 { + margin-top: 0 !important; + padding-top: 7em; } + .ftco-section-featured .featured-img { + display: block; + position: relative; + z-index: 0; } + .ftco-section-featured .featured-img h3 { + font-size: 20px; + margin-bottom: 0; + line-height: 1.2; } + .ftco-section-featured .featured-img h3 .tag { + font-size: 14px; + color: #c0c0c3; } + .ftco-section-featured .featured-img .user .user-img { + width: 50px; + height: 50px; + -webkit-border-radius: 50%; + -moz-border-radius: 50%; + -ms-border-radius: 50%; + border-radius: 50%; } + .ftco-section-featured .featured-img .user h3 { + font-size: 18px; } + .ftco-section-featured .featured-img .user h3 .position { + font-size: 14px; + color: #c0c0c3; } + .ftco-section-featured .featured-img .text { + position: absolute; + bottom: 0; + left: 0; + right: 0; + opacity: 0; + height: 80px; + background: #fff; + border-top: none; + z-index: -1; + -moz-transition: all 0.3s ease; + -o-transition: all 0.3s ease; + -webkit-transition: all 0.3s ease; + -ms-transition: all 0.3s ease; + transition: all 0.3s ease; } + .ftco-section-featured .featured-img .text-1 { + position: absolute; + top: 0; + left: 0; + right: 0; + opacity: 0; + height: 80px; + background: #fff; + border-bottom: none; + z-index: -1; + -moz-transition: all 0.3s ease; + -o-transition: all 0.3s ease; + -webkit-transition: all 0.3s ease; + -ms-transition: all 0.3s ease; + transition: all 0.3s ease; } + .ftco-section-featured .featured-img img, .ftco-section-featured .featured-img .text, .ftco-section-featured .featured-img .text-1 { + -webkit-transform: scale(0.92); + -moz-transform: scale(0.92); + -ms-transform: scale(0.92); + -o-transform: scale(0.92); + transform: scale(0.92); + -moz-transition: all 0.3s ease; + -o-transition: all 0.3s ease; + -webkit-transition: all 0.3s ease; + -ms-transition: all 0.3s ease; + transition: all 0.3s ease; } + .ftco-section-featured .featured-img:hover { + z-index: 1; } + .ftco-section-featured .featured-img:hover img, .ftco-section-featured .featured-img:hover .text, .ftco-section-featured .featured-img:hover .text-1 { + -webkit-transform: scale(1); + -moz-transform: scale(1); + -ms-transform: scale(1); + -o-transform: scale(1); + transform: scale(1); + -webkit-border-radius: 0; + -moz-border-radius: 0; + -ms-border-radius: 0; + border-radius: 0; } + .ftco-section-featured .featured-img:hover .text { + bottom: -80px; + -webkit-box-shadow: 0px 31px 52px -37px rgba(0, 0, 0, 0.58); + -moz-box-shadow: 0px 31px 52px -37px rgba(0, 0, 0, 0.58); + box-shadow: 0px 31px 52px -37px rgba(0, 0, 0, 0.58); } + .ftco-section-featured .featured-img:hover .text-1 { + top: -80px; } + .ftco-section-featured .featured-img:hover .text, .ftco-section-featured .featured-img:hover .text-1 { + opacity: 1; } + +.services .icon { + width: 90px; + height: 50px; + position: relative; } + .services .icon:before, .services .icon:after { + position: absolute; + left: 0; + right: 0; + content: ''; } + .services .icon.color-1 { + background: #fce7f1; } + .services .icon.color-1 span { + color: #ee76ad; } + .services .icon.color-1:before { + top: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 0 45px 20px 45px; + border-color: transparent transparent #fce7f1 transparent; } + .services .icon.color-1:after { + bottom: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 20px 45px 0 45px; + border-color: #fce7f1 transparent transparent transparent; } + .services .icon.color-2 { + background: #fdf2ea; } + .services .icon.color-2 span { + color: #efac78; } + .services .icon.color-2:before { + top: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 0 45px 20px 45px; + border-color: transparent transparent #fdf2ea transparent; } + .services .icon.color-2:after { + bottom: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 20px 45px 0 45px; + border-color: #fdf2ea transparent transparent transparent; } + .services .icon.color-3 { + background: #def4fb; } + .services .icon.color-3 span { + color: #29bae4; } + .services .icon.color-3:before { + top: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 0 45px 20px 45px; + border-color: transparent transparent #def4fb transparent; } + .services .icon.color-3:after { + bottom: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 20px 45px 0 45px; + border-color: #def4fb transparent transparent transparent; } + .services .icon.color-4 { + background: #ebfdf4; } + .services .icon.color-4 span { + color: #79efb4; } + .services .icon.color-4:before { + top: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 0 45px 20px 45px; + border-color: transparent transparent #ebfdf4 transparent; } + .services .icon.color-4:after { + bottom: -20px; + width: 0; + height: 0; + border-style: solid; + border-width: 20px 45px 0 45px; + border-color: #ebfdf4 transparent transparent transparent; } + +.services .media-body h3 { + font-size: 20px; } + +.list-services { + margin-top: 40px; + padding: 0; } + .list-services li { + font-size: 18px; + list-style: none; } + .list-services li a { + color: #404044; } + +.ftco-section-parallax { + position: relative; } + .ftco-section-parallax .parallax-img { + background-size: cover; + background-repeat: no-repeat; + background-position: center center; + position: relative; + padding: 10em 0; + background: var(--bg-color-1); + background: -moz-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -webkit-gradient(left bottom, right top, color-stop(0%, var(--bg-color-1)), color-stop(100%, var(--bg-color-2))); + background: -webkit-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -o-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: -ms-linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + background: linear-gradient(45deg, var(--bg-color-1) 0%, var(--bg-color-2) 100%); + filter: progid:DXImageTransform.Microsoft.gradient( startColorstr=var(--bg-color-1), endColorstr=var(--bg-color-2), GradientType=1 ); } + .ftco-section-parallax .heading-section-white h2 { + font-weight: 400 !important; } + +@media (min-width: 768px) { + .block-3 { + margin-bottom: 7em; } } + +.block-3 .text, .block-3 .image { + width: 100%; + padding: 10% 7%; + display: block; } + @media (min-width: 768px) { + .block-3 .text { + width: 60%; + padding: 10% 7%; } + .block-3 .image { + width: 40%; + padding: 10% 7%; } + } + +.block-3 .text .subheading { + font-size: 13px; + text-transform: uppercase; + letter-spacing: .1em; + color: #c0c0c3; } + +.block-3 .text .heading { + font-size: 30px; + margin-bottom: 30px; } + .block-3 .text .heading a { + color: #404044; } + +.block-3 .text p:last-child { + margin-bottom: 0; } + +.block-3 .image { + background-size: cover; + background-position: center center; + background-repeat: no-repeat; + position: relative; + height: 80% } + .block-3 .image:after { + position: absolute; + top: 0; + left: 0; + right: 0; + bottom: 0; + content: ''; + -webkit-box-shadow: 20px 20px 0 0 rgba(97, 67, 133, 0.5); + box-shadow: 20px 20px 0 0 rgba(97, 67, 133, 0.5); } + .block-3 .image.image-2:after { + position: absolute; + top: 0; + left: 0; + right: 0; + bottom: 0; + content: ''; + -webkit-box-shadow: -20px 20px 0 0 rgba(81, 99, 149, 0.5); + box-shadow: -20px 20px 0 0 rgba(81, 99, 149, 0.5); } + @media (max-width: 767.98px) { + .block-3 .image { + height: 300px; } } + +.block-5 { + overflow: hidden; + background-size: cover; + background-repeat: no-repeat; + background-position: center center; + height: 400px; + position: relative; + display: block; } + .block-5:before { + content: ''; + position: absolute; + top: 0; + right: 0; + bottom: 0; + left: 0; + background: -moz-linear-gradient(top, transparent 0%, transparent 18%, rgba(0, 0, 0, 0.8) 99%, rgba(0, 0, 0, 0.8) 100%); + background: -webkit-linear-gradient(top, transparent 0%, transparent 18%, rgba(0, 0, 0, 0.8) 99%, rgba(0, 0, 0, 0.8) 100%); + background: -webkit-gradient(linear, left top, left bottom, from(transparent), color-stop(18%, transparent), color-stop(99%, rgba(0, 0, 0, 0.8)), to(rgba(0, 0, 0, 0.8))); + background: -o-linear-gradient(top, transparent 0%, transparent 18%, rgba(0, 0, 0, 0.8) 99%, rgba(0, 0, 0, 0.8) 100%); + background: linear-gradient(to bottom, transparent 0%, transparent 18%, rgba(0, 0, 0, 0.8) 99%, rgba(0, 0, 0, 0.8) 100%); + filter: progid:DXImageTransform.Microsoft.gradient( startColorstr='#00000000', endColorstr='#cc000000',GradientType=0 ); + opacity: .8; } + .block-5 .text { + position: absolute; + bottom: 0; + right: 0; + left: 0; + padding: 20px 20px 10px 20px; + -webkit-transition: .8s all ease; + -o-transition: .8s all ease; + transition: .8s all ease; } + .block-5 .text:before { + bottom: 0; + left: 0; + right: 0; + z-index: 1; + background: #fff; + visibility: hidden; + opacity: 0; + height: 0; + position: absolute; + content: ""; + -moz-transition: all 0.3s ease; + -o-transition: all 0.3s ease; + -webkit-transition: all 0.3s ease; + -ms-transition: all 0.3s ease; + transition: all 0.3s ease; } + .block-5 .text .heading, .block-5 .text .subheading, .block-5 .text .post-meta, .block-5 .text .excerpt, .block-5 .text .price { + z-index: 2; + position: relative; } + .block-5 .text .subheading { + color: #fff; + text-transform: uppercase; + letter-spacing: .1em; + font-size: 12px; + margin-bottom: 5px; + opacity: .6; } + .block-5 .text .heading { + color: #fff; + margin: 0 0 10px 0; + padding: 0; + font-weight: bold; + font-size: 24px; + line-height: 1.2; + font-weight: 400; } + .block-5 .text .post-meta { + line-height: 1.4; + color: #fff; + font-size: 14px; } + .block-5 .text .post-meta span { + display: inline-block; + margin-right: 10px; + margin-bottom: 10px; + opacity: .6; } + .block-5 .text .price { + color: #fff; } + .block-5 .text .excerpt { + line-height: 1.4; + color: #fff; } + .block-5:hover .text:before, .block-5:focus .text:before { + visibility: visible; + opacity: 1; + height: 100%; + background: #fff; } + .block-5:hover .text .heading, .block-5:hover .text .subheading, .block-5:hover .text .post-meta, .block-5:hover .text .price, .block-5:hover .text .star-rate, .block-5:focus .text .heading, .block-5:focus .text .subheading, .block-5:focus .text .post-meta, .block-5:focus .text .price, .block-5:focus .text .star-rate { + color: #404044; } + +.aside-stretch { + background: #f4a3c8; } + .aside-stretch:after { + position: absolute; + top: 0; + right: 100%; + bottom: 0; + content: ''; + width: 360%; + background: #f4a3c8; } + @media (max-width: 767.98px) { + .aside-stretch { + background: transparent; } + .aside-stretch:after { + background: transparent; + display: none; } } + +.form-control { + height: 52px !important; + background: #fff !important; + color: #404044 !important; + font-size: 18px; + border-radius: 0px; + -webkit-box-shadow: none !important; + box-shadow: none !important; } + .form-control:focus, .form-control:active { + border-color: #404044; } + +textarea.form-control { + height: inherit !important; } + +.ftco-vh-100 { + height: 100vh; } + @media (max-width: 1199.98px) { + .ftco-vh-100 { + height: inherit; + padding-top: 5em; + padding-bottom: 5em; } } + +.ftco-vh-75 { + height: 75vh; + min-height: 700px; } + @media (max-width: 1199.98px) { + .ftco-vh-75 { + min-height: 700px; + height: inherit; + padding-top: 5em; + padding-bottom: 5em; } } + +.ftco-tab-nav { + padding: 0; + margin: 0; + display: inline-block !important; } + @media (max-width: 767.98px) { + .ftco-tab-nav { + display: block !important; + margin-bottom: 10px; + width: 100% !important; } } + .ftco-tab-nav li { + padding: 0; + margin: 0 5px; + display: inline-block !important; } + @media (max-width: 767.98px) { + .ftco-tab-nav li { + display: block !important; + margin-bottom: 10px; + width: 100% !important; } } + .ftco-tab-nav li a { + text-transform: uppercase; + font-size: 14px; + letter-spacing: .2em; + color: #ccc; + border: 2px solid #ccc; + border-radius: 0 !important; } + .ftco-tab-nav li a.active { + background: none !important; + color: black !important; + border: 2px solid #404044; } + +.ftco-animate { + opacity: 0; + visibility: hidden; } + +.bg-primary { + background: #ee76ad !important; } + +.ftco-section .ftco-sub-title { + font-size: 16px; + text-transform: uppercase; + letter-spacing: .5em; + color: #d4d4d4; + font-family: "Work Sans", -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, "Helvetica Neue", Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol"; + font-weight: 300; } + +.ftco-section .ftco-primary-title { + margin-top: 0; + margin-bottom: 30px; } + +.media-custom { + background: #fff; } + .media-custom .media-body .name { + font-weight: 500; + font-size: 16px; + margin-bottom: 0; + color: #ee76ad; } + .media-custom .media-body .position { + font-size: 13px; + color: white; } + +.about-author .desc h3 { + font-size: 24px; } + +.ftco-section { + padding: 8em 0; + position: relative; } + @media (max-width: 767.98px) { + .ftco-section { + padding: 6em 0; } } + +.ftco-bg-dark { + background: #3c312e; } + +.ftco-footer { + font-size: 16px; + background: #888; + padding: 12em 0 8em 0; } + .ftco-footer .ftco-footer-logo { + text-transform: uppercase; + letter-spacing: .1em; } + .ftco-footer .ftco-footer-widget h2 { + font-weight: normal; + color: #fff; + margin-bottom: 40px; + font-size: 18px; + font-weight: 400; } + .ftco-footer .ftco-footer-widget ul li a span { + color: #fff; } + .ftco-footer p { + color: rgba(255, 255, 255, 0.7); } + .ftco-footer a { + color: rgba(255, 255, 255, 0.7); } + .ftco-footer a:hover { + color: #fff; } + .ftco-footer .ftco-heading-2 { + font-size: 17px; + font-weight: 400; + color: #404044; } + +.ftco-footer-social li { + list-style: none; + margin: 0 10px 0 0; + display: inline-block; } + .ftco-footer-social li a { + height: 50px; + width: 50px; + display: block; + float: left; + background: rgba(255, 255, 255, 0.05); + border-radius: 50%; + position: relative; } + .ftco-footer-social li a span { + position: absolute; + font-size: 26px; + top: 50%; + left: 50%; + -webkit-transform: translate(-50%, -50%); + -ms-transform: translate(-50%, -50%); + transform: translate(-50%, -50%); } + /* .ftco-footer-social li a:hover { + color: #fff; } */ + +.footer-small-nav > li { + display: inline-block; } + .footer-small-nav > li a { + margin: 0 10px 10px 0; } + .footer-small-nav > li a:hover, .footer-small-nav > li a:focus { + color: #ee76ad; } + +.media .ftco-icon { + width: 100px; } + .media .ftco-icon span { + color: #ee76ad; } + +.ftco-media { + background: #fff; + border-radius: 0px; } + .ftco-media .heading { + font-weight: normal; } + .ftco-media.ftco-media-shadow { + padding: 40px; + background: #fff; + -webkit-box-shadow: 0 10px 50px -15px rgba(0, 0, 0, 0.3); + box-shadow: 0 10px 50px -15px rgba(0, 0, 0, 0.3); + -webkit-transition: .2s all ease; + -o-transition: .2s all ease; + transition: .2s all ease; + position: relative; + top: 0; } + .ftco-media.ftco-media-shadow:hover, .ftco-media.ftco-media-shadow:focus { + top: -3px; + -webkit-box-shadow: 0 10px 70px -15px rgba(0, 0, 0, 0.3); + box-shadow: 0 10px 70px -15px rgba(0, 0, 0, 0.3); } + .ftco-media .icon { + font-size: 50px; + display: block; + color: #ee76ad; } + .ftco-media.text-center .ftco-icon { + margin: 0 auto; } + +.ftco-overflow-hidden { + overflow: hidden; } + +.padding-top-bottom { + padding-top: 120px; + padding-bottom: 120px; } + +#map { + height: 400px; + width: 100%; } + @media (max-width: 991.98px) { + #map { + height: 300px; } } + +@-webkit-keyframes pulse { + 0% { + -webkit-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0.4); } + 70% { + -webkit-box-shadow: 0 0 0 30px rgba(238, 118, 173, 0); } + 100% { + -webkit-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0); } } + +@keyframes pulse { + 0% { + -moz-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0.4); + -webkit-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0.4); + box-shadow: 0 0 0 0 rgba(238, 118, 173, 0.4); } + 70% { + -moz-box-shadow: 0 0 0 30px rgba(238, 118, 173, 0); + -webkit-box-shadow: 0 0 0 30px rgba(238, 118, 173, 0); + box-shadow: 0 0 0 30px rgba(238, 118, 173, 0); } + 100% { + -moz-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0); + -webkit-box-shadow: 0 0 0 0 rgba(238, 118, 173, 0); + box-shadow: 0 0 0 0 rgba(238, 118, 173, 0); } } + +.heading-section .subheading { + font-size: 13px; + text-transform: uppercase; + font-weight: 400; + letter-spacing: 2px; + color: rgba(0, 0, 0, 0.2); } + +.heading-section h2 { + font-size: 38px; + font-weight: 700; } + @media (max-width: 767.98px) { + .heading-section h2 { + font-size: 28px; } } + +.heading-section.heading-section-white .subheading { + color: rgba(255, 255, 255, 0.7); } + +.heading-section.heading-section-white h2 { + font-size: 40px; + color: #fff; + font-weight: 700; } + +.heading-section.heading-section-white p { + color: rgba(255, 255, 255, 0.7); } + +.img, +.work-img, +.blog-img, +.user-img { + background-size: cover; + background-repeat: no-repeat; + background-position: center center; } + +.testimony-section { + position: relative; } + .testimony-section .owl-carousel { + margin: 0; } + .testimony-section .owl-carousel .owl-stage-outer { + padding-bottom: 2em; + position: relative; } + +.testimony-wrap { + -webkit-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -moz-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -ms-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -o-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + background: #fff; + display: block; + position: relative; } + .testimony-wrap .user-img { + width: 100px; + height: 100px; + border-radius: 50%; + margin: 0 auto; + position: relative; } + .testimony-wrap .user-img .quote { + position: absolute; + bottom: -10px; + right: 0; + width: 40px; + height: 40px; + background: #fce7f1; + -webkit-border-radius: 50%; + -moz-border-radius: 50%; + -ms-border-radius: 50%; + border-radius: 50%; } + .testimony-wrap .user-img .quote i { + color: #ee76ad; } + .testimony-wrap .name { + font-weight: 500; + font-size: 16px; + margin-bottom: 0; + color: #efac78; } + .testimony-wrap .position { + font-size: 13px; + color: #999; } + +.image-popup { + cursor: -webkit-zoom-in; + cursor: -moz-zoom-in; + cursor: zoom-in; } + +.mfp-with-zoom .mfp-container, +.mfp-with-zoom.mfp-bg { + opacity: 0; + -webkit-backface-visibility: hidden; + -webkit-transition: all 0.3s ease-out; + -moz-transition: all 0.3s ease-out; + -o-transition: all 0.3s ease-out; + transition: all 0.3s ease-out; } + +.mfp-with-zoom.mfp-ready .mfp-container { + opacity: 1; } + +.mfp-with-zoom.mfp-ready.mfp-bg { + opacity: 0.8; } + +.mfp-with-zoom.mfp-removing .mfp-container, +.mfp-with-zoom.mfp-removing.mfp-bg { + opacity: 0; } + +.ftco-counter { + background: #29bae4; + padding: 10em 0; } + .ftco-counter .text strong.number { + font-weight: 400; + font-size: 40px; + color: #fff; } + .ftco-counter .text span { + font-size: 20px; + color: rgba(255, 255, 255, 0.7); } + @media (max-width: 767.98px) { + .ftco-counter .counter-wrap { + margin-bottom: 20px; } } + .ftco-counter .ftco-number { + display: block; + font-size: 72px; + font-weight: bold; + color: #ee76ad; } + .ftco-counter .ftco-label { + font-size: 12px; + text-transform: uppercase; + letter-spacing: .1em; } + +.block-20 { + overflow: hidden; + background-size: cover; + background-repeat: no-repeat; + background-position: center center; + height: 350px; + position: relative; + display: block; } + +.blog-entry { + background: #fff; + -webkit-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -moz-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -ms-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + -o-box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + box-shadow: 0px 4px 18px -12px rgba(0, 0, 0, 0.75); + border: 1px solid #f7f7f7; } + @media (min-width: 768px) { + .blog-entry { + margin-bottom: 30px; } } + @media (max-width: 767.98px) { + .blog-entry { + margin-bottom: 30px; } } + .blog-entry .text { + position: relative; + border-top: 0; + border-radius: 2px; } + .blog-entry .text .heading { + font-size: 20px; + margin-bottom: 16px; } + .blog-entry .text .heading a { + color: #404044; } + .blog-entry .text .heading a:hover, .blog-entry .text .heading a:focus, .blog-entry .text .heading a:active { + color: #ee76ad; } + .blog-entry .text .meta-chat { + color: #a5a5ab; } + .blog-entry .text .read { + color: #404044; + font-size: 14px; } + .blog-entry .meta > div { + display: inline-block; + margin-right: 5px; + margin-bottom: 5px; + font-size: 15px; } + .blog-entry .meta > div a { + color: #a5a5ab; + font-size: 15px; } + .blog-entry .meta > div a:hover { + color: white; } + +.block-6 { + margin-bottom: 40px; } + .block-6 .icon span:before { + font-size: 30px;} + .block-6 .media-body p { + font-size: 16px; } + +.block-10 .chef-img { + height: 400px; } + +.block-10 .person-info { + height: 75px; } + .block-10 .person-info span { + display: block; } + .block-10 .person-info .name { + font-size: 20px; + color: #404044; + font-weight: 400; } + .block-10 .person-info .position { + font-size: 14px; } + +.block-17 form .fields { + width: 100%; + position: relative; } + @media (max-width: 991.98px) { + .block-17 form .fields { + width: 100%; } } + .block-17 form .fields .one-third { + width: 100% !important; + margin-bottom: 10px; } + @media (max-width: 991.98px) { + .block-17 form .fields .one-third { + width: 100%; + border-right: none; + padding-left: 0; + padding-right: 0; + margin-bottom: 10px; } } + .block-17 form .fields .one-third:last-child { + border-right: none; } + .block-17 form .fields .one-third label { + font-weight: 700; + color: #404044; } + .block-17 form .fields .form-control { + -webkit-box-shadow: none !important; + box-shadow: none !important; + border: transparent; + background: transparent !important; + color: #8b8b92 !important; + border: 2px solid rgba(0, 0, 0, 0.1); + font-size: 14px; + width: 100%; + -webkit-border-radius: 4px; + -moz-border-radius: 4px; + -ms-border-radius: 4px; + border-radius: 4px; } + .block-17 form .fields .form-control::-webkit-input-placeholder { + /* Chrome/Opera/Safari */ + color: #8b8b92; } + .block-17 form .fields .form-control::-moz-placeholder { + /* Firefox 19+ */ + color: #8b8b92; } + .block-17 form .fields .form-control:-ms-input-placeholder { + /* IE 10+ */ + color: #8b8b92; } + .block-17 form .fields .form-control:-moz-placeholder { + /* Firefox 18- */ + color: #8b8b92; } + .block-17 form .fields .icon { + position: absolute; + top: 50%; + right: 30px; + font-size: 14px; + -webkit-transform: translateY(-50%); + -ms-transform: translateY(-50%); + transform: translateY(-50%); + color: rgba(64, 64, 68, 0.7); } + @media (max-width: 767.98px) { + .block-17 form .fields .icon { + right: 10px; } } + .block-17 form .fields .select-wrap { + position: relative; } + .block-17 form .fields .select-wrap select { + -webkit-appearance: none; + -moz-appearance: none; + appearance: none; } + +.block-17 form .search-submit { + width: 100%; + background: #ee76ad; + border: 2px solid #ee76ad; + color: #fff; + padding: 12px 10px; + -webkit-border-radius: 4px; + -moz-border-radius: 4px; + -ms-border-radius: 4px; + border-radius: 4px; } + .block-17 form .search-submit:hover { + background: #404044; + color: #fff; + border: 2px solid #404044; } + +.block-18 .icon > span { + font-size: 40px; } + +.block-18 .text strong { + font-size: 30px; } + +.block-18 .text span { + display: block; } + +.block-27 ul { + padding: 0; + margin: 0; } + .block-27 ul li { + display: inline-block; + margin-bottom: 4px; + font-weight: 400; } + .block-27 ul li a, .block-27 ul li span { + color: #ee76ad; + text-align: center; + display: inline-block; + width: 40px; + height: 40px; + line-height: 40px; + border-radius: 50%; + border: 1px solid #fce7f1; } + .block-27 ul li.active a, .block-27 ul li.active span { + background: #fce7f1; + color: #ee76ad; + border: 1px solid transparent; } + +.block-7 { + margin-bottom: 30px; + padding: 30px; + -webkit-box-shadow: 0 10px 30px -5px rgba(0, 0, 0, 0.11); + box-shadow: 0 10px 30px -5px rgba(0, 0, 0, 0.11); + background: #fff; } + @media (min-width: 768px) { + .block-7 { + padding: 40px; } } + .block-7 .heading { + font-size: 50px; + line-height: 1; + margin: 0; + padding: 0; } + .block-7 .heading-2 { + font-size: 16px; + font-weight: normal; + text-transform: uppercase; } + .block-7 .price { + margin: 0; + padding: 0; + display: block; } + .block-7 .price sup { + font-size: 20px; + top: -2em; } + .block-7 .price .number { + font-size: 80px; } + .block-7 .excerpt { + margin-bottom: 20px; + color: #b3b3b3; } + .block-7 .label2 { + text-transform: uppercase; } + .block-7 .pricing-text { + margin-bottom: 0; } + .block-7 .pricing-text, .block-7 .pricing-text li { + padding: 0; + margin: 0; } + .block-7 .pricing-text li { + list-style: none; + margin-bottom: 10px; + color: #b3b3b3; } + .block-7 .pricing-text li strong { + color: #404044; } + +.block-8 .accordion-item .heading { + font-size: 16px; + font-weight: 400; + padding: 10px 0; } + .block-8 .accordion-item .heading > a { + padding-left: 35px; + position: relative; + color: #404044; } + .block-8 .accordion-item .heading > a:before { + width: 20px; + height: 20px; + line-height: 18px; + border: 1px solid #ccc; + text-align: center; + font-size: 18px; + top: .1em; + left: 0; } + .block-8 .accordion-item .heading > a[aria-expanded="true"]:before { + font-family: 'icomoon'; + position: absolute; + content: "\e316"; + -webkit-transition: .3s all ease; + -o-transition: .3s all ease; + transition: .3s all ease; + background: #ee76ad; + color: #fff; + border: 1px solid #ee76ad; } + .block-8 .accordion-item .heading > a[aria-expanded="false"]:before { + content: "\e313"; + color: #ccc; + font-family: 'icomoon'; + position: absolute; + -webkit-transition: .3s all ease; + -o-transition: .3s all ease; + transition: .3s all ease; } + +.block-8 .accordion-item .body-text { + font-size: 16px; + padding: 5px 0; + padding-left: 30px; } + +.block-4 .nonloop .owl-stage { + padding-bottom: 2em; } + +.block-4 .nonloop .owl-item { + -webkit-box-shadow: 0 7px 20px -5px rgba(0, 0, 0, 0.2); + box-shadow: 0 7px 20px -5px rgba(0, 0, 0, 0.2); } + +.block-4 .nonloop .owl-nav { + z-index: 2; + position: absolute; + width: 100%; + bottom: -2px; } + .block-4 .nonloop .owl-nav .owl-prev, .block-4 .nonloop .owl-nav .owl-next { + opacity: .2; + -webkit-transition: .3s all ease; + -o-transition: .3s all ease; + transition: .3s all ease; + position: absolute; } + .block-4 .nonloop .owl-nav .owl-prev:hover, .block-4 .nonloop .owl-nav .owl-next:hover { + opacity: 1; } + .block-4 .nonloop .owl-nav .owl-prev.disabled, .block-4 .nonloop .owl-nav .owl-next.disabled { + display: none; } + .block-4 .nonloop .owl-nav .owl-prev span, .block-4 .nonloop .owl-nav .owl-next span { + font-size: 30px; } + .block-4 .nonloop .owl-nav .owl-prev { + left: 50px; } + .block-4 .nonloop .owl-nav .owl-next { + right: 50px; } + +.block-4 .nonloop .owl-dots { + bottom: -40px; + position: absolute; + width: 100%; + text-align: center; } + .block-4 .nonloop .owl-dots .owl-dot { + display: inline-block; + width: 8px; + height: 8px; + background: #ccc; + border-radius: 50%; + margin-right: 10px; + margin-bottom: 10px; + -webkit-transition: .3s all ease; + -o-transition: .3s all ease; + transition: .3s all ease; } + .block-4 .nonloop .owl-dots .owl-dot.active { + background: #ee76ad; } + +.contact-section { + margin-top: -250px; } + .contact-section .container { + z-index: 2; + padding: 30px; } + @media (min-width: 768px) { + .contact-section .container { + padding: 70px; } } + .contact-section .contact-info p a { + color: #59595e; } + +.block-9 .form-control { + outline: none !important; + -webkit-box-shadow: none !important; + box-shadow: none !important; + font-size: 15px; } + +.block-21 .blog-img { + display: block; + height: 80px; + width: 80px; } + +.block-21 .text { + width: calc(100% - 100px); } + .block-21 .text .heading { + font-size: 18px; + font-weight: 300; } + .block-21 .text .heading a { + color: #404044; } + .block-21 .text .heading a:hover, .block-21 .text .heading a:active, .block-21 .text .heading a:focus { + color: #ee76ad; } + .block-21 .text .meta > div { + display: inline-block; + font-size: 12px; + margin-right: 5px; } + .block-21 .text .meta > div a { + color: #c0c0c3; } + +.custom-pagination { + width: 100%; + text-align: center; + display: inline-block; } + .custom-pagination li { + display: inline-block; } + .custom-pagination .prev a, .custom-pagination .next a { + font-size: 20px !important; + line-height: 38px !important; } + .custom-pagination li a, .custom-pagination .prev a, .custom-pagination .next a { + width: 40px; + height: 40px; + line-height: 40px; + padding: 0; + margin: 0; + border-radius: 50% !important; + font-size: 16px; } + .custom-pagination li.active a, .custom-pagination .prev.active a, .custom-pagination .next.active a { + display: block; + width: 40px; + height: 40px; + line-height: 40px; + padding: 0; + margin: 0; + border-radius: 50% !important; + font-size: 16px; + background: #ee76ad; + color: #fff; } + .custom-pagination li.active a:hover, .custom-pagination li.active a:focus, .custom-pagination .prev.active a:hover, .custom-pagination .prev.active a:focus, .custom-pagination .next.active a:hover, .custom-pagination .next.active a:focus { + color: #fff; } + .custom-pagination .prev { + float: left; } + .custom-pagination .next { + float: right; } + +/* Blog*/ +.post-info { + font-size: 12px; + text-transform: uppercase; + font-weight: bold; + color: #fff; + letter-spacing: .1em; } + .post-info > div { + display: inline-block; } + .post-info > div .separator { + display: inline-block; + margin: 0 10px; + opacity: .5; } + +.tagcloud a { + text-transform: uppercase; + display: inline-block; + padding: 4px 10px; + margin-bottom: 7px; + margin-right: 4px; + border-radius: 4px; + color: #404044; + border: 1px solid #ccc; + font-size: 11px; } + .tagcloud a:hover { + border: 1px solid #000; } + +.comment-form-wrap { + clear: both; } + +.comment-list { + padding: 0; + margin: 0; } + .comment-list .children { + padding: 50px 0 0 40px; + margin: 0; + float: left; + width: 100%; } + .comment-list li { + padding: 0; + margin: 0 0 30px 0; + float: left; + width: 100%; + clear: both; + list-style: none; } + .comment-list li .vcard { + width: 80px; + float: left; } + .comment-list li .vcard img { + width: 50px; + border-radius: 50%; } + .comment-list li .comment-body { + float: right; + width: calc(100% - 80px); } + .comment-list li .comment-body h3 { + font-size: 20px; } + .comment-list li .comment-body .meta { + text-transform: uppercase; + font-size: 13px; + letter-spacing: .1em; + color: #ccc; } + .comment-list li .comment-body .reply { + padding: 5px 10px; + background: #f4f4f5; + color: #404044; + text-transform: uppercase; + font-size: 11px; + letter-spacing: .1em; + font-weight: 400; + border-radius: 4px; } + .comment-list li .comment-body .reply:hover { + color: #fff; + background: #404044; } + +.search-form { + background: #f4f4f5; + padding: 10px; } + .search-form .form-group { + position: relative; } + .search-form .form-group input { + padding-right: 50px; } + .search-form .icon { + position: absolute; + top: 50%; + right: 20px; + -webkit-transform: translateY(-50%); + -ms-transform: translateY(-50%); + transform: translateY(-50%); } + +.subscribe-form .form-group { + position: relative; + margin-bottom: 0; } + .subscribe-form .form-group input { + padding-right: 50px; + background: transparent !important; + border: 1px solid rgba(255, 255, 255, 0.7); + color: rgba(255, 255, 255, 0.8) !important; + -webkit-border-radius: 30px; + -moz-border-radius: 30px; + -ms-border-radius: 30px; + border-radius: 30px; } + .subscribe-form .form-group input::-webkit-input-placeholder { + /* Chrome/Opera/Safari */ + color: rgba(255, 255, 255, 0.8) !important; } + .subscribe-form .form-group input::-moz-placeholder { + /* Firefox 19+ */ + color: rgba(255, 255, 255, 0.8) !important; } + .subscribe-form .form-group input:-ms-input-placeholder { + /* IE 10+ */ + color: rgba(255, 255, 255, 0.8) !important; } + .subscribe-form .form-group input:-moz-placeholder { + /* Firefox 18- */ + color: rgba(255, 255, 255, 0.8) !important; } + +.subscribe-form .icon { + position: absolute; + top: 50%; + right: 20px; + -webkit-transform: translateY(-50%); + -ms-transform: translateY(-50%); + transform: translateY(-50%); + color: rgba(255, 255, 255, 0.8); } + +.sidebar-box { + margin-bottom: 30px; + padding: 25px; + font-size: 15px; + width: 100%; + float: left; + background: #fff; } + .sidebar-box *:last-child { + margin-bottom: 0; } + .sidebar-box h3 { + font-size: 18px; + margin-bottom: 15px; } + +.categories li, .sidelink li { + position: relative; + margin-bottom: 10px; + padding-bottom: 10px; + border-bottom: 1px dotted #dee2e6; + list-style: none; } + .categories li:last-child, .sidelink li:last-child { + margin-bottom: 0; + border-bottom: none; + padding-bottom: 0; } + .categories li a, .sidelink li a { + display: block; } + .categories li a span, .sidelink li a span { + position: absolute; + right: 0; + top: 0; + color: #ccc; } + .categories li.active a, .sidelink li.active a { + color: #404044; + font-style: italic; } + +#ftco-loader { + position: fixed; + width: 96px; + height: 96px; + left: 50%; + top: 50%; + -webkit-transform: translate(-50%, -50%); + -ms-transform: translate(-50%, -50%); + transform: translate(-50%, -50%); + background-color: rgba(255, 255, 255, 0.9); + -webkit-box-shadow: 0px 24px 64px rgba(0, 0, 0, 0.24); + box-shadow: 0px 24px 64px rgba(0, 0, 0, 0.24); + border-radius: 16px; + opacity: 0; + visibility: hidden; + -webkit-transition: opacity .2s ease-out, visibility 0s linear .2s; + -o-transition: opacity .2s ease-out, visibility 0s linear .2s; + transition: opacity .2s ease-out, visibility 0s linear .2s; + z-index: 1000; } + +#ftco-loader.fullscreen { + padding: 0; + left: 0; + top: 0; + width: 100%; + height: 100%; + -webkit-transform: none; + -ms-transform: none; + transform: none; + background-color: #fff; + border-radius: 0; + -webkit-box-shadow: none; + box-shadow: none; } + +#ftco-loader.show { + -webkit-transition: opacity .4s ease-out, visibility 0s linear 0s; + -o-transition: opacity .4s ease-out, visibility 0s linear 0s; + transition: opacity .4s ease-out, visibility 0s linear 0s; + visibility: visible; + opacity: 1; } + +#ftco-loader .circular { + -webkit-animation: loader-rotate 2s linear infinite; + animation: loader-rotate 2s linear infinite; + position: absolute; + left: calc(50% - 24px); + top: calc(50% - 24px); + display: block; + -webkit-transform: rotate(0deg); + -ms-transform: rotate(0deg); + transform: rotate(0deg); } + +#ftco-loader .path { + stroke-dasharray: 1, 200; + stroke-dashoffset: 0; + -webkit-animation: loader-dash 1.5s ease-in-out infinite; + animation: loader-dash 1.5s ease-in-out infinite; + stroke-linecap: round; } + +@-webkit-keyframes loader-rotate { + 100% { + -webkit-transform: rotate(360deg); + transform: rotate(360deg); } } + +@keyframes loader-rotate { + 100% { + -webkit-transform: rotate(360deg); + transform: rotate(360deg); } } + +@-webkit-keyframes loader-dash { + 0% { + stroke-dasharray: 1, 200; + stroke-dashoffset: 0; } + 50% { + stroke-dasharray: 89, 200; + stroke-dashoffset: -35px; } + 100% { + stroke-dasharray: 89, 200; + stroke-dashoffset: -136px; } } + +@keyframes loader-dash { + 0% { + stroke-dasharray: 1, 200; + stroke-dashoffset: 0; } + 50% { + stroke-dasharray: 89, 200; + stroke-dashoffset: -35px; } + 100% { + stroke-dasharray: 89, 200; + stroke-dashoffset: -136px; } } + + .caption { + color: #999; + font-style: italic; + line-height: 1.3em; + margin-top: -1.5em; + } diff --git a/assets/js/aos.js b/assets/js/aos.js new file mode 100644 index 0000000000..2d37d780ae --- /dev/null +++ b/assets/js/aos.js @@ -0,0 +1,2 @@ +!function(e,t){"object"==typeof exports&&"object"==typeof module?module.exports=t():"function"==typeof define&&define.amd?define([],t):"object"==typeof exports?exports.AOS=t():e.AOS=t()}(this,function(){return function(e){function t(o){if(n[o])return n[o].exports;var i=n[o]={exports:{},id:o,loaded:!1};return e[o].call(i.exports,i,i.exports,t),i.loaded=!0,i.exports}var n={};return t.m=e,t.c=n,t.p="dist/",t(0)}([function(e,t,n){"use strict";function o(e){return e&&e.__esModule?e:{default:e}}var i=Object.assign||function(e){for(var t=1;t0&&void 0!==arguments[0]&&arguments[0];if(e&&(k=!0),k)return w=(0,y.default)(w,j),(0,b.default)(w,j.once),w},S=function(){w=(0,h.default)(),O()},_=function(){w.forEach(function(e,t){e.node.removeAttribute("data-aos"),e.node.removeAttribute("data-aos-easing"),e.node.removeAttribute("data-aos-duration"),e.node.removeAttribute("data-aos-delay")})},E=function(e){return e===!0||"mobile"===e&&p.default.mobile()||"phone"===e&&p.default.phone()||"tablet"===e&&p.default.tablet()||"function"==typeof e&&e()===!0},z=function(e){return j=i(j,e),w=(0,h.default)(),E(j.disable)||x?_():(document.querySelector("body").setAttribute("data-aos-easing",j.easing),document.querySelector("body").setAttribute("data-aos-duration",j.duration),document.querySelector("body").setAttribute("data-aos-delay",j.delay),"DOMContentLoaded"===j.startEvent&&["complete","interactive"].indexOf(document.readyState)>-1?O(!0):"load"===j.startEvent?window.addEventListener(j.startEvent,function(){O(!0)}):document.addEventListener(j.startEvent,function(){O(!0)}),window.addEventListener("resize",(0,f.default)(O,50,!0)),window.addEventListener("orientationchange",(0,f.default)(O,50,!0)),window.addEventListener("scroll",(0,u.default)(function(){(0,b.default)(w,j.once)},99)),document.addEventListener("DOMNodeRemoved",function(e){var t=e.target;t&&1===t.nodeType&&t.hasAttribute&&t.hasAttribute("data-aos")&&(0,f.default)(S,50,!0)}),(0,d.default)("[data-aos]",S),w)};e.exports={init:z,refresh:O,refreshHard:S}},function(e,t){},,,,,function(e,t){(function(t){"use strict";function n(e,t,n){function o(t){var n=b,o=v;return b=v=void 0,k=t,g=e.apply(o,n)}function r(e){return k=e,h=setTimeout(s,t),S?o(e):g}function a(e){var n=e-w,o=e-k,i=t-n;return _?j(i,y-o):i}function c(e){var n=e-w,o=e-k;return void 0===w||n>=t||n<0||_&&o>=y}function s(){var e=O();return c(e)?d(e):void(h=setTimeout(s,a(e)))}function d(e){return h=void 0,E&&b?o(e):(b=v=void 0,g)}function l(){void 0!==h&&clearTimeout(h),k=0,b=w=v=h=void 0}function p(){return void 0===h?g:d(O())}function m(){var e=O(),n=c(e);if(b=arguments,v=this,w=e,n){if(void 0===h)return r(w);if(_)return h=setTimeout(s,t),o(w)}return void 0===h&&(h=setTimeout(s,t)),g}var b,v,y,g,h,w,k=0,S=!1,_=!1,E=!0;if("function"!=typeof e)throw new TypeError(f);return t=u(t)||0,i(n)&&(S=!!n.leading,_="maxWait"in n,y=_?x(u(n.maxWait)||0,t):y,E="trailing"in n?!!n.trailing:E),m.cancel=l,m.flush=p,m}function o(e,t,o){var r=!0,a=!0;if("function"!=typeof e)throw new TypeError(f);return i(o)&&(r="leading"in o?!!o.leading:r,a="trailing"in o?!!o.trailing:a),n(e,t,{leading:r,maxWait:t,trailing:a})}function i(e){var t="undefined"==typeof e?"undefined":c(e);return!!e&&("object"==t||"function"==t)}function r(e){return!!e&&"object"==("undefined"==typeof e?"undefined":c(e))}function a(e){return"symbol"==("undefined"==typeof e?"undefined":c(e))||r(e)&&k.call(e)==d}function u(e){if("number"==typeof e)return e;if(a(e))return s;if(i(e)){var t="function"==typeof e.valueOf?e.valueOf():e;e=i(t)?t+"":t}if("string"!=typeof e)return 0===e?e:+e;e=e.replace(l,"");var n=m.test(e);return n||b.test(e)?v(e.slice(2),n?2:8):p.test(e)?s:+e}var c="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(e){return typeof e}:function(e){return e&&"function"==typeof Symbol&&e.constructor===Symbol&&e!==Symbol.prototype?"symbol":typeof e},f="Expected a function",s=NaN,d="[object Symbol]",l=/^\s+|\s+$/g,p=/^[-+]0x[0-9a-f]+$/i,m=/^0b[01]+$/i,b=/^0o[0-7]+$/i,v=parseInt,y="object"==("undefined"==typeof t?"undefined":c(t))&&t&&t.Object===Object&&t,g="object"==("undefined"==typeof self?"undefined":c(self))&&self&&self.Object===Object&&self,h=y||g||Function("return this")(),w=Object.prototype,k=w.toString,x=Math.max,j=Math.min,O=function(){return h.Date.now()};e.exports=o}).call(t,function(){return this}())},function(e,t){(function(t){"use strict";function n(e,t,n){function i(t){var n=b,o=v;return b=v=void 0,O=t,g=e.apply(o,n)}function r(e){return O=e,h=setTimeout(s,t),S?i(e):g}function u(e){var n=e-w,o=e-O,i=t-n;return _?x(i,y-o):i}function f(e){var n=e-w,o=e-O;return void 0===w||n>=t||n<0||_&&o>=y}function s(){var e=j();return f(e)?d(e):void(h=setTimeout(s,u(e)))}function d(e){return h=void 0,E&&b?i(e):(b=v=void 0,g)}function l(){void 0!==h&&clearTimeout(h),O=0,b=w=v=h=void 0}function p(){return void 0===h?g:d(j())}function m(){var e=j(),n=f(e);if(b=arguments,v=this,w=e,n){if(void 0===h)return r(w);if(_)return h=setTimeout(s,t),i(w)}return void 0===h&&(h=setTimeout(s,t)),g}var b,v,y,g,h,w,O=0,S=!1,_=!1,E=!0;if("function"!=typeof e)throw new TypeError(c);return t=a(t)||0,o(n)&&(S=!!n.leading,_="maxWait"in n,y=_?k(a(n.maxWait)||0,t):y,E="trailing"in n?!!n.trailing:E),m.cancel=l,m.flush=p,m}function o(e){var t="undefined"==typeof e?"undefined":u(e);return!!e&&("object"==t||"function"==t)}function i(e){return!!e&&"object"==("undefined"==typeof e?"undefined":u(e))}function r(e){return"symbol"==("undefined"==typeof e?"undefined":u(e))||i(e)&&w.call(e)==s}function a(e){if("number"==typeof e)return e;if(r(e))return f;if(o(e)){var t="function"==typeof e.valueOf?e.valueOf():e;e=o(t)?t+"":t}if("string"!=typeof e)return 0===e?e:+e;e=e.replace(d,"");var n=p.test(e);return n||m.test(e)?b(e.slice(2),n?2:8):l.test(e)?f:+e}var u="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(e){return typeof e}:function(e){return e&&"function"==typeof Symbol&&e.constructor===Symbol&&e!==Symbol.prototype?"symbol":typeof e},c="Expected a function",f=NaN,s="[object Symbol]",d=/^\s+|\s+$/g,l=/^[-+]0x[0-9a-f]+$/i,p=/^0b[01]+$/i,m=/^0o[0-7]+$/i,b=parseInt,v="object"==("undefined"==typeof t?"undefined":u(t))&&t&&t.Object===Object&&t,y="object"==("undefined"==typeof self?"undefined":u(self))&&self&&self.Object===Object&&self,g=v||y||Function("return this")(),h=Object.prototype,w=h.toString,k=Math.max,x=Math.min,j=function(){return g.Date.now()};e.exports=n}).call(t,function(){return this}())},function(e,t){"use strict";function n(e,t){a.push({selector:e,fn:t}),!u&&r&&(u=new r(o),u.observe(i.documentElement,{childList:!0,subtree:!0,removedNodes:!0})),o()}function o(){for(var e,t,n=0,o=a.length;ne.position?e.node.classList.add("aos-animate"):"undefined"!=typeof o&&("false"===o||!n&&"true"!==o)&&e.node.classList.remove("aos-animate")},o=function(e,t){var o=window.pageYOffset,i=window.innerHeight;e.forEach(function(e,r){n(e,i+o,t)})};t.default=o},function(e,t,n){"use strict";function o(e){return e&&e.__esModule?e:{default:e}}Object.defineProperty(t,"__esModule",{value:!0});var i=n(12),r=o(i),a=function(e,t){return e.forEach(function(e,n){e.node.classList.add("aos-init"),e.position=(0,r.default)(e.node,t.offset)}),e};t.default=a},function(e,t,n){"use strict";function o(e){return e&&e.__esModule?e:{default:e}}Object.defineProperty(t,"__esModule",{value:!0});var i=n(13),r=o(i),a=function(e,t){var n=0,o=0,i=window.innerHeight,a={offset:e.getAttribute("data-aos-offset"),anchor:e.getAttribute("data-aos-anchor"),anchorPlacement:e.getAttribute("data-aos-anchor-placement")};switch(a.offset&&!isNaN(a.offset)&&(o=parseInt(a.offset)),a.anchor&&document.querySelectorAll(a.anchor)&&(e=document.querySelectorAll(a.anchor)[0]),n=(0,r.default)(e).top,a.anchorPlacement){case"top-bottom":break;case"center-bottom":n+=e.offsetHeight/2;break;case"bottom-bottom":n+=e.offsetHeight;break;case"top-center":n+=i/2;break;case"bottom-center":n+=i/2+e.offsetHeight;break;case"center-center":n+=i/2+e.offsetHeight/2;break;case"top-top":n+=i;break;case"bottom-top":n+=e.offsetHeight+i;break;case"center-top":n+=e.offsetHeight/2+i}return a.anchorPlacement||a.offset||isNaN(t)||(o=t),n+o};t.default=a},function(e,t){"use strict";Object.defineProperty(t,"__esModule",{value:!0});var n=function(e){for(var t=0,n=0;e&&!isNaN(e.offsetLeft)&&!isNaN(e.offsetTop);)t+=e.offsetLeft-("BODY"!=e.tagName?e.scrollLeft:0),n+=e.offsetTop-("BODY"!=e.tagName?e.scrollTop:0),e=e.offsetParent;return{top:n,left:t}};t.default=n},function(e,t){"use strict";Object.defineProperty(t,"__esModule",{value:!0});var n=function(e){e=e||document.querySelectorAll("[data-aos]");var t=[];return[].forEach.call(e,function(e,n){t.push({node:e})}),t};t.default=n}])}); +//# sourceMappingURL=aos.js.map \ No newline at end of file diff --git a/assets/js/bootstrap-datepicker.js b/assets/js/bootstrap-datepicker.js new file mode 100755 index 0000000000..5837410643 --- /dev/null +++ b/assets/js/bootstrap-datepicker.js @@ -0,0 +1,1671 @@ +/* ========================================================= + * bootstrap-datepicker.js + * Repo: https://github.com/eternicode/bootstrap-datepicker/ + * Demo: http://eternicode.github.io/bootstrap-datepicker/ + * Docs: http://bootstrap-datepicker.readthedocs.org/ + * Forked from http://www.eyecon.ro/bootstrap-datepicker + * ========================================================= + * Started by Stefan Petre; improvements by Andrew Rowls + contributors + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + * ========================================================= */ + +(function($, undefined){ + + var $window = $(window); + + function UTCDate(){ + return new Date(Date.UTC.apply(Date, arguments)); + } + function UTCToday(){ + var today = new Date(); + return UTCDate(today.getFullYear(), today.getMonth(), today.getDate()); + } + function alias(method){ + return function(){ + return this[method].apply(this, arguments); + }; + } + + var DateArray = (function(){ + var extras = { + get: function(i){ + return this.slice(i)[0]; + }, + contains: function(d){ + // Array.indexOf is not cross-browser; + // $.inArray doesn't work with Dates + var val = d && d.valueOf(); + for (var i=0, l=this.length; i < l; i++) + if (this[i].valueOf() === val) + return i; + return -1; + }, + remove: function(i){ + this.splice(i,1); + }, + replace: function(new_array){ + if (!new_array) + return; + if (!$.isArray(new_array)) + new_array = [new_array]; + this.clear(); + this.push.apply(this, new_array); + }, + clear: function(){ + this.splice(0); + }, + copy: function(){ + var a = new DateArray(); + a.replace(this); + return a; + } + }; + + return function(){ + var a = []; + a.push.apply(a, arguments); + $.extend(a, extras); + return a; + }; + })(); + + + // Picker object + + var Datepicker = function(element, options){ + this.dates = new DateArray(); + this.viewDate = UTCToday(); + this.focusDate = null; + + this._process_options(options); + + this.element = $(element); + this.isInline = false; + this.isInput = this.element.is('input'); + this.component = this.element.is('.date') ? this.element.find('.add-on, .input-group-addon, .btn') : false; + this.hasInput = this.component && this.element.find('input').length; + if (this.component && this.component.length === 0) + this.component = false; + + this.picker = $(DPGlobal.template); + this._buildEvents(); + this._attachEvents(); + + if (this.isInline){ + this.picker.addClass('datepicker-inline').appendTo(this.element); + } + else { + this.picker.addClass('datepicker-dropdown dropdown-menu'); + } + + if (this.o.rtl){ + this.picker.addClass('datepicker-rtl'); + } + + this.viewMode = this.o.startView; + + if (this.o.calendarWeeks) + this.picker.find('tfoot th.today') + .attr('colspan', function(i, val){ + return parseInt(val) + 1; + }); + + this._allow_update = false; + + this.setStartDate(this._o.startDate); + this.setEndDate(this._o.endDate); + this.setDaysOfWeekDisabled(this.o.daysOfWeekDisabled); + + this.fillDow(); + this.fillMonths(); + + this._allow_update = true; + + this.update(); + this.showMode(); + + if (this.isInline){ + this.show(); + } + }; + + Datepicker.prototype = { + constructor: Datepicker, + + _process_options: function(opts){ + // Store raw options for reference + this._o = $.extend({}, this._o, opts); + // Processed options + var o = this.o = $.extend({}, this._o); + + // Check if "de-DE" style date is available, if not language should + // fallback to 2 letter code eg "de" + var lang = o.language; + if (!dates[lang]){ + lang = lang.split('-')[0]; + if (!dates[lang]) + lang = defaults.language; + } + o.language = lang; + + switch (o.startView){ + case 2: + case 'decade': + o.startView = 2; + break; + case 1: + case 'year': + o.startView = 1; + break; + default: + o.startView = 0; + } + + switch (o.minViewMode){ + case 1: + case 'months': + o.minViewMode = 1; + break; + case 2: + case 'years': + o.minViewMode = 2; + break; + default: + o.minViewMode = 0; + } + + o.startView = Math.max(o.startView, o.minViewMode); + + // true, false, or Number > 0 + if (o.multidate !== true){ + o.multidate = Number(o.multidate) || false; + if (o.multidate !== false) + o.multidate = Math.max(0, o.multidate); + else + o.multidate = 1; + } + o.multidateSeparator = String(o.multidateSeparator); + + o.weekStart %= 7; + o.weekEnd = ((o.weekStart + 6) % 7); + + var format = DPGlobal.parseFormat(o.format); + if (o.startDate !== -Infinity){ + if (!!o.startDate){ + if (o.startDate instanceof Date) + o.startDate = this._local_to_utc(this._zero_time(o.startDate)); + else + o.startDate = DPGlobal.parseDate(o.startDate, format, o.language); + } + else { + o.startDate = -Infinity; + } + } + if (o.endDate !== Infinity){ + if (!!o.endDate){ + if (o.endDate instanceof Date) + o.endDate = this._local_to_utc(this._zero_time(o.endDate)); + else + o.endDate = DPGlobal.parseDate(o.endDate, format, o.language); + } + else { + o.endDate = Infinity; + } + } + + o.daysOfWeekDisabled = o.daysOfWeekDisabled||[]; + if (!$.isArray(o.daysOfWeekDisabled)) + o.daysOfWeekDisabled = o.daysOfWeekDisabled.split(/[,\s]*/); + o.daysOfWeekDisabled = $.map(o.daysOfWeekDisabled, function(d){ + return parseInt(d, 10); + }); + + var plc = String(o.orientation).toLowerCase().split(/\s+/g), + _plc = o.orientation.toLowerCase(); + plc = $.grep(plc, function(word){ + return (/^auto|left|right|top|bottom$/).test(word); + }); + o.orientation = {x: 'auto', y: 'auto'}; + if (!_plc || _plc === 'auto') + ; // no action + else if (plc.length === 1){ + switch (plc[0]){ + case 'top': + case 'bottom': + o.orientation.y = plc[0]; + break; + case 'left': + case 'right': + o.orientation.x = plc[0]; + break; + } + } + else { + _plc = $.grep(plc, function(word){ + return (/^left|right$/).test(word); + }); + o.orientation.x = _plc[0] || 'auto'; + + _plc = $.grep(plc, function(word){ + return (/^top|bottom$/).test(word); + }); + o.orientation.y = _plc[0] || 'auto'; + } + }, + _events: [], + _secondaryEvents: [], + _applyEvents: function(evs){ + for (var i=0, el, ch, ev; i < evs.length; i++){ + el = evs[i][0]; + if (evs[i].length === 2){ + ch = undefined; + ev = evs[i][1]; + } + else if (evs[i].length === 3){ + ch = evs[i][1]; + ev = evs[i][2]; + } + el.on(ev, ch); + } + }, + _unapplyEvents: function(evs){ + for (var i=0, el, ev, ch; i < evs.length; i++){ + el = evs[i][0]; + if (evs[i].length === 2){ + ch = undefined; + ev = evs[i][1]; + } + else if (evs[i].length === 3){ + ch = evs[i][1]; + ev = evs[i][2]; + } + el.off(ev, ch); + } + }, + _buildEvents: function(){ + if (this.isInput){ // single input + this._events = [ + [this.element, { + focus: $.proxy(this.show, this), + keyup: $.proxy(function(e){ + if ($.inArray(e.keyCode, [27,37,39,38,40,32,13,9]) === -1) + this.update(); + }, this), + keydown: $.proxy(this.keydown, this) + }] + ]; + } + else if (this.component && this.hasInput){ // component: input + button + this._events = [ + // For components that are not readonly, allow keyboard nav + [this.element.find('input'), { + focus: $.proxy(this.show, this), + keyup: $.proxy(function(e){ + if ($.inArray(e.keyCode, [27,37,39,38,40,32,13,9]) === -1) + this.update(); + }, this), + keydown: $.proxy(this.keydown, this) + }], + [this.component, { + click: $.proxy(this.show, this) + }] + ]; + } + else if (this.element.is('div')){ // inline datepicker + this.isInline = true; + } + else { + this._events = [ + [this.element, { + click: $.proxy(this.show, this) + }] + ]; + } + this._events.push( + // Component: listen for blur on element descendants + [this.element, '*', { + blur: $.proxy(function(e){ + this._focused_from = e.target; + }, this) + }], + // Input: listen for blur on element + [this.element, { + blur: $.proxy(function(e){ + this._focused_from = e.target; + }, this) + }] + ); + + this._secondaryEvents = [ + [this.picker, { + click: $.proxy(this.click, this) + }], + [$(window), { + resize: $.proxy(this.place, this) + }], + [$(document), { + 'mousedown touchstart': $.proxy(function(e){ + // Clicked outside the datepicker, hide it + if (!( + this.element.is(e.target) || + this.element.find(e.target).length || + this.picker.is(e.target) || + this.picker.find(e.target).length + )){ + this.hide(); + } + }, this) + }] + ]; + }, + _attachEvents: function(){ + this._detachEvents(); + this._applyEvents(this._events); + }, + _detachEvents: function(){ + this._unapplyEvents(this._events); + }, + _attachSecondaryEvents: function(){ + this._detachSecondaryEvents(); + this._applyEvents(this._secondaryEvents); + }, + _detachSecondaryEvents: function(){ + this._unapplyEvents(this._secondaryEvents); + }, + _trigger: function(event, altdate){ + var date = altdate || this.dates.get(-1), + local_date = this._utc_to_local(date); + + this.element.trigger({ + type: event, + date: local_date, + dates: $.map(this.dates, this._utc_to_local), + format: $.proxy(function(ix, format){ + if (arguments.length === 0){ + ix = this.dates.length - 1; + format = this.o.format; + } + else if (typeof ix === 'string'){ + format = ix; + ix = this.dates.length - 1; + } + format = format || this.o.format; + var date = this.dates.get(ix); + return DPGlobal.formatDate(date, format, this.o.language); + }, this) + }); + }, + + show: function(){ + if (!this.isInline) + this.picker.appendTo('body'); + this.picker.show(); + this.place(); + this._attachSecondaryEvents(); + this._trigger('show'); + }, + + hide: function(){ + if (this.isInline) + return; + if (!this.picker.is(':visible')) + return; + this.focusDate = null; + this.picker.hide().detach(); + this._detachSecondaryEvents(); + this.viewMode = this.o.startView; + this.showMode(); + + if ( + this.o.forceParse && + ( + this.isInput && this.element.val() || + this.hasInput && this.element.find('input').val() + ) + ) + this.setValue(); + this._trigger('hide'); + }, + + remove: function(){ + this.hide(); + this._detachEvents(); + this._detachSecondaryEvents(); + this.picker.remove(); + delete this.element.data().datepicker; + if (!this.isInput){ + delete this.element.data().date; + } + }, + + _utc_to_local: function(utc){ + return utc && new Date(utc.getTime() + (utc.getTimezoneOffset()*60000)); + }, + _local_to_utc: function(local){ + return local && new Date(local.getTime() - (local.getTimezoneOffset()*60000)); + }, + _zero_time: function(local){ + return local && new Date(local.getFullYear(), local.getMonth(), local.getDate()); + }, + _zero_utc_time: function(utc){ + return utc && new Date(Date.UTC(utc.getUTCFullYear(), utc.getUTCMonth(), utc.getUTCDate())); + }, + + getDates: function(){ + return $.map(this.dates, this._utc_to_local); + }, + + getUTCDates: function(){ + return $.map(this.dates, function(d){ + return new Date(d); + }); + }, + + getDate: function(){ + return this._utc_to_local(this.getUTCDate()); + }, + + getUTCDate: function(){ + return new Date(this.dates.get(-1)); + }, + + setDates: function(){ + var args = $.isArray(arguments[0]) ? arguments[0] : arguments; + this.update.apply(this, args); + this._trigger('changeDate'); + this.setValue(); + }, + + setUTCDates: function(){ + var args = $.isArray(arguments[0]) ? arguments[0] : arguments; + this.update.apply(this, $.map(args, this._utc_to_local)); + this._trigger('changeDate'); + this.setValue(); + }, + + setDate: alias('setDates'), + setUTCDate: alias('setUTCDates'), + + setValue: function(){ + var formatted = this.getFormattedDate(); + if (!this.isInput){ + if (this.component){ + this.element.find('input').val(formatted).change(); + } + } + else { + this.element.val(formatted).change(); + } + }, + + getFormattedDate: function(format){ + if (format === undefined) + format = this.o.format; + + var lang = this.o.language; + return $.map(this.dates, function(d){ + return DPGlobal.formatDate(d, format, lang); + }).join(this.o.multidateSeparator); + }, + + setStartDate: function(startDate){ + this._process_options({startDate: startDate}); + this.update(); + this.updateNavArrows(); + }, + + setEndDate: function(endDate){ + this._process_options({endDate: endDate}); + this.update(); + this.updateNavArrows(); + }, + + setDaysOfWeekDisabled: function(daysOfWeekDisabled){ + this._process_options({daysOfWeekDisabled: daysOfWeekDisabled}); + this.update(); + this.updateNavArrows(); + }, + + place: function(){ + if (this.isInline) + return; + var calendarWidth = this.picker.outerWidth(), + calendarHeight = this.picker.outerHeight(), + visualPadding = 10, + windowWidth = $window.width(), + windowHeight = $window.height(), + scrollTop = $window.scrollTop(); + + var zIndex = parseInt(this.element.parents().filter(function(){ + return $(this).css('z-index') !== 'auto'; + }).first().css('z-index'))+10; + var offset = this.component ? this.component.parent().offset() : this.element.offset(); + var height = this.component ? this.component.outerHeight(true) : this.element.outerHeight(false); + var width = this.component ? this.component.outerWidth(true) : this.element.outerWidth(false); + var left = offset.left, + top = offset.top; + + this.picker.removeClass( + 'datepicker-orient-top datepicker-orient-bottom '+ + 'datepicker-orient-right datepicker-orient-left' + ); + + if (this.o.orientation.x !== 'auto'){ + this.picker.addClass('datepicker-orient-' + this.o.orientation.x); + if (this.o.orientation.x === 'right') + left -= calendarWidth - width; + } + // auto x orientation is best-placement: if it crosses a window + // edge, fudge it sideways + else { + // Default to left + this.picker.addClass('datepicker-orient-left'); + if (offset.left < 0) + left -= offset.left - visualPadding; + else if (offset.left + calendarWidth > windowWidth) + left = windowWidth - calendarWidth - visualPadding; + } + + // auto y orientation is best-situation: top or bottom, no fudging, + // decision based on which shows more of the calendar + var yorient = this.o.orientation.y, + top_overflow, bottom_overflow; + if (yorient === 'auto'){ + top_overflow = -scrollTop + offset.top - calendarHeight; + bottom_overflow = scrollTop + windowHeight - (offset.top + height + calendarHeight); + if (Math.max(top_overflow, bottom_overflow) === bottom_overflow) + yorient = 'top'; + else + yorient = 'bottom'; + } + this.picker.addClass('datepicker-orient-' + yorient); + if (yorient === 'top') + top += height; + else + top -= calendarHeight + parseInt(this.picker.css('padding-top')); + + this.picker.css({ + top: top, + left: left, + zIndex: zIndex + }); + }, + + _allow_update: true, + update: function(){ + if (!this._allow_update) + return; + + var oldDates = this.dates.copy(), + dates = [], + fromArgs = false; + if (arguments.length){ + $.each(arguments, $.proxy(function(i, date){ + if (date instanceof Date) + date = this._local_to_utc(date); + dates.push(date); + }, this)); + fromArgs = true; + } + else { + dates = this.isInput + ? this.element.val() + : this.element.data('date') || this.element.find('input').val(); + if (dates && this.o.multidate) + dates = dates.split(this.o.multidateSeparator); + else + dates = [dates]; + delete this.element.data().date; + } + + dates = $.map(dates, $.proxy(function(date){ + return DPGlobal.parseDate(date, this.o.format, this.o.language); + }, this)); + dates = $.grep(dates, $.proxy(function(date){ + return ( + date < this.o.startDate || + date > this.o.endDate || + !date + ); + }, this), true); + this.dates.replace(dates); + + if (this.dates.length) + this.viewDate = new Date(this.dates.get(-1)); + else if (this.viewDate < this.o.startDate) + this.viewDate = new Date(this.o.startDate); + else if (this.viewDate > this.o.endDate) + this.viewDate = new Date(this.o.endDate); + + if (fromArgs){ + // setting date by clicking + this.setValue(); + } + else if (dates.length){ + // setting date by typing + if (String(oldDates) !== String(this.dates)) + this._trigger('changeDate'); + } + if (!this.dates.length && oldDates.length) + this._trigger('clearDate'); + + this.fill(); + }, + + fillDow: function(){ + var dowCnt = this.o.weekStart, + html = ''; + if (this.o.calendarWeeks){ + var cell = ' '; + html += cell; + this.picker.find('.datepicker-days thead tr:first-child').prepend(cell); + } + while (dowCnt < this.o.weekStart + 7){ + html += ''+dates[this.o.language].daysMin[(dowCnt++)%7]+''; + } + html += ''; + this.picker.find('.datepicker-days thead').append(html); + }, + + fillMonths: function(){ + var html = '', + i = 0; + while (i < 12){ + html += ''+dates[this.o.language].monthsShort[i++]+''; + } + this.picker.find('.datepicker-months td').html(html); + }, + + setRange: function(range){ + if (!range || !range.length) + delete this.range; + else + this.range = $.map(range, function(d){ + return d.valueOf(); + }); + this.fill(); + }, + + getClassNames: function(date){ + var cls = [], + year = this.viewDate.getUTCFullYear(), + month = this.viewDate.getUTCMonth(), + today = new Date(); + if (date.getUTCFullYear() < year || (date.getUTCFullYear() === year && date.getUTCMonth() < month)){ + cls.push('old'); + } + else if (date.getUTCFullYear() > year || (date.getUTCFullYear() === year && date.getUTCMonth() > month)){ + cls.push('new'); + } + if (this.focusDate && date.valueOf() === this.focusDate.valueOf()) + cls.push('focused'); + // Compare internal UTC date with local today, not UTC today + if (this.o.todayHighlight && + date.getUTCFullYear() === today.getFullYear() && + date.getUTCMonth() === today.getMonth() && + date.getUTCDate() === today.getDate()){ + cls.push('today'); + } + if (this.dates.contains(date) !== -1) + cls.push('active'); + if (date.valueOf() < this.o.startDate || date.valueOf() > this.o.endDate || + $.inArray(date.getUTCDay(), this.o.daysOfWeekDisabled) !== -1){ + cls.push('disabled'); + } + if (this.range){ + if (date > this.range[0] && date < this.range[this.range.length-1]){ + cls.push('range'); + } + if ($.inArray(date.valueOf(), this.range) !== -1){ + cls.push('selected'); + } + } + return cls; + }, + + fill: function(){ + var d = new Date(this.viewDate), + year = d.getUTCFullYear(), + month = d.getUTCMonth(), + startYear = this.o.startDate !== -Infinity ? this.o.startDate.getUTCFullYear() : -Infinity, + startMonth = this.o.startDate !== -Infinity ? this.o.startDate.getUTCMonth() : -Infinity, + endYear = this.o.endDate !== Infinity ? this.o.endDate.getUTCFullYear() : Infinity, + endMonth = this.o.endDate !== Infinity ? this.o.endDate.getUTCMonth() : Infinity, + todaytxt = dates[this.o.language].today || dates['en'].today || '', + cleartxt = dates[this.o.language].clear || dates['en'].clear || '', + tooltip; + this.picker.find('.datepicker-days thead th.datepicker-switch') + .text(dates[this.o.language].months[month]+' '+year); + this.picker.find('tfoot th.today') + .text(todaytxt) + .toggle(this.o.todayBtn !== false); + this.picker.find('tfoot th.clear') + .text(cleartxt) + .toggle(this.o.clearBtn !== false); + this.updateNavArrows(); + this.fillMonths(); + var prevMonth = UTCDate(year, month-1, 28), + day = DPGlobal.getDaysInMonth(prevMonth.getUTCFullYear(), prevMonth.getUTCMonth()); + prevMonth.setUTCDate(day); + prevMonth.setUTCDate(day - (prevMonth.getUTCDay() - this.o.weekStart + 7)%7); + var nextMonth = new Date(prevMonth); + nextMonth.setUTCDate(nextMonth.getUTCDate() + 42); + nextMonth = nextMonth.valueOf(); + var html = []; + var clsName; + while (prevMonth.valueOf() < nextMonth){ + if (prevMonth.getUTCDay() === this.o.weekStart){ + html.push(''); + if (this.o.calendarWeeks){ + // ISO 8601: First week contains first thursday. + // ISO also states week starts on Monday, but we can be more abstract here. + var + // Start of current week: based on weekstart/current date + ws = new Date(+prevMonth + (this.o.weekStart - prevMonth.getUTCDay() - 7) % 7 * 864e5), + // Thursday of this week + th = new Date(Number(ws) + (7 + 4 - ws.getUTCDay()) % 7 * 864e5), + // First Thursday of year, year from thursday + yth = new Date(Number(yth = UTCDate(th.getUTCFullYear(), 0, 1)) + (7 + 4 - yth.getUTCDay())%7*864e5), + // Calendar week: ms between thursdays, div ms per day, div 7 days + calWeek = (th - yth) / 864e5 / 7 + 1; + html.push(''+ calWeek +''); + + } + } + clsName = this.getClassNames(prevMonth); + clsName.push('day'); + + if (this.o.beforeShowDay !== $.noop){ + var before = this.o.beforeShowDay(this._utc_to_local(prevMonth)); + if (before === undefined) + before = {}; + else if (typeof(before) === 'boolean') + before = {enabled: before}; + else if (typeof(before) === 'string') + before = {classes: before}; + if (before.enabled === false) + clsName.push('disabled'); + if (before.classes) + clsName = clsName.concat(before.classes.split(/\s+/)); + if (before.tooltip) + tooltip = before.tooltip; + } + + clsName = $.unique(clsName); + html.push(''+prevMonth.getUTCDate() + ''); + if (prevMonth.getUTCDay() === this.o.weekEnd){ + html.push(''); + } + prevMonth.setUTCDate(prevMonth.getUTCDate()+1); + } + this.picker.find('.datepicker-days tbody').empty().append(html.join('')); + + var months = this.picker.find('.datepicker-months') + .find('th:eq(1)') + .text(year) + .end() + .find('span').removeClass('active'); + + $.each(this.dates, function(i, d){ + if (d.getUTCFullYear() === year) + months.eq(d.getUTCMonth()).addClass('active'); + }); + + if (year < startYear || year > endYear){ + months.addClass('disabled'); + } + if (year === startYear){ + months.slice(0, startMonth).addClass('disabled'); + } + if (year === endYear){ + months.slice(endMonth+1).addClass('disabled'); + } + + html = ''; + year = parseInt(year/10, 10) * 10; + var yearCont = this.picker.find('.datepicker-years') + .find('th:eq(1)') + .text(year + '-' + (year + 9)) + .end() + .find('td'); + year -= 1; + var years = $.map(this.dates, function(d){ + return d.getUTCFullYear(); + }), + classes; + for (var i = -1; i < 11; i++){ + classes = ['year']; + if (i === -1) + classes.push('old'); + else if (i === 10) + classes.push('new'); + if ($.inArray(year, years) !== -1) + classes.push('active'); + if (year < startYear || year > endYear) + classes.push('disabled'); + html += ''+year+''; + year += 1; + } + yearCont.html(html); + }, + + updateNavArrows: function(){ + if (!this._allow_update) + return; + + var d = new Date(this.viewDate), + year = d.getUTCFullYear(), + month = d.getUTCMonth(); + switch (this.viewMode){ + case 0: + if (this.o.startDate !== -Infinity && year <= this.o.startDate.getUTCFullYear() && month <= this.o.startDate.getUTCMonth()){ + this.picker.find('.prev').css({visibility: 'hidden'}); + } + else { + this.picker.find('.prev').css({visibility: 'visible'}); + } + if (this.o.endDate !== Infinity && year >= this.o.endDate.getUTCFullYear() && month >= this.o.endDate.getUTCMonth()){ + this.picker.find('.next').css({visibility: 'hidden'}); + } + else { + this.picker.find('.next').css({visibility: 'visible'}); + } + break; + case 1: + case 2: + if (this.o.startDate !== -Infinity && year <= this.o.startDate.getUTCFullYear()){ + this.picker.find('.prev').css({visibility: 'hidden'}); + } + else { + this.picker.find('.prev').css({visibility: 'visible'}); + } + if (this.o.endDate !== Infinity && year >= this.o.endDate.getUTCFullYear()){ + this.picker.find('.next').css({visibility: 'hidden'}); + } + else { + this.picker.find('.next').css({visibility: 'visible'}); + } + break; + } + }, + + click: function(e){ + e.preventDefault(); + var target = $(e.target).closest('span, td, th'), + year, month, day; + if (target.length === 1){ + switch (target[0].nodeName.toLowerCase()){ + case 'th': + switch (target[0].className){ + case 'datepicker-switch': + this.showMode(1); + break; + case 'prev': + case 'next': + var dir = DPGlobal.modes[this.viewMode].navStep * (target[0].className === 'prev' ? -1 : 1); + switch (this.viewMode){ + case 0: + this.viewDate = this.moveMonth(this.viewDate, dir); + this._trigger('changeMonth', this.viewDate); + break; + case 1: + case 2: + this.viewDate = this.moveYear(this.viewDate, dir); + if (this.viewMode === 1) + this._trigger('changeYear', this.viewDate); + break; + } + this.fill(); + break; + case 'today': + var date = new Date(); + date = UTCDate(date.getFullYear(), date.getMonth(), date.getDate(), 0, 0, 0); + + this.showMode(-2); + var which = this.o.todayBtn === 'linked' ? null : 'view'; + this._setDate(date, which); + break; + case 'clear': + var element; + if (this.isInput) + element = this.element; + else if (this.component) + element = this.element.find('input'); + if (element) + element.val("").change(); + this.update(); + this._trigger('changeDate'); + if (this.o.autoclose) + this.hide(); + break; + } + break; + case 'span': + if (!target.is('.disabled')){ + this.viewDate.setUTCDate(1); + if (target.is('.month')){ + day = 1; + month = target.parent().find('span').index(target); + year = this.viewDate.getUTCFullYear(); + this.viewDate.setUTCMonth(month); + this._trigger('changeMonth', this.viewDate); + if (this.o.minViewMode === 1){ + this._setDate(UTCDate(year, month, day)); + } + } + else { + day = 1; + month = 0; + year = parseInt(target.text(), 10)||0; + this.viewDate.setUTCFullYear(year); + this._trigger('changeYear', this.viewDate); + if (this.o.minViewMode === 2){ + this._setDate(UTCDate(year, month, day)); + } + } + this.showMode(-1); + this.fill(); + } + break; + case 'td': + if (target.is('.day') && !target.is('.disabled')){ + day = parseInt(target.text(), 10)||1; + year = this.viewDate.getUTCFullYear(); + month = this.viewDate.getUTCMonth(); + if (target.is('.old')){ + if (month === 0){ + month = 11; + year -= 1; + } + else { + month -= 1; + } + } + else if (target.is('.new')){ + if (month === 11){ + month = 0; + year += 1; + } + else { + month += 1; + } + } + this._setDate(UTCDate(year, month, day)); + } + break; + } + } + if (this.picker.is(':visible') && this._focused_from){ + $(this._focused_from).focus(); + } + delete this._focused_from; + }, + + _toggle_multidate: function(date){ + var ix = this.dates.contains(date); + if (!date){ + this.dates.clear(); + } + else if (ix !== -1){ + this.dates.remove(ix); + } + else { + this.dates.push(date); + } + if (typeof this.o.multidate === 'number') + while (this.dates.length > this.o.multidate) + this.dates.remove(0); + }, + + _setDate: function(date, which){ + if (!which || which === 'date') + this._toggle_multidate(date && new Date(date)); + if (!which || which === 'view') + this.viewDate = date && new Date(date); + + this.fill(); + this.setValue(); + this._trigger('changeDate'); + var element; + if (this.isInput){ + element = this.element; + } + else if (this.component){ + element = this.element.find('input'); + } + if (element){ + element.change(); + } + if (this.o.autoclose && (!which || which === 'date')){ + this.hide(); + } + }, + + moveMonth: function(date, dir){ + if (!date) + return undefined; + if (!dir) + return date; + var new_date = new Date(date.valueOf()), + day = new_date.getUTCDate(), + month = new_date.getUTCMonth(), + mag = Math.abs(dir), + new_month, test; + dir = dir > 0 ? 1 : -1; + if (mag === 1){ + test = dir === -1 + // If going back one month, make sure month is not current month + // (eg, Mar 31 -> Feb 31 == Feb 28, not Mar 02) + ? function(){ + return new_date.getUTCMonth() === month; + } + // If going forward one month, make sure month is as expected + // (eg, Jan 31 -> Feb 31 == Feb 28, not Mar 02) + : function(){ + return new_date.getUTCMonth() !== new_month; + }; + new_month = month + dir; + new_date.setUTCMonth(new_month); + // Dec -> Jan (12) or Jan -> Dec (-1) -- limit expected date to 0-11 + if (new_month < 0 || new_month > 11) + new_month = (new_month + 12) % 12; + } + else { + // For magnitudes >1, move one month at a time... + for (var i=0; i < mag; i++) + // ...which might decrease the day (eg, Jan 31 to Feb 28, etc)... + new_date = this.moveMonth(new_date, dir); + // ...then reset the day, keeping it in the new month + new_month = new_date.getUTCMonth(); + new_date.setUTCDate(day); + test = function(){ + return new_month !== new_date.getUTCMonth(); + }; + } + // Common date-resetting loop -- if date is beyond end of month, make it + // end of month + while (test()){ + new_date.setUTCDate(--day); + new_date.setUTCMonth(new_month); + } + return new_date; + }, + + moveYear: function(date, dir){ + return this.moveMonth(date, dir*12); + }, + + dateWithinRange: function(date){ + return date >= this.o.startDate && date <= this.o.endDate; + }, + + keydown: function(e){ + if (this.picker.is(':not(:visible)')){ + if (e.keyCode === 27) // allow escape to hide and re-show picker + this.show(); + return; + } + var dateChanged = false, + dir, newDate, newViewDate, + focusDate = this.focusDate || this.viewDate; + switch (e.keyCode){ + case 27: // escape + if (this.focusDate){ + this.focusDate = null; + this.viewDate = this.dates.get(-1) || this.viewDate; + this.fill(); + } + else + this.hide(); + e.preventDefault(); + break; + case 37: // left + case 39: // right + if (!this.o.keyboardNavigation) + break; + dir = e.keyCode === 37 ? -1 : 1; + if (e.ctrlKey){ + newDate = this.moveYear(this.dates.get(-1) || UTCToday(), dir); + newViewDate = this.moveYear(focusDate, dir); + this._trigger('changeYear', this.viewDate); + } + else if (e.shiftKey){ + newDate = this.moveMonth(this.dates.get(-1) || UTCToday(), dir); + newViewDate = this.moveMonth(focusDate, dir); + this._trigger('changeMonth', this.viewDate); + } + else { + newDate = new Date(this.dates.get(-1) || UTCToday()); + newDate.setUTCDate(newDate.getUTCDate() + dir); + newViewDate = new Date(focusDate); + newViewDate.setUTCDate(focusDate.getUTCDate() + dir); + } + if (this.dateWithinRange(newDate)){ + this.focusDate = this.viewDate = newViewDate; + this.setValue(); + this.fill(); + e.preventDefault(); + } + break; + case 38: // up + case 40: // down + if (!this.o.keyboardNavigation) + break; + dir = e.keyCode === 38 ? -1 : 1; + if (e.ctrlKey){ + newDate = this.moveYear(this.dates.get(-1) || UTCToday(), dir); + newViewDate = this.moveYear(focusDate, dir); + this._trigger('changeYear', this.viewDate); + } + else if (e.shiftKey){ + newDate = this.moveMonth(this.dates.get(-1) || UTCToday(), dir); + newViewDate = this.moveMonth(focusDate, dir); + this._trigger('changeMonth', this.viewDate); + } + else { + newDate = new Date(this.dates.get(-1) || UTCToday()); + newDate.setUTCDate(newDate.getUTCDate() + dir * 7); + newViewDate = new Date(focusDate); + newViewDate.setUTCDate(focusDate.getUTCDate() + dir * 7); + } + if (this.dateWithinRange(newDate)){ + this.focusDate = this.viewDate = newViewDate; + this.setValue(); + this.fill(); + e.preventDefault(); + } + break; + case 32: // spacebar + // Spacebar is used in manually typing dates in some formats. + // As such, its behavior should not be hijacked. + break; + case 13: // enter + focusDate = this.focusDate || this.dates.get(-1) || this.viewDate; + this._toggle_multidate(focusDate); + dateChanged = true; + this.focusDate = null; + this.viewDate = this.dates.get(-1) || this.viewDate; + this.setValue(); + this.fill(); + if (this.picker.is(':visible')){ + e.preventDefault(); + if (this.o.autoclose) + this.hide(); + } + break; + case 9: // tab + this.focusDate = null; + this.viewDate = this.dates.get(-1) || this.viewDate; + this.fill(); + this.hide(); + break; + } + if (dateChanged){ + if (this.dates.length) + this._trigger('changeDate'); + else + this._trigger('clearDate'); + var element; + if (this.isInput){ + element = this.element; + } + else if (this.component){ + element = this.element.find('input'); + } + if (element){ + element.change(); + } + } + }, + + showMode: function(dir){ + if (dir){ + this.viewMode = Math.max(this.o.minViewMode, Math.min(2, this.viewMode + dir)); + } + this.picker + .find('>div') + .hide() + .filter('.datepicker-'+DPGlobal.modes[this.viewMode].clsName) + .css('display', 'block'); + this.updateNavArrows(); + } + }; + + var DateRangePicker = function(element, options){ + this.element = $(element); + this.inputs = $.map(options.inputs, function(i){ + return i.jquery ? i[0] : i; + }); + delete options.inputs; + + $(this.inputs) + .datepicker(options) + .bind('changeDate', $.proxy(this.dateUpdated, this)); + + this.pickers = $.map(this.inputs, function(i){ + return $(i).data('datepicker'); + }); + this.updateDates(); + }; + DateRangePicker.prototype = { + updateDates: function(){ + this.dates = $.map(this.pickers, function(i){ + return i.getUTCDate(); + }); + this.updateRanges(); + }, + updateRanges: function(){ + var range = $.map(this.dates, function(d){ + return d.valueOf(); + }); + $.each(this.pickers, function(i, p){ + p.setRange(range); + }); + }, + dateUpdated: function(e){ + // `this.updating` is a workaround for preventing infinite recursion + // between `changeDate` triggering and `setUTCDate` calling. Until + // there is a better mechanism. + if (this.updating) + return; + this.updating = true; + + var dp = $(e.target).data('datepicker'), + new_date = dp.getUTCDate(), + i = $.inArray(e.target, this.inputs), + l = this.inputs.length; + if (i === -1) + return; + + $.each(this.pickers, function(i, p){ + if (!p.getUTCDate()) + p.setUTCDate(new_date); + }); + + if (new_date < this.dates[i]){ + // Date being moved earlier/left + while (i >= 0 && new_date < this.dates[i]){ + this.pickers[i--].setUTCDate(new_date); + } + } + else if (new_date > this.dates[i]){ + // Date being moved later/right + while (i < l && new_date > this.dates[i]){ + this.pickers[i++].setUTCDate(new_date); + } + } + this.updateDates(); + + delete this.updating; + }, + remove: function(){ + $.map(this.pickers, function(p){ p.remove(); }); + delete this.element.data().datepicker; + } + }; + + function opts_from_el(el, prefix){ + // Derive options from element data-attrs + var data = $(el).data(), + out = {}, inkey, + replace = new RegExp('^' + prefix.toLowerCase() + '([A-Z])'); + prefix = new RegExp('^' + prefix.toLowerCase()); + function re_lower(_,a){ + return a.toLowerCase(); + } + for (var key in data) + if (prefix.test(key)){ + inkey = key.replace(replace, re_lower); + out[inkey] = data[key]; + } + return out; + } + + function opts_from_locale(lang){ + // Derive options from locale plugins + var out = {}; + // Check if "de-DE" style date is available, if not language should + // fallback to 2 letter code eg "de" + if (!dates[lang]){ + lang = lang.split('-')[0]; + if (!dates[lang]) + return; + } + var d = dates[lang]; + $.each(locale_opts, function(i,k){ + if (k in d) + out[k] = d[k]; + }); + return out; + } + + var old = $.fn.datepicker; + $.fn.datepicker = function(option){ + var args = Array.apply(null, arguments); + args.shift(); + var internal_return; + this.each(function(){ + var $this = $(this), + data = $this.data('datepicker'), + options = typeof option === 'object' && option; + if (!data){ + var elopts = opts_from_el(this, 'date'), + // Preliminary options + xopts = $.extend({}, defaults, elopts, options), + locopts = opts_from_locale(xopts.language), + // Options priority: js args, data-attrs, locales, defaults + opts = $.extend({}, defaults, locopts, elopts, options); + if ($this.is('.input-daterange') || opts.inputs){ + var ropts = { + inputs: opts.inputs || $this.find('input').toArray() + }; + $this.data('datepicker', (data = new DateRangePicker(this, $.extend(opts, ropts)))); + } + else { + $this.data('datepicker', (data = new Datepicker(this, opts))); + } + } + if (typeof option === 'string' && typeof data[option] === 'function'){ + internal_return = data[option].apply(data, args); + if (internal_return !== undefined) + return false; + } + }); + if (internal_return !== undefined) + return internal_return; + else + return this; + }; + + var defaults = $.fn.datepicker.defaults = { + autoclose: false, + beforeShowDay: $.noop, + calendarWeeks: false, + clearBtn: false, + daysOfWeekDisabled: [], + endDate: Infinity, + forceParse: true, + format: 'mm/dd/yyyy', + keyboardNavigation: true, + language: 'en', + minViewMode: 0, + multidate: false, + multidateSeparator: ',', + orientation: "auto", + rtl: false, + startDate: -Infinity, + startView: 0, + todayBtn: false, + todayHighlight: false, + weekStart: 0 + }; + var locale_opts = $.fn.datepicker.locale_opts = [ + 'format', + 'rtl', + 'weekStart' + ]; + $.fn.datepicker.Constructor = Datepicker; + var dates = $.fn.datepicker.dates = { + en: { + days: ["Sunday", "Monday", "Tuesday", "Wednesday", "Thursday", "Friday", "Saturday", "Sunday"], + daysShort: ["Sun", "Mon", "Tue", "Wed", "Thu", "Fri", "Sat", "Sun"], + daysMin: ["Su", "Mo", "Tu", "We", "Th", "Fr", "Sa", "Su"], + months: ["January", "February", "March", "April", "May", "June", "July", "August", "September", "October", "November", "December"], + monthsShort: ["Jan", "Feb", "Mar", "Apr", "May", "Jun", "Jul", "Aug", "Sep", "Oct", "Nov", "Dec"], + today: "Today", + clear: "Clear" + } + }; + + var DPGlobal = { + modes: [ + { + clsName: 'days', + navFnc: 'Month', + navStep: 1 + }, + { + clsName: 'months', + navFnc: 'FullYear', + navStep: 1 + }, + { + clsName: 'years', + navFnc: 'FullYear', + navStep: 10 + }], + isLeapYear: function(year){ + return (((year % 4 === 0) && (year % 100 !== 0)) || (year % 400 === 0)); + }, + getDaysInMonth: function(year, month){ + return [31, (DPGlobal.isLeapYear(year) ? 29 : 28), 31, 30, 31, 30, 31, 31, 30, 31, 30, 31][month]; + }, + validParts: /dd?|DD?|mm?|MM?|yy(?:yy)?/g, + nonpunctuation: /[^ -\/:-@\[\u3400-\u9fff-`{-~\t\n\r]+/g, + parseFormat: function(format){ + // IE treats \0 as a string end in inputs (truncating the value), + // so it's a bad format delimiter, anyway + var separators = format.replace(this.validParts, '\0').split('\0'), + parts = format.match(this.validParts); + if (!separators || !separators.length || !parts || parts.length === 0){ + throw new Error("Invalid date format."); + } + return {separators: separators, parts: parts}; + }, + parseDate: function(date, format, language){ + if (!date) + return undefined; + if (date instanceof Date) + return date; + if (typeof format === 'string') + format = DPGlobal.parseFormat(format); + var part_re = /([\-+]\d+)([dmwy])/, + parts = date.match(/([\-+]\d+)([dmwy])/g), + part, dir, i; + if (/^[\-+]\d+[dmwy]([\s,]+[\-+]\d+[dmwy])*$/.test(date)){ + date = new Date(); + for (i=0; i < parts.length; i++){ + part = part_re.exec(parts[i]); + dir = parseInt(part[1]); + switch (part[2]){ + case 'd': + date.setUTCDate(date.getUTCDate() + dir); + break; + case 'm': + date = Datepicker.prototype.moveMonth.call(Datepicker.prototype, date, dir); + break; + case 'w': + date.setUTCDate(date.getUTCDate() + dir * 7); + break; + case 'y': + date = Datepicker.prototype.moveYear.call(Datepicker.prototype, date, dir); + break; + } + } + return UTCDate(date.getUTCFullYear(), date.getUTCMonth(), date.getUTCDate(), 0, 0, 0); + } + parts = date && date.match(this.nonpunctuation) || []; + date = new Date(); + var parsed = {}, + setters_order = ['yyyy', 'yy', 'M', 'MM', 'm', 'mm', 'd', 'dd'], + setters_map = { + yyyy: function(d,v){ + return d.setUTCFullYear(v); + }, + yy: function(d,v){ + return d.setUTCFullYear(2000+v); + }, + m: function(d,v){ + if (isNaN(d)) + return d; + v -= 1; + while (v < 0) v += 12; + v %= 12; + d.setUTCMonth(v); + while (d.getUTCMonth() !== v) + d.setUTCDate(d.getUTCDate()-1); + return d; + }, + d: function(d,v){ + return d.setUTCDate(v); + } + }, + val, filtered; + setters_map['M'] = setters_map['MM'] = setters_map['mm'] = setters_map['m']; + setters_map['dd'] = setters_map['d']; + date = UTCDate(date.getFullYear(), date.getMonth(), date.getDate(), 0, 0, 0); + var fparts = format.parts.slice(); + // Remove noop parts + if (parts.length !== fparts.length){ + fparts = $(fparts).filter(function(i,p){ + return $.inArray(p, setters_order) !== -1; + }).toArray(); + } + // Process remainder + function match_part(){ + var m = this.slice(0, parts[i].length), + p = parts[i].slice(0, m.length); + return m === p; + } + if (parts.length === fparts.length){ + var cnt; + for (i=0, cnt = fparts.length; i < cnt; i++){ + val = parseInt(parts[i], 10); + part = fparts[i]; + if (isNaN(val)){ + switch (part){ + case 'MM': + filtered = $(dates[language].months).filter(match_part); + val = $.inArray(filtered[0], dates[language].months) + 1; + break; + case 'M': + filtered = $(dates[language].monthsShort).filter(match_part); + val = $.inArray(filtered[0], dates[language].monthsShort) + 1; + break; + } + } + parsed[part] = val; + } + var _date, s; + for (i=0; i < setters_order.length; i++){ + s = setters_order[i]; + if (s in parsed && !isNaN(parsed[s])){ + _date = new Date(date); + setters_map[s](_date, parsed[s]); + if (!isNaN(_date)) + date = _date; + } + } + } + return date; + }, + formatDate: function(date, format, language){ + if (!date) + return ''; + if (typeof format === 'string') + format = DPGlobal.parseFormat(format); + var val = { + d: date.getUTCDate(), + D: dates[language].daysShort[date.getUTCDay()], + DD: dates[language].days[date.getUTCDay()], + m: date.getUTCMonth() + 1, + M: dates[language].monthsShort[date.getUTCMonth()], + MM: dates[language].months[date.getUTCMonth()], + yy: date.getUTCFullYear().toString().substring(2), + yyyy: date.getUTCFullYear() + }; + val.dd = (val.d < 10 ? '0' : '') + val.d; + val.mm = (val.m < 10 ? '0' : '') + val.m; + date = []; + var seps = $.extend([], format.separators); + for (var i=0, cnt = format.parts.length; i <= cnt; i++){ + if (seps.length) + date.push(seps.shift()); + date.push(val[format.parts[i]]); + } + return date.join(''); + }, + headTemplate: ''+ + ''+ + '«'+ + ''+ + '»'+ + ''+ + '', + contTemplate: '', + footTemplate: ''+ + ''+ + ''+ + ''+ + ''+ + ''+ + ''+ + '' + }; + DPGlobal.template = '
'+ + '
'+ + ''+ + DPGlobal.headTemplate+ + ''+ + DPGlobal.footTemplate+ + '
'+ + '
'+ + '
'+ + ''+ + DPGlobal.headTemplate+ + DPGlobal.contTemplate+ + DPGlobal.footTemplate+ + '
'+ + '
'+ + '
'+ + ''+ + DPGlobal.headTemplate+ + DPGlobal.contTemplate+ + DPGlobal.footTemplate+ + '
'+ + '
'+ + '
'; + + $.fn.datepicker.DPGlobal = DPGlobal; + + + /* DATEPICKER NO CONFLICT + * =================== */ + + $.fn.datepicker.noConflict = function(){ + $.fn.datepicker = old; + return this; + }; + + + /* DATEPICKER DATA-API + * ================== */ + + $(document).on( + 'focus.datepicker.data-api click.datepicker.data-api', + '[data-provide="datepicker"]', + function(e){ + var $this = $(this); + if ($this.data('datepicker')) + return; + e.preventDefault(); + // component click requires us to explicitly show it + $this.datepicker('show'); + } + ); + $(function(){ + $('[data-provide="datepicker-inline"]').datepicker(); + }); + +}(window.jQuery)); \ No newline at end of file diff --git a/assets/js/bootstrap.min.js b/assets/js/bootstrap.min.js new file mode 100644 index 0000000000..7961bdaf8e --- /dev/null +++ b/assets/js/bootstrap.min.js @@ -0,0 +1,7 @@ +/*! + * Bootstrap v4.6.0 (https://getbootstrap.com/) + * Copyright 2011-2021 The Bootstrap Authors (https://github.com/twbs/bootstrap/graphs/contributors) + * Licensed under MIT (https://github.com/twbs/bootstrap/blob/main/LICENSE) + */ +!function(t,e){"object"==typeof exports&&"undefined"!=typeof module?e(exports,require("jquery")):"function"==typeof define&&define.amd?define(["exports","jquery"],e):e((t="undefined"!=typeof globalThis?globalThis:t||self).bootstrap={},t.jQuery)}(this,(function(t,e){"use strict";function n(t){return t&&"object"==typeof t&&"default"in t?t:{default:t}}var i=n(e);function o(t,e){for(var n=0;n=4)throw new Error("Bootstrap's JavaScript requires at least jQuery v1.9.1 but less than v4.0.0")}};l.jQueryDetection(),i.default.fn.emulateTransitionEnd=s,i.default.event.special[l.TRANSITION_END]={bindType:"transitionend",delegateType:"transitionend",handle:function(t){if(i.default(t.target).is(this))return t.handleObj.handler.apply(this,arguments)}};var u="alert",f=i.default.fn[u],d=function(){function t(t){this._element=t}var e=t.prototype;return e.close=function(t){var e=this._element;t&&(e=this._getRootElement(t)),this._triggerCloseEvent(e).isDefaultPrevented()||this._removeElement(e)},e.dispose=function(){i.default.removeData(this._element,"bs.alert"),this._element=null},e._getRootElement=function(t){var e=l.getSelectorFromElement(t),n=!1;return e&&(n=document.querySelector(e)),n||(n=i.default(t).closest(".alert")[0]),n},e._triggerCloseEvent=function(t){var e=i.default.Event("close.bs.alert");return i.default(t).trigger(e),e},e._removeElement=function(t){var e=this;if(i.default(t).removeClass("show"),i.default(t).hasClass("fade")){var n=l.getTransitionDurationFromElement(t);i.default(t).one(l.TRANSITION_END,(function(n){return e._destroyElement(t,n)})).emulateTransitionEnd(n)}else this._destroyElement(t)},e._destroyElement=function(t){i.default(t).detach().trigger("closed.bs.alert").remove()},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this),o=n.data("bs.alert");o||(o=new t(this),n.data("bs.alert",o)),"close"===e&&o[e](this)}))},t._handleDismiss=function(t){return function(e){e&&e.preventDefault(),t.close(this)}},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}}]),t}();i.default(document).on("click.bs.alert.data-api",'[data-dismiss="alert"]',d._handleDismiss(new d)),i.default.fn[u]=d._jQueryInterface,i.default.fn[u].Constructor=d,i.default.fn[u].noConflict=function(){return i.default.fn[u]=f,d._jQueryInterface};var c=i.default.fn.button,h=function(){function t(t){this._element=t,this.shouldAvoidTriggerChange=!1}var e=t.prototype;return e.toggle=function(){var t=!0,e=!0,n=i.default(this._element).closest('[data-toggle="buttons"]')[0];if(n){var o=this._element.querySelector('input:not([type="hidden"])');if(o){if("radio"===o.type)if(o.checked&&this._element.classList.contains("active"))t=!1;else{var r=n.querySelector(".active");r&&i.default(r).removeClass("active")}t&&("checkbox"!==o.type&&"radio"!==o.type||(o.checked=!this._element.classList.contains("active")),this.shouldAvoidTriggerChange||i.default(o).trigger("change")),o.focus(),e=!1}}this._element.hasAttribute("disabled")||this._element.classList.contains("disabled")||(e&&this._element.setAttribute("aria-pressed",!this._element.classList.contains("active")),t&&i.default(this._element).toggleClass("active"))},e.dispose=function(){i.default.removeData(this._element,"bs.button"),this._element=null},t._jQueryInterface=function(e,n){return this.each((function(){var o=i.default(this),r=o.data("bs.button");r||(r=new t(this),o.data("bs.button",r)),r.shouldAvoidTriggerChange=n,"toggle"===e&&r[e]()}))},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}}]),t}();i.default(document).on("click.bs.button.data-api",'[data-toggle^="button"]',(function(t){var e=t.target,n=e;if(i.default(e).hasClass("btn")||(e=i.default(e).closest(".btn")[0]),!e||e.hasAttribute("disabled")||e.classList.contains("disabled"))t.preventDefault();else{var o=e.querySelector('input:not([type="hidden"])');if(o&&(o.hasAttribute("disabled")||o.classList.contains("disabled")))return void t.preventDefault();"INPUT"!==n.tagName&&"LABEL"===e.tagName||h._jQueryInterface.call(i.default(e),"toggle","INPUT"===n.tagName)}})).on("focus.bs.button.data-api blur.bs.button.data-api",'[data-toggle^="button"]',(function(t){var e=i.default(t.target).closest(".btn")[0];i.default(e).toggleClass("focus",/^focus(in)?$/.test(t.type))})),i.default(window).on("load.bs.button.data-api",(function(){for(var t=[].slice.call(document.querySelectorAll('[data-toggle="buttons"] .btn')),e=0,n=t.length;e0,this._pointerEvent=Boolean(window.PointerEvent||window.MSPointerEvent),this._addEventListeners()}var e=t.prototype;return e.next=function(){this._isSliding||this._slide("next")},e.nextWhenVisible=function(){var t=i.default(this._element);!document.hidden&&t.is(":visible")&&"hidden"!==t.css("visibility")&&this.next()},e.prev=function(){this._isSliding||this._slide("prev")},e.pause=function(t){t||(this._isPaused=!0),this._element.querySelector(".carousel-item-next, .carousel-item-prev")&&(l.triggerTransitionEnd(this._element),this.cycle(!0)),clearInterval(this._interval),this._interval=null},e.cycle=function(t){t||(this._isPaused=!1),this._interval&&(clearInterval(this._interval),this._interval=null),this._config.interval&&!this._isPaused&&(this._updateInterval(),this._interval=setInterval((document.visibilityState?this.nextWhenVisible:this.next).bind(this),this._config.interval))},e.to=function(t){var e=this;this._activeElement=this._element.querySelector(".active.carousel-item");var n=this._getItemIndex(this._activeElement);if(!(t>this._items.length-1||t<0))if(this._isSliding)i.default(this._element).one("slid.bs.carousel",(function(){return e.to(t)}));else{if(n===t)return this.pause(),void this.cycle();var o=t>n?"next":"prev";this._slide(o,this._items[t])}},e.dispose=function(){i.default(this._element).off(m),i.default.removeData(this._element,"bs.carousel"),this._items=null,this._config=null,this._element=null,this._interval=null,this._isPaused=null,this._isSliding=null,this._activeElement=null,this._indicatorsElement=null},e._getConfig=function(t){return t=a({},v,t),l.typeCheckConfig(p,t,_),t},e._handleSwipe=function(){var t=Math.abs(this.touchDeltaX);if(!(t<=40)){var e=t/this.touchDeltaX;this.touchDeltaX=0,e>0&&this.prev(),e<0&&this.next()}},e._addEventListeners=function(){var t=this;this._config.keyboard&&i.default(this._element).on("keydown.bs.carousel",(function(e){return t._keydown(e)})),"hover"===this._config.pause&&i.default(this._element).on("mouseenter.bs.carousel",(function(e){return t.pause(e)})).on("mouseleave.bs.carousel",(function(e){return t.cycle(e)})),this._config.touch&&this._addTouchEventListeners()},e._addTouchEventListeners=function(){var t=this;if(this._touchSupported){var e=function(e){t._pointerEvent&&b[e.originalEvent.pointerType.toUpperCase()]?t.touchStartX=e.originalEvent.clientX:t._pointerEvent||(t.touchStartX=e.originalEvent.touches[0].clientX)},n=function(e){t._pointerEvent&&b[e.originalEvent.pointerType.toUpperCase()]&&(t.touchDeltaX=e.originalEvent.clientX-t.touchStartX),t._handleSwipe(),"hover"===t._config.pause&&(t.pause(),t.touchTimeout&&clearTimeout(t.touchTimeout),t.touchTimeout=setTimeout((function(e){return t.cycle(e)}),500+t._config.interval))};i.default(this._element.querySelectorAll(".carousel-item img")).on("dragstart.bs.carousel",(function(t){return t.preventDefault()})),this._pointerEvent?(i.default(this._element).on("pointerdown.bs.carousel",(function(t){return e(t)})),i.default(this._element).on("pointerup.bs.carousel",(function(t){return n(t)})),this._element.classList.add("pointer-event")):(i.default(this._element).on("touchstart.bs.carousel",(function(t){return e(t)})),i.default(this._element).on("touchmove.bs.carousel",(function(e){return function(e){e.originalEvent.touches&&e.originalEvent.touches.length>1?t.touchDeltaX=0:t.touchDeltaX=e.originalEvent.touches[0].clientX-t.touchStartX}(e)})),i.default(this._element).on("touchend.bs.carousel",(function(t){return n(t)})))}},e._keydown=function(t){if(!/input|textarea/i.test(t.target.tagName))switch(t.which){case 37:t.preventDefault(),this.prev();break;case 39:t.preventDefault(),this.next()}},e._getItemIndex=function(t){return this._items=t&&t.parentNode?[].slice.call(t.parentNode.querySelectorAll(".carousel-item")):[],this._items.indexOf(t)},e._getItemByDirection=function(t,e){var n="next"===t,i="prev"===t,o=this._getItemIndex(e),r=this._items.length-1;if((i&&0===o||n&&o===r)&&!this._config.wrap)return e;var a=(o+("prev"===t?-1:1))%this._items.length;return-1===a?this._items[this._items.length-1]:this._items[a]},e._triggerSlideEvent=function(t,e){var n=this._getItemIndex(t),o=this._getItemIndex(this._element.querySelector(".active.carousel-item")),r=i.default.Event("slide.bs.carousel",{relatedTarget:t,direction:e,from:o,to:n});return i.default(this._element).trigger(r),r},e._setActiveIndicatorElement=function(t){if(this._indicatorsElement){var e=[].slice.call(this._indicatorsElement.querySelectorAll(".active"));i.default(e).removeClass("active");var n=this._indicatorsElement.children[this._getItemIndex(t)];n&&i.default(n).addClass("active")}},e._updateInterval=function(){var t=this._activeElement||this._element.querySelector(".active.carousel-item");if(t){var e=parseInt(t.getAttribute("data-interval"),10);e?(this._config.defaultInterval=this._config.defaultInterval||this._config.interval,this._config.interval=e):this._config.interval=this._config.defaultInterval||this._config.interval}},e._slide=function(t,e){var n,o,r,a=this,s=this._element.querySelector(".active.carousel-item"),u=this._getItemIndex(s),f=e||s&&this._getItemByDirection(t,s),d=this._getItemIndex(f),c=Boolean(this._interval);if("next"===t?(n="carousel-item-left",o="carousel-item-next",r="left"):(n="carousel-item-right",o="carousel-item-prev",r="right"),f&&i.default(f).hasClass("active"))this._isSliding=!1;else if(!this._triggerSlideEvent(f,r).isDefaultPrevented()&&s&&f){this._isSliding=!0,c&&this.pause(),this._setActiveIndicatorElement(f),this._activeElement=f;var h=i.default.Event("slid.bs.carousel",{relatedTarget:f,direction:r,from:u,to:d});if(i.default(this._element).hasClass("slide")){i.default(f).addClass(o),l.reflow(f),i.default(s).addClass(n),i.default(f).addClass(n);var p=l.getTransitionDurationFromElement(s);i.default(s).one(l.TRANSITION_END,(function(){i.default(f).removeClass(n+" "+o).addClass("active"),i.default(s).removeClass("active "+o+" "+n),a._isSliding=!1,setTimeout((function(){return i.default(a._element).trigger(h)}),0)})).emulateTransitionEnd(p)}else i.default(s).removeClass("active"),i.default(f).addClass("active"),this._isSliding=!1,i.default(this._element).trigger(h);c&&this.cycle()}},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this).data("bs.carousel"),o=a({},v,i.default(this).data());"object"==typeof e&&(o=a({},o,e));var r="string"==typeof e?e:o.slide;if(n||(n=new t(this,o),i.default(this).data("bs.carousel",n)),"number"==typeof e)n.to(e);else if("string"==typeof r){if("undefined"==typeof n[r])throw new TypeError('No method named "'+r+'"');n[r]()}else o.interval&&o.ride&&(n.pause(),n.cycle())}))},t._dataApiClickHandler=function(e){var n=l.getSelectorFromElement(this);if(n){var o=i.default(n)[0];if(o&&i.default(o).hasClass("carousel")){var r=a({},i.default(o).data(),i.default(this).data()),s=this.getAttribute("data-slide-to");s&&(r.interval=!1),t._jQueryInterface.call(i.default(o),r),s&&i.default(o).data("bs.carousel").to(s),e.preventDefault()}}},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}},{key:"Default",get:function(){return v}}]),t}();i.default(document).on("click.bs.carousel.data-api","[data-slide], [data-slide-to]",y._dataApiClickHandler),i.default(window).on("load.bs.carousel.data-api",(function(){for(var t=[].slice.call(document.querySelectorAll('[data-ride="carousel"]')),e=0,n=t.length;e0&&(this._selector=a,this._triggerArray.push(r))}this._parent=this._config.parent?this._getParent():null,this._config.parent||this._addAriaAndCollapsedClass(this._element,this._triggerArray),this._config.toggle&&this.toggle()}var e=t.prototype;return e.toggle=function(){i.default(this._element).hasClass("show")?this.hide():this.show()},e.show=function(){var e,n,o=this;if(!this._isTransitioning&&!i.default(this._element).hasClass("show")&&(this._parent&&0===(e=[].slice.call(this._parent.querySelectorAll(".show, .collapsing")).filter((function(t){return"string"==typeof o._config.parent?t.getAttribute("data-parent")===o._config.parent:t.classList.contains("collapse")}))).length&&(e=null),!(e&&(n=i.default(e).not(this._selector).data("bs.collapse"))&&n._isTransitioning))){var r=i.default.Event("show.bs.collapse");if(i.default(this._element).trigger(r),!r.isDefaultPrevented()){e&&(t._jQueryInterface.call(i.default(e).not(this._selector),"hide"),n||i.default(e).data("bs.collapse",null));var a=this._getDimension();i.default(this._element).removeClass("collapse").addClass("collapsing"),this._element.style[a]=0,this._triggerArray.length&&i.default(this._triggerArray).removeClass("collapsed").attr("aria-expanded",!0),this.setTransitioning(!0);var s="scroll"+(a[0].toUpperCase()+a.slice(1)),u=l.getTransitionDurationFromElement(this._element);i.default(this._element).one(l.TRANSITION_END,(function(){i.default(o._element).removeClass("collapsing").addClass("collapse show"),o._element.style[a]="",o.setTransitioning(!1),i.default(o._element).trigger("shown.bs.collapse")})).emulateTransitionEnd(u),this._element.style[a]=this._element[s]+"px"}}},e.hide=function(){var t=this;if(!this._isTransitioning&&i.default(this._element).hasClass("show")){var e=i.default.Event("hide.bs.collapse");if(i.default(this._element).trigger(e),!e.isDefaultPrevented()){var n=this._getDimension();this._element.style[n]=this._element.getBoundingClientRect()[n]+"px",l.reflow(this._element),i.default(this._element).addClass("collapsing").removeClass("collapse show");var o=this._triggerArray.length;if(o>0)for(var r=0;r=0)return 1;return 0}();var k=D&&window.Promise?function(t){var e=!1;return function(){e||(e=!0,window.Promise.resolve().then((function(){e=!1,t()})))}}:function(t){var e=!1;return function(){e||(e=!0,setTimeout((function(){e=!1,t()}),N))}};function A(t){return t&&"[object Function]"==={}.toString.call(t)}function I(t,e){if(1!==t.nodeType)return[];var n=t.ownerDocument.defaultView.getComputedStyle(t,null);return e?n[e]:n}function O(t){return"HTML"===t.nodeName?t:t.parentNode||t.host}function x(t){if(!t)return document.body;switch(t.nodeName){case"HTML":case"BODY":return t.ownerDocument.body;case"#document":return t.body}var e=I(t),n=e.overflow,i=e.overflowX,o=e.overflowY;return/(auto|scroll|overlay)/.test(n+o+i)?t:x(O(t))}function j(t){return t&&t.referenceNode?t.referenceNode:t}var L=D&&!(!window.MSInputMethodContext||!document.documentMode),P=D&&/MSIE 10/.test(navigator.userAgent);function F(t){return 11===t?L:10===t?P:L||P}function R(t){if(!t)return document.documentElement;for(var e=F(10)?document.body:null,n=t.offsetParent||null;n===e&&t.nextElementSibling;)n=(t=t.nextElementSibling).offsetParent;var i=n&&n.nodeName;return i&&"BODY"!==i&&"HTML"!==i?-1!==["TH","TD","TABLE"].indexOf(n.nodeName)&&"static"===I(n,"position")?R(n):n:t?t.ownerDocument.documentElement:document.documentElement}function H(t){return null!==t.parentNode?H(t.parentNode):t}function M(t,e){if(!(t&&t.nodeType&&e&&e.nodeType))return document.documentElement;var n=t.compareDocumentPosition(e)&Node.DOCUMENT_POSITION_FOLLOWING,i=n?t:e,o=n?e:t,r=document.createRange();r.setStart(i,0),r.setEnd(o,0);var a,s,l=r.commonAncestorContainer;if(t!==l&&e!==l||i.contains(o))return"BODY"===(s=(a=l).nodeName)||"HTML"!==s&&R(a.firstElementChild)!==a?R(l):l;var u=H(t);return u.host?M(u.host,e):M(t,H(e).host)}function q(t){var e=arguments.length>1&&void 0!==arguments[1]?arguments[1]:"top",n="top"===e?"scrollTop":"scrollLeft",i=t.nodeName;if("BODY"===i||"HTML"===i){var o=t.ownerDocument.documentElement,r=t.ownerDocument.scrollingElement||o;return r[n]}return t[n]}function B(t,e){var n=arguments.length>2&&void 0!==arguments[2]&&arguments[2],i=q(e,"top"),o=q(e,"left"),r=n?-1:1;return t.top+=i*r,t.bottom+=i*r,t.left+=o*r,t.right+=o*r,t}function Q(t,e){var n="x"===e?"Left":"Top",i="Left"===n?"Right":"Bottom";return parseFloat(t["border"+n+"Width"])+parseFloat(t["border"+i+"Width"])}function W(t,e,n,i){return Math.max(e["offset"+t],e["scroll"+t],n["client"+t],n["offset"+t],n["scroll"+t],F(10)?parseInt(n["offset"+t])+parseInt(i["margin"+("Height"===t?"Top":"Left")])+parseInt(i["margin"+("Height"===t?"Bottom":"Right")]):0)}function U(t){var e=t.body,n=t.documentElement,i=F(10)&&getComputedStyle(n);return{height:W("Height",e,n,i),width:W("Width",e,n,i)}}var V=function(t,e){if(!(t instanceof e))throw new TypeError("Cannot call a class as a function")},Y=function(){function t(t,e){for(var n=0;n2&&void 0!==arguments[2]&&arguments[2],i=F(10),o="HTML"===e.nodeName,r=G(t),a=G(e),s=x(t),l=I(e),u=parseFloat(l.borderTopWidth),f=parseFloat(l.borderLeftWidth);n&&o&&(a.top=Math.max(a.top,0),a.left=Math.max(a.left,0));var d=K({top:r.top-a.top-u,left:r.left-a.left-f,width:r.width,height:r.height});if(d.marginTop=0,d.marginLeft=0,!i&&o){var c=parseFloat(l.marginTop),h=parseFloat(l.marginLeft);d.top-=u-c,d.bottom-=u-c,d.left-=f-h,d.right-=f-h,d.marginTop=c,d.marginLeft=h}return(i&&!n?e.contains(s):e===s&&"BODY"!==s.nodeName)&&(d=B(d,e)),d}function J(t){var e=arguments.length>1&&void 0!==arguments[1]&&arguments[1],n=t.ownerDocument.documentElement,i=$(t,n),o=Math.max(n.clientWidth,window.innerWidth||0),r=Math.max(n.clientHeight,window.innerHeight||0),a=e?0:q(n),s=e?0:q(n,"left"),l={top:a-i.top+i.marginTop,left:s-i.left+i.marginLeft,width:o,height:r};return K(l)}function Z(t){var e=t.nodeName;if("BODY"===e||"HTML"===e)return!1;if("fixed"===I(t,"position"))return!0;var n=O(t);return!!n&&Z(n)}function tt(t){if(!t||!t.parentElement||F())return document.documentElement;for(var e=t.parentElement;e&&"none"===I(e,"transform");)e=e.parentElement;return e||document.documentElement}function et(t,e,n,i){var o=arguments.length>4&&void 0!==arguments[4]&&arguments[4],r={top:0,left:0},a=o?tt(t):M(t,j(e));if("viewport"===i)r=J(a,o);else{var s=void 0;"scrollParent"===i?"BODY"===(s=x(O(e))).nodeName&&(s=t.ownerDocument.documentElement):s="window"===i?t.ownerDocument.documentElement:i;var l=$(s,a,o);if("HTML"!==s.nodeName||Z(a))r=l;else{var u=U(t.ownerDocument),f=u.height,d=u.width;r.top+=l.top-l.marginTop,r.bottom=f+l.top,r.left+=l.left-l.marginLeft,r.right=d+l.left}}var c="number"==typeof(n=n||0);return r.left+=c?n:n.left||0,r.top+=c?n:n.top||0,r.right-=c?n:n.right||0,r.bottom-=c?n:n.bottom||0,r}function nt(t){return t.width*t.height}function it(t,e,n,i,o){var r=arguments.length>5&&void 0!==arguments[5]?arguments[5]:0;if(-1===t.indexOf("auto"))return t;var a=et(n,i,r,o),s={top:{width:a.width,height:e.top-a.top},right:{width:a.right-e.right,height:a.height},bottom:{width:a.width,height:a.bottom-e.bottom},left:{width:e.left-a.left,height:a.height}},l=Object.keys(s).map((function(t){return X({key:t},s[t],{area:nt(s[t])})})).sort((function(t,e){return e.area-t.area})),u=l.filter((function(t){var e=t.width,i=t.height;return e>=n.clientWidth&&i>=n.clientHeight})),f=u.length>0?u[0].key:l[0].key,d=t.split("-")[1];return f+(d?"-"+d:"")}function ot(t,e,n){var i=arguments.length>3&&void 0!==arguments[3]?arguments[3]:null,o=i?tt(e):M(e,j(n));return $(n,o,i)}function rt(t){var e=t.ownerDocument.defaultView.getComputedStyle(t),n=parseFloat(e.marginTop||0)+parseFloat(e.marginBottom||0),i=parseFloat(e.marginLeft||0)+parseFloat(e.marginRight||0);return{width:t.offsetWidth+i,height:t.offsetHeight+n}}function at(t){var e={left:"right",right:"left",bottom:"top",top:"bottom"};return t.replace(/left|right|bottom|top/g,(function(t){return e[t]}))}function st(t,e,n){n=n.split("-")[0];var i=rt(t),o={width:i.width,height:i.height},r=-1!==["right","left"].indexOf(n),a=r?"top":"left",s=r?"left":"top",l=r?"height":"width",u=r?"width":"height";return o[a]=e[a]+e[l]/2-i[l]/2,o[s]=n===s?e[s]-i[u]:e[at(s)],o}function lt(t,e){return Array.prototype.find?t.find(e):t.filter(e)[0]}function ut(t,e,n){return(void 0===n?t:t.slice(0,function(t,e,n){if(Array.prototype.findIndex)return t.findIndex((function(t){return t[e]===n}));var i=lt(t,(function(t){return t[e]===n}));return t.indexOf(i)}(t,"name",n))).forEach((function(t){t.function&&console.warn("`modifier.function` is deprecated, use `modifier.fn`!");var n=t.function||t.fn;t.enabled&&A(n)&&(e.offsets.popper=K(e.offsets.popper),e.offsets.reference=K(e.offsets.reference),e=n(e,t))})),e}function ft(){if(!this.state.isDestroyed){var t={instance:this,styles:{},arrowStyles:{},attributes:{},flipped:!1,offsets:{}};t.offsets.reference=ot(this.state,this.popper,this.reference,this.options.positionFixed),t.placement=it(this.options.placement,t.offsets.reference,this.popper,this.reference,this.options.modifiers.flip.boundariesElement,this.options.modifiers.flip.padding),t.originalPlacement=t.placement,t.positionFixed=this.options.positionFixed,t.offsets.popper=st(this.popper,t.offsets.reference,t.placement),t.offsets.popper.position=this.options.positionFixed?"fixed":"absolute",t=ut(this.modifiers,t),this.state.isCreated?this.options.onUpdate(t):(this.state.isCreated=!0,this.options.onCreate(t))}}function dt(t,e){return t.some((function(t){var n=t.name;return t.enabled&&n===e}))}function ct(t){for(var e=[!1,"ms","Webkit","Moz","O"],n=t.charAt(0).toUpperCase()+t.slice(1),i=0;i1&&void 0!==arguments[1]&&arguments[1],n=Tt.indexOf(t),i=Tt.slice(n+1).concat(Tt.slice(0,n));return e?i.reverse():i}var St="flip",Dt="clockwise",Nt="counterclockwise";function kt(t,e,n,i){var o=[0,0],r=-1!==["right","left"].indexOf(i),a=t.split(/(\+|\-)/).map((function(t){return t.trim()})),s=a.indexOf(lt(a,(function(t){return-1!==t.search(/,|\s/)})));a[s]&&-1===a[s].indexOf(",")&&console.warn("Offsets separated by white space(s) are deprecated, use a comma (,) instead.");var l=/\s*,\s*|\s+/,u=-1!==s?[a.slice(0,s).concat([a[s].split(l)[0]]),[a[s].split(l)[1]].concat(a.slice(s+1))]:[a];return(u=u.map((function(t,i){var o=(1===i?!r:r)?"height":"width",a=!1;return t.reduce((function(t,e){return""===t[t.length-1]&&-1!==["+","-"].indexOf(e)?(t[t.length-1]=e,a=!0,t):a?(t[t.length-1]+=e,a=!1,t):t.concat(e)}),[]).map((function(t){return function(t,e,n,i){var o=t.match(/((?:\-|\+)?\d*\.?\d*)(.*)/),r=+o[1],a=o[2];if(!r)return t;if(0===a.indexOf("%")){var s=void 0;switch(a){case"%p":s=n;break;case"%":case"%r":default:s=i}return K(s)[e]/100*r}if("vh"===a||"vw"===a)return("vh"===a?Math.max(document.documentElement.clientHeight,window.innerHeight||0):Math.max(document.documentElement.clientWidth,window.innerWidth||0))/100*r;return r}(t,o,e,n)}))}))).forEach((function(t,e){t.forEach((function(n,i){_t(n)&&(o[e]+=n*("-"===t[i-1]?-1:1))}))})),o}var At={placement:"bottom",positionFixed:!1,eventsEnabled:!0,removeOnDestroy:!1,onCreate:function(){},onUpdate:function(){},modifiers:{shift:{order:100,enabled:!0,fn:function(t){var e=t.placement,n=e.split("-")[0],i=e.split("-")[1];if(i){var o=t.offsets,r=o.reference,a=o.popper,s=-1!==["bottom","top"].indexOf(n),l=s?"left":"top",u=s?"width":"height",f={start:z({},l,r[l]),end:z({},l,r[l]+r[u]-a[u])};t.offsets.popper=X({},a,f[i])}return t}},offset:{order:200,enabled:!0,fn:function(t,e){var n=e.offset,i=t.placement,o=t.offsets,r=o.popper,a=o.reference,s=i.split("-")[0],l=void 0;return l=_t(+n)?[+n,0]:kt(n,r,a,s),"left"===s?(r.top+=l[0],r.left-=l[1]):"right"===s?(r.top+=l[0],r.left+=l[1]):"top"===s?(r.left+=l[0],r.top-=l[1]):"bottom"===s&&(r.left+=l[0],r.top+=l[1]),t.popper=r,t},offset:0},preventOverflow:{order:300,enabled:!0,fn:function(t,e){var n=e.boundariesElement||R(t.instance.popper);t.instance.reference===n&&(n=R(n));var i=ct("transform"),o=t.instance.popper.style,r=o.top,a=o.left,s=o[i];o.top="",o.left="",o[i]="";var l=et(t.instance.popper,t.instance.reference,e.padding,n,t.positionFixed);o.top=r,o.left=a,o[i]=s,e.boundaries=l;var u=e.priority,f=t.offsets.popper,d={primary:function(t){var n=f[t];return f[t]l[t]&&!e.escapeWithReference&&(i=Math.min(f[n],l[t]-("right"===t?f.width:f.height))),z({},n,i)}};return u.forEach((function(t){var e=-1!==["left","top"].indexOf(t)?"primary":"secondary";f=X({},f,d[e](t))})),t.offsets.popper=f,t},priority:["left","right","top","bottom"],padding:5,boundariesElement:"scrollParent"},keepTogether:{order:400,enabled:!0,fn:function(t){var e=t.offsets,n=e.popper,i=e.reference,o=t.placement.split("-")[0],r=Math.floor,a=-1!==["top","bottom"].indexOf(o),s=a?"right":"bottom",l=a?"left":"top",u=a?"width":"height";return n[s]r(i[s])&&(t.offsets.popper[l]=r(i[s])),t}},arrow:{order:500,enabled:!0,fn:function(t,e){var n;if(!wt(t.instance.modifiers,"arrow","keepTogether"))return t;var i=e.element;if("string"==typeof i){if(!(i=t.instance.popper.querySelector(i)))return t}else if(!t.instance.popper.contains(i))return console.warn("WARNING: `arrow.element` must be child of its popper element!"),t;var o=t.placement.split("-")[0],r=t.offsets,a=r.popper,s=r.reference,l=-1!==["left","right"].indexOf(o),u=l?"height":"width",f=l?"Top":"Left",d=f.toLowerCase(),c=l?"left":"top",h=l?"bottom":"right",p=rt(i)[u];s[h]-pa[h]&&(t.offsets.popper[d]+=s[d]+p-a[h]),t.offsets.popper=K(t.offsets.popper);var m=s[d]+s[u]/2-p/2,g=I(t.instance.popper),v=parseFloat(g["margin"+f]),_=parseFloat(g["border"+f+"Width"]),b=m-t.offsets.popper[d]-v-_;return b=Math.max(Math.min(a[u]-p,b),0),t.arrowElement=i,t.offsets.arrow=(z(n={},d,Math.round(b)),z(n,c,""),n),t},element:"[x-arrow]"},flip:{order:600,enabled:!0,fn:function(t,e){if(dt(t.instance.modifiers,"inner"))return t;if(t.flipped&&t.placement===t.originalPlacement)return t;var n=et(t.instance.popper,t.instance.reference,e.padding,e.boundariesElement,t.positionFixed),i=t.placement.split("-")[0],o=at(i),r=t.placement.split("-")[1]||"",a=[];switch(e.behavior){case St:a=[i,o];break;case Dt:a=Ct(i);break;case Nt:a=Ct(i,!0);break;default:a=e.behavior}return a.forEach((function(s,l){if(i!==s||a.length===l+1)return t;i=t.placement.split("-")[0],o=at(i);var u=t.offsets.popper,f=t.offsets.reference,d=Math.floor,c="left"===i&&d(u.right)>d(f.left)||"right"===i&&d(u.left)d(f.top)||"bottom"===i&&d(u.top)d(n.right),m=d(u.top)d(n.bottom),v="left"===i&&h||"right"===i&&p||"top"===i&&m||"bottom"===i&&g,_=-1!==["top","bottom"].indexOf(i),b=!!e.flipVariations&&(_&&"start"===r&&h||_&&"end"===r&&p||!_&&"start"===r&&m||!_&&"end"===r&&g),y=!!e.flipVariationsByContent&&(_&&"start"===r&&p||_&&"end"===r&&h||!_&&"start"===r&&g||!_&&"end"===r&&m),w=b||y;(c||v||w)&&(t.flipped=!0,(c||v)&&(i=a[l+1]),w&&(r=function(t){return"end"===t?"start":"start"===t?"end":t}(r)),t.placement=i+(r?"-"+r:""),t.offsets.popper=X({},t.offsets.popper,st(t.instance.popper,t.offsets.reference,t.placement)),t=ut(t.instance.modifiers,t,"flip"))})),t},behavior:"flip",padding:5,boundariesElement:"viewport",flipVariations:!1,flipVariationsByContent:!1},inner:{order:700,enabled:!1,fn:function(t){var e=t.placement,n=e.split("-")[0],i=t.offsets,o=i.popper,r=i.reference,a=-1!==["left","right"].indexOf(n),s=-1===["top","left"].indexOf(n);return o[a?"left":"top"]=r[n]-(s?o[a?"width":"height"]:0),t.placement=at(e),t.offsets.popper=K(o),t}},hide:{order:800,enabled:!0,fn:function(t){if(!wt(t.instance.modifiers,"hide","preventOverflow"))return t;var e=t.offsets.reference,n=lt(t.instance.modifiers,(function(t){return"preventOverflow"===t.name})).boundaries;if(e.bottomn.right||e.top>n.bottom||e.right2&&void 0!==arguments[2]?arguments[2]:{};V(this,t),this.scheduleUpdate=function(){return requestAnimationFrame(i.update)},this.update=k(this.update.bind(this)),this.options=X({},t.Defaults,o),this.state={isDestroyed:!1,isCreated:!1,scrollParents:[]},this.reference=e&&e.jquery?e[0]:e,this.popper=n&&n.jquery?n[0]:n,this.options.modifiers={},Object.keys(X({},t.Defaults.modifiers,o.modifiers)).forEach((function(e){i.options.modifiers[e]=X({},t.Defaults.modifiers[e]||{},o.modifiers?o.modifiers[e]:{})})),this.modifiers=Object.keys(this.options.modifiers).map((function(t){return X({name:t},i.options.modifiers[t])})).sort((function(t,e){return t.order-e.order})),this.modifiers.forEach((function(t){t.enabled&&A(t.onLoad)&&t.onLoad(i.reference,i.popper,i.options,t,i.state)})),this.update();var r=this.options.eventsEnabled;r&&this.enableEventListeners(),this.state.eventsEnabled=r}return Y(t,[{key:"update",value:function(){return ft.call(this)}},{key:"destroy",value:function(){return ht.call(this)}},{key:"enableEventListeners",value:function(){return gt.call(this)}},{key:"disableEventListeners",value:function(){return vt.call(this)}}]),t}();It.Utils=("undefined"!=typeof window?window:global).PopperUtils,It.placements=Et,It.Defaults=At;var Ot="dropdown",xt=i.default.fn[Ot],jt=new RegExp("38|40|27"),Lt={offset:0,flip:!0,boundary:"scrollParent",reference:"toggle",display:"dynamic",popperConfig:null},Pt={offset:"(number|string|function)",flip:"boolean",boundary:"(string|element)",reference:"(string|element)",display:"string",popperConfig:"(null|object)"},Ft=function(){function t(t,e){this._element=t,this._popper=null,this._config=this._getConfig(e),this._menu=this._getMenuElement(),this._inNavbar=this._detectNavbar(),this._addEventListeners()}var e=t.prototype;return e.toggle=function(){if(!this._element.disabled&&!i.default(this._element).hasClass("disabled")){var e=i.default(this._menu).hasClass("show");t._clearMenus(),e||this.show(!0)}},e.show=function(e){if(void 0===e&&(e=!1),!(this._element.disabled||i.default(this._element).hasClass("disabled")||i.default(this._menu).hasClass("show"))){var n={relatedTarget:this._element},o=i.default.Event("show.bs.dropdown",n),r=t._getParentFromElement(this._element);if(i.default(r).trigger(o),!o.isDefaultPrevented()){if(!this._inNavbar&&e){if("undefined"==typeof It)throw new TypeError("Bootstrap's dropdowns require Popper (https://popper.js.org)");var a=this._element;"parent"===this._config.reference?a=r:l.isElement(this._config.reference)&&(a=this._config.reference,"undefined"!=typeof this._config.reference.jquery&&(a=this._config.reference[0])),"scrollParent"!==this._config.boundary&&i.default(r).addClass("position-static"),this._popper=new It(a,this._menu,this._getPopperConfig())}"ontouchstart"in document.documentElement&&0===i.default(r).closest(".navbar-nav").length&&i.default(document.body).children().on("mouseover",null,i.default.noop),this._element.focus(),this._element.setAttribute("aria-expanded",!0),i.default(this._menu).toggleClass("show"),i.default(r).toggleClass("show").trigger(i.default.Event("shown.bs.dropdown",n))}}},e.hide=function(){if(!this._element.disabled&&!i.default(this._element).hasClass("disabled")&&i.default(this._menu).hasClass("show")){var e={relatedTarget:this._element},n=i.default.Event("hide.bs.dropdown",e),o=t._getParentFromElement(this._element);i.default(o).trigger(n),n.isDefaultPrevented()||(this._popper&&this._popper.destroy(),i.default(this._menu).toggleClass("show"),i.default(o).toggleClass("show").trigger(i.default.Event("hidden.bs.dropdown",e)))}},e.dispose=function(){i.default.removeData(this._element,"bs.dropdown"),i.default(this._element).off(".bs.dropdown"),this._element=null,this._menu=null,null!==this._popper&&(this._popper.destroy(),this._popper=null)},e.update=function(){this._inNavbar=this._detectNavbar(),null!==this._popper&&this._popper.scheduleUpdate()},e._addEventListeners=function(){var t=this;i.default(this._element).on("click.bs.dropdown",(function(e){e.preventDefault(),e.stopPropagation(),t.toggle()}))},e._getConfig=function(t){return t=a({},this.constructor.Default,i.default(this._element).data(),t),l.typeCheckConfig(Ot,t,this.constructor.DefaultType),t},e._getMenuElement=function(){if(!this._menu){var e=t._getParentFromElement(this._element);e&&(this._menu=e.querySelector(".dropdown-menu"))}return this._menu},e._getPlacement=function(){var t=i.default(this._element.parentNode),e="bottom-start";return t.hasClass("dropup")?e=i.default(this._menu).hasClass("dropdown-menu-right")?"top-end":"top-start":t.hasClass("dropright")?e="right-start":t.hasClass("dropleft")?e="left-start":i.default(this._menu).hasClass("dropdown-menu-right")&&(e="bottom-end"),e},e._detectNavbar=function(){return i.default(this._element).closest(".navbar").length>0},e._getOffset=function(){var t=this,e={};return"function"==typeof this._config.offset?e.fn=function(e){return e.offsets=a({},e.offsets,t._config.offset(e.offsets,t._element)||{}),e}:e.offset=this._config.offset,e},e._getPopperConfig=function(){var t={placement:this._getPlacement(),modifiers:{offset:this._getOffset(),flip:{enabled:this._config.flip},preventOverflow:{boundariesElement:this._config.boundary}}};return"static"===this._config.display&&(t.modifiers.applyStyle={enabled:!1}),a({},t,this._config.popperConfig)},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this).data("bs.dropdown");if(n||(n=new t(this,"object"==typeof e?e:null),i.default(this).data("bs.dropdown",n)),"string"==typeof e){if("undefined"==typeof n[e])throw new TypeError('No method named "'+e+'"');n[e]()}}))},t._clearMenus=function(e){if(!e||3!==e.which&&("keyup"!==e.type||9===e.which))for(var n=[].slice.call(document.querySelectorAll('[data-toggle="dropdown"]')),o=0,r=n.length;o0&&a--,40===e.which&&adocument.documentElement.clientHeight;n||(this._element.style.overflowY="hidden"),this._element.classList.add("modal-static");var o=l.getTransitionDurationFromElement(this._dialog);i.default(this._element).off(l.TRANSITION_END),i.default(this._element).one(l.TRANSITION_END,(function(){t._element.classList.remove("modal-static"),n||i.default(t._element).one(l.TRANSITION_END,(function(){t._element.style.overflowY=""})).emulateTransitionEnd(t._element,o)})).emulateTransitionEnd(o),this._element.focus()}},e._showElement=function(t){var e=this,n=i.default(this._element).hasClass("fade"),o=this._dialog?this._dialog.querySelector(".modal-body"):null;this._element.parentNode&&this._element.parentNode.nodeType===Node.ELEMENT_NODE||document.body.appendChild(this._element),this._element.style.display="block",this._element.removeAttribute("aria-hidden"),this._element.setAttribute("aria-modal",!0),this._element.setAttribute("role","dialog"),i.default(this._dialog).hasClass("modal-dialog-scrollable")&&o?o.scrollTop=0:this._element.scrollTop=0,n&&l.reflow(this._element),i.default(this._element).addClass("show"),this._config.focus&&this._enforceFocus();var r=i.default.Event("shown.bs.modal",{relatedTarget:t}),a=function(){e._config.focus&&e._element.focus(),e._isTransitioning=!1,i.default(e._element).trigger(r)};if(n){var s=l.getTransitionDurationFromElement(this._dialog);i.default(this._dialog).one(l.TRANSITION_END,a).emulateTransitionEnd(s)}else a()},e._enforceFocus=function(){var t=this;i.default(document).off("focusin.bs.modal").on("focusin.bs.modal",(function(e){document!==e.target&&t._element!==e.target&&0===i.default(t._element).has(e.target).length&&t._element.focus()}))},e._setEscapeEvent=function(){var t=this;this._isShown?i.default(this._element).on("keydown.dismiss.bs.modal",(function(e){t._config.keyboard&&27===e.which?(e.preventDefault(),t.hide()):t._config.keyboard||27!==e.which||t._triggerBackdropTransition()})):this._isShown||i.default(this._element).off("keydown.dismiss.bs.modal")},e._setResizeEvent=function(){var t=this;this._isShown?i.default(window).on("resize.bs.modal",(function(e){return t.handleUpdate(e)})):i.default(window).off("resize.bs.modal")},e._hideModal=function(){var t=this;this._element.style.display="none",this._element.setAttribute("aria-hidden",!0),this._element.removeAttribute("aria-modal"),this._element.removeAttribute("role"),this._isTransitioning=!1,this._showBackdrop((function(){i.default(document.body).removeClass("modal-open"),t._resetAdjustments(),t._resetScrollbar(),i.default(t._element).trigger("hidden.bs.modal")}))},e._removeBackdrop=function(){this._backdrop&&(i.default(this._backdrop).remove(),this._backdrop=null)},e._showBackdrop=function(t){var e=this,n=i.default(this._element).hasClass("fade")?"fade":"";if(this._isShown&&this._config.backdrop){if(this._backdrop=document.createElement("div"),this._backdrop.className="modal-backdrop",n&&this._backdrop.classList.add(n),i.default(this._backdrop).appendTo(document.body),i.default(this._element).on("click.dismiss.bs.modal",(function(t){e._ignoreBackdropClick?e._ignoreBackdropClick=!1:t.target===t.currentTarget&&("static"===e._config.backdrop?e._triggerBackdropTransition():e.hide())})),n&&l.reflow(this._backdrop),i.default(this._backdrop).addClass("show"),!t)return;if(!n)return void t();var o=l.getTransitionDurationFromElement(this._backdrop);i.default(this._backdrop).one(l.TRANSITION_END,t).emulateTransitionEnd(o)}else if(!this._isShown&&this._backdrop){i.default(this._backdrop).removeClass("show");var r=function(){e._removeBackdrop(),t&&t()};if(i.default(this._element).hasClass("fade")){var a=l.getTransitionDurationFromElement(this._backdrop);i.default(this._backdrop).one(l.TRANSITION_END,r).emulateTransitionEnd(a)}else r()}else t&&t()},e._adjustDialog=function(){var t=this._element.scrollHeight>document.documentElement.clientHeight;!this._isBodyOverflowing&&t&&(this._element.style.paddingLeft=this._scrollbarWidth+"px"),this._isBodyOverflowing&&!t&&(this._element.style.paddingRight=this._scrollbarWidth+"px")},e._resetAdjustments=function(){this._element.style.paddingLeft="",this._element.style.paddingRight=""},e._checkScrollbar=function(){var t=document.body.getBoundingClientRect();this._isBodyOverflowing=Math.round(t.left+t.right)
',trigger:"hover focus",title:"",delay:0,html:!1,selector:!1,placement:"top",offset:0,container:!1,fallbackPlacement:"flip",boundary:"scrollParent",customClass:"",sanitize:!0,sanitizeFn:null,whiteList:Qt,popperConfig:null},Zt={HIDE:"hide.bs.tooltip",HIDDEN:"hidden.bs.tooltip",SHOW:"show.bs.tooltip",SHOWN:"shown.bs.tooltip",INSERTED:"inserted.bs.tooltip",CLICK:"click.bs.tooltip",FOCUSIN:"focusin.bs.tooltip",FOCUSOUT:"focusout.bs.tooltip",MOUSEENTER:"mouseenter.bs.tooltip",MOUSELEAVE:"mouseleave.bs.tooltip"},te=function(){function t(t,e){if("undefined"==typeof It)throw new TypeError("Bootstrap's tooltips require Popper (https://popper.js.org)");this._isEnabled=!0,this._timeout=0,this._hoverState="",this._activeTrigger={},this._popper=null,this.element=t,this.config=this._getConfig(e),this.tip=null,this._setListeners()}var e=t.prototype;return e.enable=function(){this._isEnabled=!0},e.disable=function(){this._isEnabled=!1},e.toggleEnabled=function(){this._isEnabled=!this._isEnabled},e.toggle=function(t){if(this._isEnabled)if(t){var e=this.constructor.DATA_KEY,n=i.default(t.currentTarget).data(e);n||(n=new this.constructor(t.currentTarget,this._getDelegateConfig()),i.default(t.currentTarget).data(e,n)),n._activeTrigger.click=!n._activeTrigger.click,n._isWithActiveTrigger()?n._enter(null,n):n._leave(null,n)}else{if(i.default(this.getTipElement()).hasClass("show"))return void this._leave(null,this);this._enter(null,this)}},e.dispose=function(){clearTimeout(this._timeout),i.default.removeData(this.element,this.constructor.DATA_KEY),i.default(this.element).off(this.constructor.EVENT_KEY),i.default(this.element).closest(".modal").off("hide.bs.modal",this._hideModalHandler),this.tip&&i.default(this.tip).remove(),this._isEnabled=null,this._timeout=null,this._hoverState=null,this._activeTrigger=null,this._popper&&this._popper.destroy(),this._popper=null,this.element=null,this.config=null,this.tip=null},e.show=function(){var t=this;if("none"===i.default(this.element).css("display"))throw new Error("Please use show on visible elements");var e=i.default.Event(this.constructor.Event.SHOW);if(this.isWithContent()&&this._isEnabled){i.default(this.element).trigger(e);var n=l.findShadowRoot(this.element),o=i.default.contains(null!==n?n:this.element.ownerDocument.documentElement,this.element);if(e.isDefaultPrevented()||!o)return;var r=this.getTipElement(),a=l.getUID(this.constructor.NAME);r.setAttribute("id",a),this.element.setAttribute("aria-describedby",a),this.setContent(),this.config.animation&&i.default(r).addClass("fade");var s="function"==typeof this.config.placement?this.config.placement.call(this,r,this.element):this.config.placement,u=this._getAttachment(s);this.addAttachmentClass(u);var f=this._getContainer();i.default(r).data(this.constructor.DATA_KEY,this),i.default.contains(this.element.ownerDocument.documentElement,this.tip)||i.default(r).appendTo(f),i.default(this.element).trigger(this.constructor.Event.INSERTED),this._popper=new It(this.element,r,this._getPopperConfig(u)),i.default(r).addClass("show"),i.default(r).addClass(this.config.customClass),"ontouchstart"in document.documentElement&&i.default(document.body).children().on("mouseover",null,i.default.noop);var d=function(){t.config.animation&&t._fixTransition();var e=t._hoverState;t._hoverState=null,i.default(t.element).trigger(t.constructor.Event.SHOWN),"out"===e&&t._leave(null,t)};if(i.default(this.tip).hasClass("fade")){var c=l.getTransitionDurationFromElement(this.tip);i.default(this.tip).one(l.TRANSITION_END,d).emulateTransitionEnd(c)}else d()}},e.hide=function(t){var e=this,n=this.getTipElement(),o=i.default.Event(this.constructor.Event.HIDE),r=function(){"show"!==e._hoverState&&n.parentNode&&n.parentNode.removeChild(n),e._cleanTipClass(),e.element.removeAttribute("aria-describedby"),i.default(e.element).trigger(e.constructor.Event.HIDDEN),null!==e._popper&&e._popper.destroy(),t&&t()};if(i.default(this.element).trigger(o),!o.isDefaultPrevented()){if(i.default(n).removeClass("show"),"ontouchstart"in document.documentElement&&i.default(document.body).children().off("mouseover",null,i.default.noop),this._activeTrigger.click=!1,this._activeTrigger.focus=!1,this._activeTrigger.hover=!1,i.default(this.tip).hasClass("fade")){var a=l.getTransitionDurationFromElement(n);i.default(n).one(l.TRANSITION_END,r).emulateTransitionEnd(a)}else r();this._hoverState=""}},e.update=function(){null!==this._popper&&this._popper.scheduleUpdate()},e.isWithContent=function(){return Boolean(this.getTitle())},e.addAttachmentClass=function(t){i.default(this.getTipElement()).addClass("bs-tooltip-"+t)},e.getTipElement=function(){return this.tip=this.tip||i.default(this.config.template)[0],this.tip},e.setContent=function(){var t=this.getTipElement();this.setElementContent(i.default(t.querySelectorAll(".tooltip-inner")),this.getTitle()),i.default(t).removeClass("fade show")},e.setElementContent=function(t,e){"object"!=typeof e||!e.nodeType&&!e.jquery?this.config.html?(this.config.sanitize&&(e=Vt(e,this.config.whiteList,this.config.sanitizeFn)),t.html(e)):t.text(e):this.config.html?i.default(e).parent().is(t)||t.empty().append(e):t.text(i.default(e).text())},e.getTitle=function(){var t=this.element.getAttribute("data-original-title");return t||(t="function"==typeof this.config.title?this.config.title.call(this.element):this.config.title),t},e._getPopperConfig=function(t){var e=this;return a({},{placement:t,modifiers:{offset:this._getOffset(),flip:{behavior:this.config.fallbackPlacement},arrow:{element:".arrow"},preventOverflow:{boundariesElement:this.config.boundary}},onCreate:function(t){t.originalPlacement!==t.placement&&e._handlePopperPlacementChange(t)},onUpdate:function(t){return e._handlePopperPlacementChange(t)}},this.config.popperConfig)},e._getOffset=function(){var t=this,e={};return"function"==typeof this.config.offset?e.fn=function(e){return e.offsets=a({},e.offsets,t.config.offset(e.offsets,t.element)||{}),e}:e.offset=this.config.offset,e},e._getContainer=function(){return!1===this.config.container?document.body:l.isElement(this.config.container)?i.default(this.config.container):i.default(document).find(this.config.container)},e._getAttachment=function(t){return $t[t.toUpperCase()]},e._setListeners=function(){var t=this;this.config.trigger.split(" ").forEach((function(e){if("click"===e)i.default(t.element).on(t.constructor.Event.CLICK,t.config.selector,(function(e){return t.toggle(e)}));else if("manual"!==e){var n="hover"===e?t.constructor.Event.MOUSEENTER:t.constructor.Event.FOCUSIN,o="hover"===e?t.constructor.Event.MOUSELEAVE:t.constructor.Event.FOCUSOUT;i.default(t.element).on(n,t.config.selector,(function(e){return t._enter(e)})).on(o,t.config.selector,(function(e){return t._leave(e)}))}})),this._hideModalHandler=function(){t.element&&t.hide()},i.default(this.element).closest(".modal").on("hide.bs.modal",this._hideModalHandler),this.config.selector?this.config=a({},this.config,{trigger:"manual",selector:""}):this._fixTitle()},e._fixTitle=function(){var t=typeof this.element.getAttribute("data-original-title");(this.element.getAttribute("title")||"string"!==t)&&(this.element.setAttribute("data-original-title",this.element.getAttribute("title")||""),this.element.setAttribute("title",""))},e._enter=function(t,e){var n=this.constructor.DATA_KEY;(e=e||i.default(t.currentTarget).data(n))||(e=new this.constructor(t.currentTarget,this._getDelegateConfig()),i.default(t.currentTarget).data(n,e)),t&&(e._activeTrigger["focusin"===t.type?"focus":"hover"]=!0),i.default(e.getTipElement()).hasClass("show")||"show"===e._hoverState?e._hoverState="show":(clearTimeout(e._timeout),e._hoverState="show",e.config.delay&&e.config.delay.show?e._timeout=setTimeout((function(){"show"===e._hoverState&&e.show()}),e.config.delay.show):e.show())},e._leave=function(t,e){var n=this.constructor.DATA_KEY;(e=e||i.default(t.currentTarget).data(n))||(e=new this.constructor(t.currentTarget,this._getDelegateConfig()),i.default(t.currentTarget).data(n,e)),t&&(e._activeTrigger["focusout"===t.type?"focus":"hover"]=!1),e._isWithActiveTrigger()||(clearTimeout(e._timeout),e._hoverState="out",e.config.delay&&e.config.delay.hide?e._timeout=setTimeout((function(){"out"===e._hoverState&&e.hide()}),e.config.delay.hide):e.hide())},e._isWithActiveTrigger=function(){for(var t in this._activeTrigger)if(this._activeTrigger[t])return!0;return!1},e._getConfig=function(t){var e=i.default(this.element).data();return Object.keys(e).forEach((function(t){-1!==Kt.indexOf(t)&&delete e[t]})),"number"==typeof(t=a({},this.constructor.Default,e,"object"==typeof t&&t?t:{})).delay&&(t.delay={show:t.delay,hide:t.delay}),"number"==typeof t.title&&(t.title=t.title.toString()),"number"==typeof t.content&&(t.content=t.content.toString()),l.typeCheckConfig(Yt,t,this.constructor.DefaultType),t.sanitize&&(t.template=Vt(t.template,t.whiteList,t.sanitizeFn)),t},e._getDelegateConfig=function(){var t={};if(this.config)for(var e in this.config)this.constructor.Default[e]!==this.config[e]&&(t[e]=this.config[e]);return t},e._cleanTipClass=function(){var t=i.default(this.getTipElement()),e=t.attr("class").match(Xt);null!==e&&e.length&&t.removeClass(e.join(""))},e._handlePopperPlacementChange=function(t){this.tip=t.instance.popper,this._cleanTipClass(),this.addAttachmentClass(this._getAttachment(t.placement))},e._fixTransition=function(){var t=this.getTipElement(),e=this.config.animation;null===t.getAttribute("x-placement")&&(i.default(t).removeClass("fade"),this.config.animation=!1,this.hide(),this.show(),this.config.animation=e)},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this),o=n.data("bs.tooltip"),r="object"==typeof e&&e;if((o||!/dispose|hide/.test(e))&&(o||(o=new t(this,r),n.data("bs.tooltip",o)),"string"==typeof e)){if("undefined"==typeof o[e])throw new TypeError('No method named "'+e+'"');o[e]()}}))},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}},{key:"Default",get:function(){return Jt}},{key:"NAME",get:function(){return Yt}},{key:"DATA_KEY",get:function(){return"bs.tooltip"}},{key:"Event",get:function(){return Zt}},{key:"EVENT_KEY",get:function(){return".bs.tooltip"}},{key:"DefaultType",get:function(){return Gt}}]),t}();i.default.fn[Yt]=te._jQueryInterface,i.default.fn[Yt].Constructor=te,i.default.fn[Yt].noConflict=function(){return i.default.fn[Yt]=zt,te._jQueryInterface};var ee="popover",ne=i.default.fn[ee],ie=new RegExp("(^|\\s)bs-popover\\S+","g"),oe=a({},te.Default,{placement:"right",trigger:"click",content:"",template:''}),re=a({},te.DefaultType,{content:"(string|element|function)"}),ae={HIDE:"hide.bs.popover",HIDDEN:"hidden.bs.popover",SHOW:"show.bs.popover",SHOWN:"shown.bs.popover",INSERTED:"inserted.bs.popover",CLICK:"click.bs.popover",FOCUSIN:"focusin.bs.popover",FOCUSOUT:"focusout.bs.popover",MOUSEENTER:"mouseenter.bs.popover",MOUSELEAVE:"mouseleave.bs.popover"},se=function(t){var e,n;function o(){return t.apply(this,arguments)||this}n=t,(e=o).prototype=Object.create(n.prototype),e.prototype.constructor=e,e.__proto__=n;var a=o.prototype;return a.isWithContent=function(){return this.getTitle()||this._getContent()},a.addAttachmentClass=function(t){i.default(this.getTipElement()).addClass("bs-popover-"+t)},a.getTipElement=function(){return this.tip=this.tip||i.default(this.config.template)[0],this.tip},a.setContent=function(){var t=i.default(this.getTipElement());this.setElementContent(t.find(".popover-header"),this.getTitle());var e=this._getContent();"function"==typeof e&&(e=e.call(this.element)),this.setElementContent(t.find(".popover-body"),e),t.removeClass("fade show")},a._getContent=function(){return this.element.getAttribute("data-content")||this.config.content},a._cleanTipClass=function(){var t=i.default(this.getTipElement()),e=t.attr("class").match(ie);null!==e&&e.length>0&&t.removeClass(e.join(""))},o._jQueryInterface=function(t){return this.each((function(){var e=i.default(this).data("bs.popover"),n="object"==typeof t?t:null;if((e||!/dispose|hide/.test(t))&&(e||(e=new o(this,n),i.default(this).data("bs.popover",e)),"string"==typeof t)){if("undefined"==typeof e[t])throw new TypeError('No method named "'+t+'"');e[t]()}}))},r(o,null,[{key:"VERSION",get:function(){return"4.6.0"}},{key:"Default",get:function(){return oe}},{key:"NAME",get:function(){return ee}},{key:"DATA_KEY",get:function(){return"bs.popover"}},{key:"Event",get:function(){return ae}},{key:"EVENT_KEY",get:function(){return".bs.popover"}},{key:"DefaultType",get:function(){return re}}]),o}(te);i.default.fn[ee]=se._jQueryInterface,i.default.fn[ee].Constructor=se,i.default.fn[ee].noConflict=function(){return i.default.fn[ee]=ne,se._jQueryInterface};var le="scrollspy",ue=i.default.fn[le],fe={offset:10,method:"auto",target:""},de={offset:"number",method:"string",target:"(string|element)"},ce=function(){function t(t,e){var n=this;this._element=t,this._scrollElement="BODY"===t.tagName?window:t,this._config=this._getConfig(e),this._selector=this._config.target+" .nav-link,"+this._config.target+" .list-group-item,"+this._config.target+" .dropdown-item",this._offsets=[],this._targets=[],this._activeTarget=null,this._scrollHeight=0,i.default(this._scrollElement).on("scroll.bs.scrollspy",(function(t){return n._process(t)})),this.refresh(),this._process()}var e=t.prototype;return e.refresh=function(){var t=this,e=this._scrollElement===this._scrollElement.window?"offset":"position",n="auto"===this._config.method?e:this._config.method,o="position"===n?this._getScrollTop():0;this._offsets=[],this._targets=[],this._scrollHeight=this._getScrollHeight(),[].slice.call(document.querySelectorAll(this._selector)).map((function(t){var e,r=l.getSelectorFromElement(t);if(r&&(e=document.querySelector(r)),e){var a=e.getBoundingClientRect();if(a.width||a.height)return[i.default(e)[n]().top+o,r]}return null})).filter((function(t){return t})).sort((function(t,e){return t[0]-e[0]})).forEach((function(e){t._offsets.push(e[0]),t._targets.push(e[1])}))},e.dispose=function(){i.default.removeData(this._element,"bs.scrollspy"),i.default(this._scrollElement).off(".bs.scrollspy"),this._element=null,this._scrollElement=null,this._config=null,this._selector=null,this._offsets=null,this._targets=null,this._activeTarget=null,this._scrollHeight=null},e._getConfig=function(t){if("string"!=typeof(t=a({},fe,"object"==typeof t&&t?t:{})).target&&l.isElement(t.target)){var e=i.default(t.target).attr("id");e||(e=l.getUID(le),i.default(t.target).attr("id",e)),t.target="#"+e}return l.typeCheckConfig(le,t,de),t},e._getScrollTop=function(){return this._scrollElement===window?this._scrollElement.pageYOffset:this._scrollElement.scrollTop},e._getScrollHeight=function(){return this._scrollElement.scrollHeight||Math.max(document.body.scrollHeight,document.documentElement.scrollHeight)},e._getOffsetHeight=function(){return this._scrollElement===window?window.innerHeight:this._scrollElement.getBoundingClientRect().height},e._process=function(){var t=this._getScrollTop()+this._config.offset,e=this._getScrollHeight(),n=this._config.offset+e-this._getOffsetHeight();if(this._scrollHeight!==e&&this.refresh(),t>=n){var i=this._targets[this._targets.length-1];this._activeTarget!==i&&this._activate(i)}else{if(this._activeTarget&&t0)return this._activeTarget=null,void this._clear();for(var o=this._offsets.length;o--;){this._activeTarget!==this._targets[o]&&t>=this._offsets[o]&&("undefined"==typeof this._offsets[o+1]||t li > .active":".active";n=(n=i.default.makeArray(i.default(o).find(a)))[n.length-1]}var s=i.default.Event("hide.bs.tab",{relatedTarget:this._element}),u=i.default.Event("show.bs.tab",{relatedTarget:n});if(n&&i.default(n).trigger(s),i.default(this._element).trigger(u),!u.isDefaultPrevented()&&!s.isDefaultPrevented()){r&&(e=document.querySelector(r)),this._activate(this._element,o);var f=function(){var e=i.default.Event("hidden.bs.tab",{relatedTarget:t._element}),o=i.default.Event("shown.bs.tab",{relatedTarget:n});i.default(n).trigger(e),i.default(t._element).trigger(o)};e?this._activate(e,e.parentNode,f):f()}}},e.dispose=function(){i.default.removeData(this._element,"bs.tab"),this._element=null},e._activate=function(t,e,n){var o=this,r=(!e||"UL"!==e.nodeName&&"OL"!==e.nodeName?i.default(e).children(".active"):i.default(e).find("> li > .active"))[0],a=n&&r&&i.default(r).hasClass("fade"),s=function(){return o._transitionComplete(t,r,n)};if(r&&a){var u=l.getTransitionDurationFromElement(r);i.default(r).removeClass("show").one(l.TRANSITION_END,s).emulateTransitionEnd(u)}else s()},e._transitionComplete=function(t,e,n){if(e){i.default(e).removeClass("active");var o=i.default(e.parentNode).find("> .dropdown-menu .active")[0];o&&i.default(o).removeClass("active"),"tab"===e.getAttribute("role")&&e.setAttribute("aria-selected",!1)}if(i.default(t).addClass("active"),"tab"===t.getAttribute("role")&&t.setAttribute("aria-selected",!0),l.reflow(t),t.classList.contains("fade")&&t.classList.add("show"),t.parentNode&&i.default(t.parentNode).hasClass("dropdown-menu")){var r=i.default(t).closest(".dropdown")[0];if(r){var a=[].slice.call(r.querySelectorAll(".dropdown-toggle"));i.default(a).addClass("active")}t.setAttribute("aria-expanded",!0)}n&&n()},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this),o=n.data("bs.tab");if(o||(o=new t(this),n.data("bs.tab",o)),"string"==typeof e){if("undefined"==typeof o[e])throw new TypeError('No method named "'+e+'"');o[e]()}}))},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}}]),t}();i.default(document).on("click.bs.tab.data-api",'[data-toggle="tab"], [data-toggle="pill"], [data-toggle="list"]',(function(t){t.preventDefault(),pe._jQueryInterface.call(i.default(this),"show")})),i.default.fn.tab=pe._jQueryInterface,i.default.fn.tab.Constructor=pe,i.default.fn.tab.noConflict=function(){return i.default.fn.tab=he,pe._jQueryInterface};var me=i.default.fn.toast,ge={animation:"boolean",autohide:"boolean",delay:"number"},ve={animation:!0,autohide:!0,delay:500},_e=function(){function t(t,e){this._element=t,this._config=this._getConfig(e),this._timeout=null,this._setListeners()}var e=t.prototype;return e.show=function(){var t=this,e=i.default.Event("show.bs.toast");if(i.default(this._element).trigger(e),!e.isDefaultPrevented()){this._clearTimeout(),this._config.animation&&this._element.classList.add("fade");var n=function(){t._element.classList.remove("showing"),t._element.classList.add("show"),i.default(t._element).trigger("shown.bs.toast"),t._config.autohide&&(t._timeout=setTimeout((function(){t.hide()}),t._config.delay))};if(this._element.classList.remove("hide"),l.reflow(this._element),this._element.classList.add("showing"),this._config.animation){var o=l.getTransitionDurationFromElement(this._element);i.default(this._element).one(l.TRANSITION_END,n).emulateTransitionEnd(o)}else n()}},e.hide=function(){if(this._element.classList.contains("show")){var t=i.default.Event("hide.bs.toast");i.default(this._element).trigger(t),t.isDefaultPrevented()||this._close()}},e.dispose=function(){this._clearTimeout(),this._element.classList.contains("show")&&this._element.classList.remove("show"),i.default(this._element).off("click.dismiss.bs.toast"),i.default.removeData(this._element,"bs.toast"),this._element=null,this._config=null},e._getConfig=function(t){return t=a({},ve,i.default(this._element).data(),"object"==typeof t&&t?t:{}),l.typeCheckConfig("toast",t,this.constructor.DefaultType),t},e._setListeners=function(){var t=this;i.default(this._element).on("click.dismiss.bs.toast",'[data-dismiss="toast"]',(function(){return t.hide()}))},e._close=function(){var t=this,e=function(){t._element.classList.add("hide"),i.default(t._element).trigger("hidden.bs.toast")};if(this._element.classList.remove("show"),this._config.animation){var n=l.getTransitionDurationFromElement(this._element);i.default(this._element).one(l.TRANSITION_END,e).emulateTransitionEnd(n)}else e()},e._clearTimeout=function(){clearTimeout(this._timeout),this._timeout=null},t._jQueryInterface=function(e){return this.each((function(){var n=i.default(this),o=n.data("bs.toast");if(o||(o=new t(this,"object"==typeof e&&e),n.data("bs.toast",o)),"string"==typeof e){if("undefined"==typeof o[e])throw new TypeError('No method named "'+e+'"');o[e](this)}}))},r(t,null,[{key:"VERSION",get:function(){return"4.6.0"}},{key:"DefaultType",get:function(){return ge}},{key:"Default",get:function(){return ve}}]),t}();i.default.fn.toast=_e._jQueryInterface,i.default.fn.toast.Constructor=_e,i.default.fn.toast.noConflict=function(){return i.default.fn.toast=me,_e._jQueryInterface},t.Alert=d,t.Button=h,t.Carousel=y,t.Collapse=S,t.Dropdown=Ft,t.Modal=qt,t.Popover=se,t.Scrollspy=ce,t.Tab=pe,t.Toast=_e,t.Tooltip=te,t.Util=l,Object.defineProperty(t,"__esModule",{value:!0})})); +//# sourceMappingURL=bootstrap.bundle.min.js.map \ No newline at end of file diff --git a/assets/js/breakpoints.min.js b/assets/js/breakpoints.min.js new file mode 100644 index 0000000000..32419ccb96 --- /dev/null +++ b/assets/js/breakpoints.min.js @@ -0,0 +1,2 @@ +/* breakpoints.js v1.0 | @ajlkn | MIT licensed */ +var breakpoints=function(){"use strict";function e(e){t.init(e)}var t={list:null,media:{},events:[],init:function(e){t.list=e,window.addEventListener("resize",t.poll),window.addEventListener("orientationchange",t.poll),window.addEventListener("load",t.poll),window.addEventListener("fullscreenchange",t.poll)},active:function(e){var n,a,s,i,r,d,c;if(!(e in t.media)){if(">="==e.substr(0,2)?(a="gte",n=e.substr(2)):"<="==e.substr(0,2)?(a="lte",n=e.substr(2)):">"==e.substr(0,1)?(a="gt",n=e.substr(1)):"<"==e.substr(0,1)?(a="lt",n=e.substr(1)):"!"==e.substr(0,1)?(a="not",n=e.substr(1)):(a="eq",n=e),n&&n in t.list)if(i=t.list[n],Array.isArray(i)){if(r=parseInt(i[0]),d=parseInt(i[1]),isNaN(r)){if(isNaN(d))return;c=i[1].substr(String(d).length)}else c=i[0].substr(String(r).length);if(isNaN(r))switch(a){case"gte":s="screen";break;case"lte":s="screen and (max-width: "+d+c+")";break;case"gt":s="screen and (min-width: "+(d+1)+c+")";break;case"lt":s="screen and (max-width: -1px)";break;case"not":s="screen and (min-width: "+(d+1)+c+")";break;default:s="screen and (max-width: "+d+c+")"}else if(isNaN(d))switch(a){case"gte":s="screen and (min-width: "+r+c+")";break;case"lte":s="screen";break;case"gt":s="screen and (max-width: -1px)";break;case"lt":s="screen and (max-width: "+(r-1)+c+")";break;case"not":s="screen and (max-width: "+(r-1)+c+")";break;default:s="screen and (min-width: "+r+c+")"}else switch(a){case"gte":s="screen and (min-width: "+r+c+")";break;case"lte":s="screen and (max-width: "+d+c+")";break;case"gt":s="screen and (min-width: "+(d+1)+c+")";break;case"lt":s="screen and (max-width: "+(r-1)+c+")";break;case"not":s="screen and (max-width: "+(r-1)+c+"), screen and (min-width: "+(d+1)+c+")";break;default:s="screen and (min-width: "+r+c+") and (max-width: "+d+c+")"}}else s="("==i.charAt(0)?"screen and "+i:i;t.media[e]=!!s&&s}return t.media[e]!==!1&&window.matchMedia(t.media[e]).matches},on:function(e,n){t.events.push({query:e,handler:n,state:!1}),t.active(e)&&n()},poll:function(){var e,n;for(e=0;e0:!!("ontouchstart"in window),e.mobile="wp"==e.os||"android"==e.os||"ios"==e.os||"bb"==e.os}};return e.init(),e}();!function(e,n){"function"==typeof define&&define.amd?define([],n):"object"==typeof exports?module.exports=n():e.browser=n()}(this,function(){return browser}); diff --git a/assets/js/google-map.js b/assets/js/google-map.js new file mode 100644 index 0000000000..79143c5da4 --- /dev/null +++ b/assets/js/google-map.js @@ -0,0 +1,62 @@ + +var google; + +function init() { + // Basic options for a simple Google Map + // For more options see: https://developers.google.com/maps/documentation/javascript/reference#MapOptions + // var myLatlng = new google.maps.LatLng(40.71751, -73.990922); + var myLatlng = new google.maps.LatLng(40.69847032728747, -73.9514422416687); + // 39.399872 + // -8.224454 + + var mapOptions = { + // How zoomed in you want the map to start at (always required) + zoom: 7, + + // The latitude and longitude to center the map (always required) + center: myLatlng, + + // How you would like to style the map. + scrollwheel: false, + styles: [ + { + "featureType": "administrative.country", + "elementType": "geometry", + "stylers": [ + { + "visibility": "simplified" + }, + { + "hue": "#ff0000" + } + ] + } + ] + }; + + + + // Get the HTML DOM element that will contain your map + // We are using a div with id="map" seen below in the + var mapElement = document.getElementById('map'); + + // Create the Google Map using out element and options defined above + var map = new google.maps.Map(mapElement, mapOptions); + + var addresses = ['New York']; + + for (var x = 0; x < addresses.length; x++) { + $.getJSON('http://maps.googleapis.com/maps/api/geocode/json?address='+addresses[x]+'&sensor=false', null, function (data) { + var p = data.results[0].geometry.location + var latlng = new google.maps.LatLng(p.lat, p.lng); + new google.maps.Marker({ + position: latlng, + map: map, + icon: 'images/loc.png' + }); + + }); + } + +} +google.maps.event.addDomListener(window, 'load', init); \ No newline at end of file diff --git a/assets/js/jquery-3.2.1.min.js b/assets/js/jquery-3.2.1.min.js new file mode 100644 index 0000000000..bcd3956c82 --- /dev/null +++ b/assets/js/jquery-3.2.1.min.js @@ -0,0 +1,4 @@ +/*! jQuery v3.2.1 | (c) JS Foundation and other contributors | jquery.org/license */ +!function(a,b){"use strict";"object"==typeof module&&"object"==typeof module.exports?module.exports=a.document?b(a,!0):function(a){if(!a.document)throw new Error("jQuery requires a window with a document");return b(a)}:b(a)}("undefined"!=typeof window?window:this,function(a,b){"use strict";var c=[],d=a.document,e=Object.getPrototypeOf,f=c.slice,g=c.concat,h=c.push,i=c.indexOf,j={},k=j.toString,l=j.hasOwnProperty,m=l.toString,n=m.call(Object),o={};function p(a,b){b=b||d;var c=b.createElement("script");c.text=a,b.head.appendChild(c).parentNode.removeChild(c)}var q="3.2.1",r=function(a,b){return new r.fn.init(a,b)},s=/^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,t=/^-ms-/,u=/-([a-z])/g,v=function(a,b){return b.toUpperCase()};r.fn=r.prototype={jquery:q,constructor:r,length:0,toArray:function(){return f.call(this)},get:function(a){return null==a?f.call(this):a<0?this[a+this.length]:this[a]},pushStack:function(a){var b=r.merge(this.constructor(),a);return b.prevObject=this,b},each:function(a){return r.each(this,a)},map:function(a){return this.pushStack(r.map(this,function(b,c){return a.call(b,c,b)}))},slice:function(){return this.pushStack(f.apply(this,arguments))},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},eq:function(a){var b=this.length,c=+a+(a<0?b:0);return this.pushStack(c>=0&&c0&&b-1 in a)}var x=function(a){var b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u="sizzle"+1*new Date,v=a.document,w=0,x=0,y=ha(),z=ha(),A=ha(),B=function(a,b){return a===b&&(l=!0),0},C={}.hasOwnProperty,D=[],E=D.pop,F=D.push,G=D.push,H=D.slice,I=function(a,b){for(var c=0,d=a.length;c+~]|"+K+")"+K+"*"),S=new RegExp("="+K+"*([^\\]'\"]*?)"+K+"*\\]","g"),T=new RegExp(N),U=new RegExp("^"+L+"$"),V={ID:new RegExp("^#("+L+")"),CLASS:new RegExp("^\\.("+L+")"),TAG:new RegExp("^("+L+"|[*])"),ATTR:new RegExp("^"+M),PSEUDO:new RegExp("^"+N),CHILD:new RegExp("^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\("+K+"*(even|odd|(([+-]|)(\\d*)n|)"+K+"*(?:([+-]|)"+K+"*(\\d+)|))"+K+"*\\)|)","i"),bool:new RegExp("^(?:"+J+")$","i"),needsContext:new RegExp("^"+K+"*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\("+K+"*((?:-\\d)?\\d*)"+K+"*\\)|)(?=[^-]|$)","i")},W=/^(?:input|select|textarea|button)$/i,X=/^h\d$/i,Y=/^[^{]+\{\s*\[native \w/,Z=/^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,$=/[+~]/,_=new RegExp("\\\\([\\da-f]{1,6}"+K+"?|("+K+")|.)","ig"),aa=function(a,b,c){var d="0x"+b-65536;return d!==d||c?b:d<0?String.fromCharCode(d+65536):String.fromCharCode(d>>10|55296,1023&d|56320)},ba=/([\0-\x1f\x7f]|^-?\d)|^-$|[^\0-\x1f\x7f-\uFFFF\w-]/g,ca=function(a,b){return b?"\0"===a?"\ufffd":a.slice(0,-1)+"\\"+a.charCodeAt(a.length-1).toString(16)+" ":"\\"+a},da=function(){m()},ea=ta(function(a){return a.disabled===!0&&("form"in a||"label"in a)},{dir:"parentNode",next:"legend"});try{G.apply(D=H.call(v.childNodes),v.childNodes),D[v.childNodes.length].nodeType}catch(fa){G={apply:D.length?function(a,b){F.apply(a,H.call(b))}:function(a,b){var c=a.length,d=0;while(a[c++]=b[d++]);a.length=c-1}}}function ga(a,b,d,e){var f,h,j,k,l,o,r,s=b&&b.ownerDocument,w=b?b.nodeType:9;if(d=d||[],"string"!=typeof a||!a||1!==w&&9!==w&&11!==w)return d;if(!e&&((b?b.ownerDocument||b:v)!==n&&m(b),b=b||n,p)){if(11!==w&&(l=Z.exec(a)))if(f=l[1]){if(9===w){if(!(j=b.getElementById(f)))return d;if(j.id===f)return d.push(j),d}else if(s&&(j=s.getElementById(f))&&t(b,j)&&j.id===f)return d.push(j),d}else{if(l[2])return G.apply(d,b.getElementsByTagName(a)),d;if((f=l[3])&&c.getElementsByClassName&&b.getElementsByClassName)return G.apply(d,b.getElementsByClassName(f)),d}if(c.qsa&&!A[a+" "]&&(!q||!q.test(a))){if(1!==w)s=b,r=a;else if("object"!==b.nodeName.toLowerCase()){(k=b.getAttribute("id"))?k=k.replace(ba,ca):b.setAttribute("id",k=u),o=g(a),h=o.length;while(h--)o[h]="#"+k+" "+sa(o[h]);r=o.join(","),s=$.test(a)&&qa(b.parentNode)||b}if(r)try{return G.apply(d,s.querySelectorAll(r)),d}catch(x){}finally{k===u&&b.removeAttribute("id")}}}return i(a.replace(P,"$1"),b,d,e)}function ha(){var a=[];function b(c,e){return a.push(c+" ")>d.cacheLength&&delete b[a.shift()],b[c+" "]=e}return b}function ia(a){return a[u]=!0,a}function ja(a){var b=n.createElement("fieldset");try{return!!a(b)}catch(c){return!1}finally{b.parentNode&&b.parentNode.removeChild(b),b=null}}function ka(a,b){var c=a.split("|"),e=c.length;while(e--)d.attrHandle[c[e]]=b}function la(a,b){var c=b&&a,d=c&&1===a.nodeType&&1===b.nodeType&&a.sourceIndex-b.sourceIndex;if(d)return d;if(c)while(c=c.nextSibling)if(c===b)return-1;return a?1:-1}function ma(a){return function(b){var c=b.nodeName.toLowerCase();return"input"===c&&b.type===a}}function na(a){return function(b){var c=b.nodeName.toLowerCase();return("input"===c||"button"===c)&&b.type===a}}function oa(a){return function(b){return"form"in b?b.parentNode&&b.disabled===!1?"label"in b?"label"in b.parentNode?b.parentNode.disabled===a:b.disabled===a:b.isDisabled===a||b.isDisabled!==!a&&ea(b)===a:b.disabled===a:"label"in b&&b.disabled===a}}function pa(a){return ia(function(b){return b=+b,ia(function(c,d){var e,f=a([],c.length,b),g=f.length;while(g--)c[e=f[g]]&&(c[e]=!(d[e]=c[e]))})})}function qa(a){return a&&"undefined"!=typeof a.getElementsByTagName&&a}c=ga.support={},f=ga.isXML=function(a){var b=a&&(a.ownerDocument||a).documentElement;return!!b&&"HTML"!==b.nodeName},m=ga.setDocument=function(a){var b,e,g=a?a.ownerDocument||a:v;return g!==n&&9===g.nodeType&&g.documentElement?(n=g,o=n.documentElement,p=!f(n),v!==n&&(e=n.defaultView)&&e.top!==e&&(e.addEventListener?e.addEventListener("unload",da,!1):e.attachEvent&&e.attachEvent("onunload",da)),c.attributes=ja(function(a){return a.className="i",!a.getAttribute("className")}),c.getElementsByTagName=ja(function(a){return a.appendChild(n.createComment("")),!a.getElementsByTagName("*").length}),c.getElementsByClassName=Y.test(n.getElementsByClassName),c.getById=ja(function(a){return o.appendChild(a).id=u,!n.getElementsByName||!n.getElementsByName(u).length}),c.getById?(d.filter.ID=function(a){var b=a.replace(_,aa);return function(a){return a.getAttribute("id")===b}},d.find.ID=function(a,b){if("undefined"!=typeof b.getElementById&&p){var c=b.getElementById(a);return c?[c]:[]}}):(d.filter.ID=function(a){var b=a.replace(_,aa);return function(a){var c="undefined"!=typeof a.getAttributeNode&&a.getAttributeNode("id");return c&&c.value===b}},d.find.ID=function(a,b){if("undefined"!=typeof b.getElementById&&p){var c,d,e,f=b.getElementById(a);if(f){if(c=f.getAttributeNode("id"),c&&c.value===a)return[f];e=b.getElementsByName(a),d=0;while(f=e[d++])if(c=f.getAttributeNode("id"),c&&c.value===a)return[f]}return[]}}),d.find.TAG=c.getElementsByTagName?function(a,b){return"undefined"!=typeof b.getElementsByTagName?b.getElementsByTagName(a):c.qsa?b.querySelectorAll(a):void 0}:function(a,b){var c,d=[],e=0,f=b.getElementsByTagName(a);if("*"===a){while(c=f[e++])1===c.nodeType&&d.push(c);return d}return f},d.find.CLASS=c.getElementsByClassName&&function(a,b){if("undefined"!=typeof b.getElementsByClassName&&p)return b.getElementsByClassName(a)},r=[],q=[],(c.qsa=Y.test(n.querySelectorAll))&&(ja(function(a){o.appendChild(a).innerHTML="",a.querySelectorAll("[msallowcapture^='']").length&&q.push("[*^$]="+K+"*(?:''|\"\")"),a.querySelectorAll("[selected]").length||q.push("\\["+K+"*(?:value|"+J+")"),a.querySelectorAll("[id~="+u+"-]").length||q.push("~="),a.querySelectorAll(":checked").length||q.push(":checked"),a.querySelectorAll("a#"+u+"+*").length||q.push(".#.+[+~]")}),ja(function(a){a.innerHTML="";var b=n.createElement("input");b.setAttribute("type","hidden"),a.appendChild(b).setAttribute("name","D"),a.querySelectorAll("[name=d]").length&&q.push("name"+K+"*[*^$|!~]?="),2!==a.querySelectorAll(":enabled").length&&q.push(":enabled",":disabled"),o.appendChild(a).disabled=!0,2!==a.querySelectorAll(":disabled").length&&q.push(":enabled",":disabled"),a.querySelectorAll("*,:x"),q.push(",.*:")})),(c.matchesSelector=Y.test(s=o.matches||o.webkitMatchesSelector||o.mozMatchesSelector||o.oMatchesSelector||o.msMatchesSelector))&&ja(function(a){c.disconnectedMatch=s.call(a,"*"),s.call(a,"[s!='']:x"),r.push("!=",N)}),q=q.length&&new RegExp(q.join("|")),r=r.length&&new RegExp(r.join("|")),b=Y.test(o.compareDocumentPosition),t=b||Y.test(o.contains)?function(a,b){var c=9===a.nodeType?a.documentElement:a,d=b&&b.parentNode;return a===d||!(!d||1!==d.nodeType||!(c.contains?c.contains(d):a.compareDocumentPosition&&16&a.compareDocumentPosition(d)))}:function(a,b){if(b)while(b=b.parentNode)if(b===a)return!0;return!1},B=b?function(a,b){if(a===b)return l=!0,0;var d=!a.compareDocumentPosition-!b.compareDocumentPosition;return d?d:(d=(a.ownerDocument||a)===(b.ownerDocument||b)?a.compareDocumentPosition(b):1,1&d||!c.sortDetached&&b.compareDocumentPosition(a)===d?a===n||a.ownerDocument===v&&t(v,a)?-1:b===n||b.ownerDocument===v&&t(v,b)?1:k?I(k,a)-I(k,b):0:4&d?-1:1)}:function(a,b){if(a===b)return l=!0,0;var c,d=0,e=a.parentNode,f=b.parentNode,g=[a],h=[b];if(!e||!f)return a===n?-1:b===n?1:e?-1:f?1:k?I(k,a)-I(k,b):0;if(e===f)return la(a,b);c=a;while(c=c.parentNode)g.unshift(c);c=b;while(c=c.parentNode)h.unshift(c);while(g[d]===h[d])d++;return d?la(g[d],h[d]):g[d]===v?-1:h[d]===v?1:0},n):n},ga.matches=function(a,b){return ga(a,null,null,b)},ga.matchesSelector=function(a,b){if((a.ownerDocument||a)!==n&&m(a),b=b.replace(S,"='$1']"),c.matchesSelector&&p&&!A[b+" "]&&(!r||!r.test(b))&&(!q||!q.test(b)))try{var d=s.call(a,b);if(d||c.disconnectedMatch||a.document&&11!==a.document.nodeType)return d}catch(e){}return ga(b,n,null,[a]).length>0},ga.contains=function(a,b){return(a.ownerDocument||a)!==n&&m(a),t(a,b)},ga.attr=function(a,b){(a.ownerDocument||a)!==n&&m(a);var e=d.attrHandle[b.toLowerCase()],f=e&&C.call(d.attrHandle,b.toLowerCase())?e(a,b,!p):void 0;return void 0!==f?f:c.attributes||!p?a.getAttribute(b):(f=a.getAttributeNode(b))&&f.specified?f.value:null},ga.escape=function(a){return(a+"").replace(ba,ca)},ga.error=function(a){throw new Error("Syntax error, unrecognized expression: "+a)},ga.uniqueSort=function(a){var b,d=[],e=0,f=0;if(l=!c.detectDuplicates,k=!c.sortStable&&a.slice(0),a.sort(B),l){while(b=a[f++])b===a[f]&&(e=d.push(f));while(e--)a.splice(d[e],1)}return k=null,a},e=ga.getText=function(a){var b,c="",d=0,f=a.nodeType;if(f){if(1===f||9===f||11===f){if("string"==typeof a.textContent)return a.textContent;for(a=a.firstChild;a;a=a.nextSibling)c+=e(a)}else if(3===f||4===f)return a.nodeValue}else while(b=a[d++])c+=e(b);return c},d=ga.selectors={cacheLength:50,createPseudo:ia,match:V,attrHandle:{},find:{},relative:{">":{dir:"parentNode",first:!0}," ":{dir:"parentNode"},"+":{dir:"previousSibling",first:!0},"~":{dir:"previousSibling"}},preFilter:{ATTR:function(a){return a[1]=a[1].replace(_,aa),a[3]=(a[3]||a[4]||a[5]||"").replace(_,aa),"~="===a[2]&&(a[3]=" "+a[3]+" "),a.slice(0,4)},CHILD:function(a){return a[1]=a[1].toLowerCase(),"nth"===a[1].slice(0,3)?(a[3]||ga.error(a[0]),a[4]=+(a[4]?a[5]+(a[6]||1):2*("even"===a[3]||"odd"===a[3])),a[5]=+(a[7]+a[8]||"odd"===a[3])):a[3]&&ga.error(a[0]),a},PSEUDO:function(a){var b,c=!a[6]&&a[2];return V.CHILD.test(a[0])?null:(a[3]?a[2]=a[4]||a[5]||"":c&&T.test(c)&&(b=g(c,!0))&&(b=c.indexOf(")",c.length-b)-c.length)&&(a[0]=a[0].slice(0,b),a[2]=c.slice(0,b)),a.slice(0,3))}},filter:{TAG:function(a){var b=a.replace(_,aa).toLowerCase();return"*"===a?function(){return!0}:function(a){return a.nodeName&&a.nodeName.toLowerCase()===b}},CLASS:function(a){var b=y[a+" "];return b||(b=new RegExp("(^|"+K+")"+a+"("+K+"|$)"))&&y(a,function(a){return b.test("string"==typeof a.className&&a.className||"undefined"!=typeof a.getAttribute&&a.getAttribute("class")||"")})},ATTR:function(a,b,c){return function(d){var e=ga.attr(d,a);return null==e?"!="===b:!b||(e+="","="===b?e===c:"!="===b?e!==c:"^="===b?c&&0===e.indexOf(c):"*="===b?c&&e.indexOf(c)>-1:"$="===b?c&&e.slice(-c.length)===c:"~="===b?(" "+e.replace(O," ")+" ").indexOf(c)>-1:"|="===b&&(e===c||e.slice(0,c.length+1)===c+"-"))}},CHILD:function(a,b,c,d,e){var f="nth"!==a.slice(0,3),g="last"!==a.slice(-4),h="of-type"===b;return 1===d&&0===e?function(a){return!!a.parentNode}:function(b,c,i){var j,k,l,m,n,o,p=f!==g?"nextSibling":"previousSibling",q=b.parentNode,r=h&&b.nodeName.toLowerCase(),s=!i&&!h,t=!1;if(q){if(f){while(p){m=b;while(m=m[p])if(h?m.nodeName.toLowerCase()===r:1===m.nodeType)return!1;o=p="only"===a&&!o&&"nextSibling"}return!0}if(o=[g?q.firstChild:q.lastChild],g&&s){m=q,l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),j=k[a]||[],n=j[0]===w&&j[1],t=n&&j[2],m=n&&q.childNodes[n];while(m=++n&&m&&m[p]||(t=n=0)||o.pop())if(1===m.nodeType&&++t&&m===b){k[a]=[w,n,t];break}}else if(s&&(m=b,l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),j=k[a]||[],n=j[0]===w&&j[1],t=n),t===!1)while(m=++n&&m&&m[p]||(t=n=0)||o.pop())if((h?m.nodeName.toLowerCase()===r:1===m.nodeType)&&++t&&(s&&(l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),k[a]=[w,t]),m===b))break;return t-=e,t===d||t%d===0&&t/d>=0}}},PSEUDO:function(a,b){var c,e=d.pseudos[a]||d.setFilters[a.toLowerCase()]||ga.error("unsupported pseudo: "+a);return e[u]?e(b):e.length>1?(c=[a,a,"",b],d.setFilters.hasOwnProperty(a.toLowerCase())?ia(function(a,c){var d,f=e(a,b),g=f.length;while(g--)d=I(a,f[g]),a[d]=!(c[d]=f[g])}):function(a){return e(a,0,c)}):e}},pseudos:{not:ia(function(a){var b=[],c=[],d=h(a.replace(P,"$1"));return d[u]?ia(function(a,b,c,e){var f,g=d(a,null,e,[]),h=a.length;while(h--)(f=g[h])&&(a[h]=!(b[h]=f))}):function(a,e,f){return b[0]=a,d(b,null,f,c),b[0]=null,!c.pop()}}),has:ia(function(a){return function(b){return ga(a,b).length>0}}),contains:ia(function(a){return a=a.replace(_,aa),function(b){return(b.textContent||b.innerText||e(b)).indexOf(a)>-1}}),lang:ia(function(a){return U.test(a||"")||ga.error("unsupported lang: "+a),a=a.replace(_,aa).toLowerCase(),function(b){var c;do if(c=p?b.lang:b.getAttribute("xml:lang")||b.getAttribute("lang"))return c=c.toLowerCase(),c===a||0===c.indexOf(a+"-");while((b=b.parentNode)&&1===b.nodeType);return!1}}),target:function(b){var c=a.location&&a.location.hash;return c&&c.slice(1)===b.id},root:function(a){return a===o},focus:function(a){return a===n.activeElement&&(!n.hasFocus||n.hasFocus())&&!!(a.type||a.href||~a.tabIndex)},enabled:oa(!1),disabled:oa(!0),checked:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&!!a.checked||"option"===b&&!!a.selected},selected:function(a){return a.parentNode&&a.parentNode.selectedIndex,a.selected===!0},empty:function(a){for(a=a.firstChild;a;a=a.nextSibling)if(a.nodeType<6)return!1;return!0},parent:function(a){return!d.pseudos.empty(a)},header:function(a){return X.test(a.nodeName)},input:function(a){return W.test(a.nodeName)},button:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&"button"===a.type||"button"===b},text:function(a){var b;return"input"===a.nodeName.toLowerCase()&&"text"===a.type&&(null==(b=a.getAttribute("type"))||"text"===b.toLowerCase())},first:pa(function(){return[0]}),last:pa(function(a,b){return[b-1]}),eq:pa(function(a,b,c){return[c<0?c+b:c]}),even:pa(function(a,b){for(var c=0;c=0;)a.push(d);return a}),gt:pa(function(a,b,c){for(var d=c<0?c+b:c;++d1?function(b,c,d){var e=a.length;while(e--)if(!a[e](b,c,d))return!1;return!0}:a[0]}function va(a,b,c){for(var d=0,e=b.length;d-1&&(f[j]=!(g[j]=l))}}else r=wa(r===g?r.splice(o,r.length):r),e?e(null,g,r,i):G.apply(g,r)})}function ya(a){for(var b,c,e,f=a.length,g=d.relative[a[0].type],h=g||d.relative[" "],i=g?1:0,k=ta(function(a){return a===b},h,!0),l=ta(function(a){return I(b,a)>-1},h,!0),m=[function(a,c,d){var e=!g&&(d||c!==j)||((b=c).nodeType?k(a,c,d):l(a,c,d));return b=null,e}];i1&&ua(m),i>1&&sa(a.slice(0,i-1).concat({value:" "===a[i-2].type?"*":""})).replace(P,"$1"),c,i0,e=a.length>0,f=function(f,g,h,i,k){var l,o,q,r=0,s="0",t=f&&[],u=[],v=j,x=f||e&&d.find.TAG("*",k),y=w+=null==v?1:Math.random()||.1,z=x.length;for(k&&(j=g===n||g||k);s!==z&&null!=(l=x[s]);s++){if(e&&l){o=0,g||l.ownerDocument===n||(m(l),h=!p);while(q=a[o++])if(q(l,g||n,h)){i.push(l);break}k&&(w=y)}c&&((l=!q&&l)&&r--,f&&t.push(l))}if(r+=s,c&&s!==r){o=0;while(q=b[o++])q(t,u,g,h);if(f){if(r>0)while(s--)t[s]||u[s]||(u[s]=E.call(i));u=wa(u)}G.apply(i,u),k&&!f&&u.length>0&&r+b.length>1&&ga.uniqueSort(i)}return k&&(w=y,j=v),t};return c?ia(f):f}return h=ga.compile=function(a,b){var c,d=[],e=[],f=A[a+" "];if(!f){b||(b=g(a)),c=b.length;while(c--)f=ya(b[c]),f[u]?d.push(f):e.push(f);f=A(a,za(e,d)),f.selector=a}return f},i=ga.select=function(a,b,c,e){var f,i,j,k,l,m="function"==typeof a&&a,n=!e&&g(a=m.selector||a);if(c=c||[],1===n.length){if(i=n[0]=n[0].slice(0),i.length>2&&"ID"===(j=i[0]).type&&9===b.nodeType&&p&&d.relative[i[1].type]){if(b=(d.find.ID(j.matches[0].replace(_,aa),b)||[])[0],!b)return c;m&&(b=b.parentNode),a=a.slice(i.shift().value.length)}f=V.needsContext.test(a)?0:i.length;while(f--){if(j=i[f],d.relative[k=j.type])break;if((l=d.find[k])&&(e=l(j.matches[0].replace(_,aa),$.test(i[0].type)&&qa(b.parentNode)||b))){if(i.splice(f,1),a=e.length&&sa(i),!a)return G.apply(c,e),c;break}}}return(m||h(a,n))(e,b,!p,c,!b||$.test(a)&&qa(b.parentNode)||b),c},c.sortStable=u.split("").sort(B).join("")===u,c.detectDuplicates=!!l,m(),c.sortDetached=ja(function(a){return 1&a.compareDocumentPosition(n.createElement("fieldset"))}),ja(function(a){return a.innerHTML="","#"===a.firstChild.getAttribute("href")})||ka("type|href|height|width",function(a,b,c){if(!c)return a.getAttribute(b,"type"===b.toLowerCase()?1:2)}),c.attributes&&ja(function(a){return a.innerHTML="",a.firstChild.setAttribute("value",""),""===a.firstChild.getAttribute("value")})||ka("value",function(a,b,c){if(!c&&"input"===a.nodeName.toLowerCase())return a.defaultValue}),ja(function(a){return null==a.getAttribute("disabled")})||ka(J,function(a,b,c){var d;if(!c)return a[b]===!0?b.toLowerCase():(d=a.getAttributeNode(b))&&d.specified?d.value:null}),ga}(a);r.find=x,r.expr=x.selectors,r.expr[":"]=r.expr.pseudos,r.uniqueSort=r.unique=x.uniqueSort,r.text=x.getText,r.isXMLDoc=x.isXML,r.contains=x.contains,r.escapeSelector=x.escape;var y=function(a,b,c){var d=[],e=void 0!==c;while((a=a[b])&&9!==a.nodeType)if(1===a.nodeType){if(e&&r(a).is(c))break;d.push(a)}return d},z=function(a,b){for(var c=[];a;a=a.nextSibling)1===a.nodeType&&a!==b&&c.push(a);return c},A=r.expr.match.needsContext;function B(a,b){return a.nodeName&&a.nodeName.toLowerCase()===b.toLowerCase()}var C=/^<([a-z][^\/\0>:\x20\t\r\n\f]*)[\x20\t\r\n\f]*\/?>(?:<\/\1>|)$/i,D=/^.[^:#\[\.,]*$/;function E(a,b,c){return r.isFunction(b)?r.grep(a,function(a,d){return!!b.call(a,d,a)!==c}):b.nodeType?r.grep(a,function(a){return a===b!==c}):"string"!=typeof b?r.grep(a,function(a){return i.call(b,a)>-1!==c}):D.test(b)?r.filter(b,a,c):(b=r.filter(b,a),r.grep(a,function(a){return i.call(b,a)>-1!==c&&1===a.nodeType}))}r.filter=function(a,b,c){var d=b[0];return c&&(a=":not("+a+")"),1===b.length&&1===d.nodeType?r.find.matchesSelector(d,a)?[d]:[]:r.find.matches(a,r.grep(b,function(a){return 1===a.nodeType}))},r.fn.extend({find:function(a){var b,c,d=this.length,e=this;if("string"!=typeof a)return this.pushStack(r(a).filter(function(){for(b=0;b1?r.uniqueSort(c):c},filter:function(a){return this.pushStack(E(this,a||[],!1))},not:function(a){return this.pushStack(E(this,a||[],!0))},is:function(a){return!!E(this,"string"==typeof a&&A.test(a)?r(a):a||[],!1).length}});var F,G=/^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]+))$/,H=r.fn.init=function(a,b,c){var e,f;if(!a)return this;if(c=c||F,"string"==typeof a){if(e="<"===a[0]&&">"===a[a.length-1]&&a.length>=3?[null,a,null]:G.exec(a),!e||!e[1]&&b)return!b||b.jquery?(b||c).find(a):this.constructor(b).find(a);if(e[1]){if(b=b instanceof r?b[0]:b,r.merge(this,r.parseHTML(e[1],b&&b.nodeType?b.ownerDocument||b:d,!0)),C.test(e[1])&&r.isPlainObject(b))for(e in b)r.isFunction(this[e])?this[e](b[e]):this.attr(e,b[e]);return this}return f=d.getElementById(e[2]),f&&(this[0]=f,this.length=1),this}return a.nodeType?(this[0]=a,this.length=1,this):r.isFunction(a)?void 0!==c.ready?c.ready(a):a(r):r.makeArray(a,this)};H.prototype=r.fn,F=r(d);var I=/^(?:parents|prev(?:Until|All))/,J={children:!0,contents:!0,next:!0,prev:!0};r.fn.extend({has:function(a){var b=r(a,this),c=b.length;return this.filter(function(){for(var a=0;a-1:1===c.nodeType&&r.find.matchesSelector(c,a))){f.push(c);break}return this.pushStack(f.length>1?r.uniqueSort(f):f)},index:function(a){return a?"string"==typeof a?i.call(r(a),this[0]):i.call(this,a.jquery?a[0]:a):this[0]&&this[0].parentNode?this.first().prevAll().length:-1},add:function(a,b){return this.pushStack(r.uniqueSort(r.merge(this.get(),r(a,b))))},addBack:function(a){return this.add(null==a?this.prevObject:this.prevObject.filter(a))}});function K(a,b){while((a=a[b])&&1!==a.nodeType);return a}r.each({parent:function(a){var b=a.parentNode;return b&&11!==b.nodeType?b:null},parents:function(a){return y(a,"parentNode")},parentsUntil:function(a,b,c){return y(a,"parentNode",c)},next:function(a){return K(a,"nextSibling")},prev:function(a){return K(a,"previousSibling")},nextAll:function(a){return y(a,"nextSibling")},prevAll:function(a){return y(a,"previousSibling")},nextUntil:function(a,b,c){return y(a,"nextSibling",c)},prevUntil:function(a,b,c){return y(a,"previousSibling",c)},siblings:function(a){return z((a.parentNode||{}).firstChild,a)},children:function(a){return z(a.firstChild)},contents:function(a){return B(a,"iframe")?a.contentDocument:(B(a,"template")&&(a=a.content||a),r.merge([],a.childNodes))}},function(a,b){r.fn[a]=function(c,d){var e=r.map(this,b,c);return"Until"!==a.slice(-5)&&(d=c),d&&"string"==typeof d&&(e=r.filter(d,e)),this.length>1&&(J[a]||r.uniqueSort(e),I.test(a)&&e.reverse()),this.pushStack(e)}});var L=/[^\x20\t\r\n\f]+/g;function M(a){var b={};return r.each(a.match(L)||[],function(a,c){b[c]=!0}),b}r.Callbacks=function(a){a="string"==typeof a?M(a):r.extend({},a);var b,c,d,e,f=[],g=[],h=-1,i=function(){for(e=e||a.once,d=b=!0;g.length;h=-1){c=g.shift();while(++h-1)f.splice(c,1),c<=h&&h--}),this},has:function(a){return a?r.inArray(a,f)>-1:f.length>0},empty:function(){return f&&(f=[]),this},disable:function(){return e=g=[],f=c="",this},disabled:function(){return!f},lock:function(){return e=g=[],c||b||(f=c=""),this},locked:function(){return!!e},fireWith:function(a,c){return e||(c=c||[],c=[a,c.slice?c.slice():c],g.push(c),b||i()),this},fire:function(){return j.fireWith(this,arguments),this},fired:function(){return!!d}};return j};function N(a){return a}function O(a){throw a}function P(a,b,c,d){var e;try{a&&r.isFunction(e=a.promise)?e.call(a).done(b).fail(c):a&&r.isFunction(e=a.then)?e.call(a,b,c):b.apply(void 0,[a].slice(d))}catch(a){c.apply(void 0,[a])}}r.extend({Deferred:function(b){var c=[["notify","progress",r.Callbacks("memory"),r.Callbacks("memory"),2],["resolve","done",r.Callbacks("once memory"),r.Callbacks("once memory"),0,"resolved"],["reject","fail",r.Callbacks("once memory"),r.Callbacks("once memory"),1,"rejected"]],d="pending",e={state:function(){return d},always:function(){return f.done(arguments).fail(arguments),this},"catch":function(a){return e.then(null,a)},pipe:function(){var a=arguments;return r.Deferred(function(b){r.each(c,function(c,d){var e=r.isFunction(a[d[4]])&&a[d[4]];f[d[1]](function(){var a=e&&e.apply(this,arguments);a&&r.isFunction(a.promise)?a.promise().progress(b.notify).done(b.resolve).fail(b.reject):b[d[0]+"With"](this,e?[a]:arguments)})}),a=null}).promise()},then:function(b,d,e){var f=0;function g(b,c,d,e){return function(){var h=this,i=arguments,j=function(){var a,j;if(!(b=f&&(d!==O&&(h=void 0,i=[a]),c.rejectWith(h,i))}};b?k():(r.Deferred.getStackHook&&(k.stackTrace=r.Deferred.getStackHook()),a.setTimeout(k))}}return r.Deferred(function(a){c[0][3].add(g(0,a,r.isFunction(e)?e:N,a.notifyWith)),c[1][3].add(g(0,a,r.isFunction(b)?b:N)),c[2][3].add(g(0,a,r.isFunction(d)?d:O))}).promise()},promise:function(a){return null!=a?r.extend(a,e):e}},f={};return r.each(c,function(a,b){var g=b[2],h=b[5];e[b[1]]=g.add,h&&g.add(function(){d=h},c[3-a][2].disable,c[0][2].lock),g.add(b[3].fire),f[b[0]]=function(){return f[b[0]+"With"](this===f?void 0:this,arguments),this},f[b[0]+"With"]=g.fireWith}),e.promise(f),b&&b.call(f,f),f},when:function(a){var b=arguments.length,c=b,d=Array(c),e=f.call(arguments),g=r.Deferred(),h=function(a){return function(c){d[a]=this,e[a]=arguments.length>1?f.call(arguments):c,--b||g.resolveWith(d,e)}};if(b<=1&&(P(a,g.done(h(c)).resolve,g.reject,!b),"pending"===g.state()||r.isFunction(e[c]&&e[c].then)))return g.then();while(c--)P(e[c],h(c),g.reject);return g.promise()}});var Q=/^(Eval|Internal|Range|Reference|Syntax|Type|URI)Error$/;r.Deferred.exceptionHook=function(b,c){a.console&&a.console.warn&&b&&Q.test(b.name)&&a.console.warn("jQuery.Deferred exception: "+b.message,b.stack,c)},r.readyException=function(b){a.setTimeout(function(){throw b})};var R=r.Deferred();r.fn.ready=function(a){return R.then(a)["catch"](function(a){r.readyException(a)}),this},r.extend({isReady:!1,readyWait:1,ready:function(a){(a===!0?--r.readyWait:r.isReady)||(r.isReady=!0,a!==!0&&--r.readyWait>0||R.resolveWith(d,[r]))}}),r.ready.then=R.then;function S(){d.removeEventListener("DOMContentLoaded",S), +a.removeEventListener("load",S),r.ready()}"complete"===d.readyState||"loading"!==d.readyState&&!d.documentElement.doScroll?a.setTimeout(r.ready):(d.addEventListener("DOMContentLoaded",S),a.addEventListener("load",S));var T=function(a,b,c,d,e,f,g){var h=0,i=a.length,j=null==c;if("object"===r.type(c)){e=!0;for(h in c)T(a,b,h,c[h],!0,f,g)}else if(void 0!==d&&(e=!0,r.isFunction(d)||(g=!0),j&&(g?(b.call(a,d),b=null):(j=b,b=function(a,b,c){return j.call(r(a),c)})),b))for(;h1,null,!0)},removeData:function(a){return this.each(function(){X.remove(this,a)})}}),r.extend({queue:function(a,b,c){var d;if(a)return b=(b||"fx")+"queue",d=W.get(a,b),c&&(!d||Array.isArray(c)?d=W.access(a,b,r.makeArray(c)):d.push(c)),d||[]},dequeue:function(a,b){b=b||"fx";var c=r.queue(a,b),d=c.length,e=c.shift(),f=r._queueHooks(a,b),g=function(){r.dequeue(a,b)};"inprogress"===e&&(e=c.shift(),d--),e&&("fx"===b&&c.unshift("inprogress"),delete f.stop,e.call(a,g,f)),!d&&f&&f.empty.fire()},_queueHooks:function(a,b){var c=b+"queueHooks";return W.get(a,c)||W.access(a,c,{empty:r.Callbacks("once memory").add(function(){W.remove(a,[b+"queue",c])})})}}),r.fn.extend({queue:function(a,b){var c=2;return"string"!=typeof a&&(b=a,a="fx",c--),arguments.length\x20\t\r\n\f]+)/i,la=/^$|\/(?:java|ecma)script/i,ma={option:[1,""],thead:[1,"","
"],col:[2,"","
"],tr:[2,"","
"],td:[3,"","
"],_default:[0,"",""]};ma.optgroup=ma.option,ma.tbody=ma.tfoot=ma.colgroup=ma.caption=ma.thead,ma.th=ma.td;function na(a,b){var c;return c="undefined"!=typeof a.getElementsByTagName?a.getElementsByTagName(b||"*"):"undefined"!=typeof a.querySelectorAll?a.querySelectorAll(b||"*"):[],void 0===b||b&&B(a,b)?r.merge([a],c):c}function oa(a,b){for(var c=0,d=a.length;c-1)e&&e.push(f);else if(j=r.contains(f.ownerDocument,f),g=na(l.appendChild(f),"script"),j&&oa(g),c){k=0;while(f=g[k++])la.test(f.type||"")&&c.push(f)}return l}!function(){var a=d.createDocumentFragment(),b=a.appendChild(d.createElement("div")),c=d.createElement("input");c.setAttribute("type","radio"),c.setAttribute("checked","checked"),c.setAttribute("name","t"),b.appendChild(c),o.checkClone=b.cloneNode(!0).cloneNode(!0).lastChild.checked,b.innerHTML="",o.noCloneChecked=!!b.cloneNode(!0).lastChild.defaultValue}();var ra=d.documentElement,sa=/^key/,ta=/^(?:mouse|pointer|contextmenu|drag|drop)|click/,ua=/^([^.]*)(?:\.(.+)|)/;function va(){return!0}function wa(){return!1}function xa(){try{return d.activeElement}catch(a){}}function ya(a,b,c,d,e,f){var g,h;if("object"==typeof b){"string"!=typeof c&&(d=d||c,c=void 0);for(h in b)ya(a,h,c,d,b[h],f);return a}if(null==d&&null==e?(e=c,d=c=void 0):null==e&&("string"==typeof c?(e=d,d=void 0):(e=d,d=c,c=void 0)),e===!1)e=wa;else if(!e)return a;return 1===f&&(g=e,e=function(a){return r().off(a),g.apply(this,arguments)},e.guid=g.guid||(g.guid=r.guid++)),a.each(function(){r.event.add(this,b,e,d,c)})}r.event={global:{},add:function(a,b,c,d,e){var f,g,h,i,j,k,l,m,n,o,p,q=W.get(a);if(q){c.handler&&(f=c,c=f.handler,e=f.selector),e&&r.find.matchesSelector(ra,e),c.guid||(c.guid=r.guid++),(i=q.events)||(i=q.events={}),(g=q.handle)||(g=q.handle=function(b){return"undefined"!=typeof r&&r.event.triggered!==b.type?r.event.dispatch.apply(a,arguments):void 0}),b=(b||"").match(L)||[""],j=b.length;while(j--)h=ua.exec(b[j])||[],n=p=h[1],o=(h[2]||"").split(".").sort(),n&&(l=r.event.special[n]||{},n=(e?l.delegateType:l.bindType)||n,l=r.event.special[n]||{},k=r.extend({type:n,origType:p,data:d,handler:c,guid:c.guid,selector:e,needsContext:e&&r.expr.match.needsContext.test(e),namespace:o.join(".")},f),(m=i[n])||(m=i[n]=[],m.delegateCount=0,l.setup&&l.setup.call(a,d,o,g)!==!1||a.addEventListener&&a.addEventListener(n,g)),l.add&&(l.add.call(a,k),k.handler.guid||(k.handler.guid=c.guid)),e?m.splice(m.delegateCount++,0,k):m.push(k),r.event.global[n]=!0)}},remove:function(a,b,c,d,e){var f,g,h,i,j,k,l,m,n,o,p,q=W.hasData(a)&&W.get(a);if(q&&(i=q.events)){b=(b||"").match(L)||[""],j=b.length;while(j--)if(h=ua.exec(b[j])||[],n=p=h[1],o=(h[2]||"").split(".").sort(),n){l=r.event.special[n]||{},n=(d?l.delegateType:l.bindType)||n,m=i[n]||[],h=h[2]&&new RegExp("(^|\\.)"+o.join("\\.(?:.*\\.|)")+"(\\.|$)"),g=f=m.length;while(f--)k=m[f],!e&&p!==k.origType||c&&c.guid!==k.guid||h&&!h.test(k.namespace)||d&&d!==k.selector&&("**"!==d||!k.selector)||(m.splice(f,1),k.selector&&m.delegateCount--,l.remove&&l.remove.call(a,k));g&&!m.length&&(l.teardown&&l.teardown.call(a,o,q.handle)!==!1||r.removeEvent(a,n,q.handle),delete i[n])}else for(n in i)r.event.remove(a,n+b[j],c,d,!0);r.isEmptyObject(i)&&W.remove(a,"handle events")}},dispatch:function(a){var b=r.event.fix(a),c,d,e,f,g,h,i=new Array(arguments.length),j=(W.get(this,"events")||{})[b.type]||[],k=r.event.special[b.type]||{};for(i[0]=b,c=1;c=1))for(;j!==this;j=j.parentNode||this)if(1===j.nodeType&&("click"!==a.type||j.disabled!==!0)){for(f=[],g={},c=0;c-1:r.find(e,this,null,[j]).length),g[e]&&f.push(d);f.length&&h.push({elem:j,handlers:f})}return j=this,i\x20\t\r\n\f]*)[^>]*)\/>/gi,Aa=/\s*$/g;function Ea(a,b){return B(a,"table")&&B(11!==b.nodeType?b:b.firstChild,"tr")?r(">tbody",a)[0]||a:a}function Fa(a){return a.type=(null!==a.getAttribute("type"))+"/"+a.type,a}function Ga(a){var b=Ca.exec(a.type);return b?a.type=b[1]:a.removeAttribute("type"),a}function Ha(a,b){var c,d,e,f,g,h,i,j;if(1===b.nodeType){if(W.hasData(a)&&(f=W.access(a),g=W.set(b,f),j=f.events)){delete g.handle,g.events={};for(e in j)for(c=0,d=j[e].length;c1&&"string"==typeof q&&!o.checkClone&&Ba.test(q))return a.each(function(e){var f=a.eq(e);s&&(b[0]=q.call(this,e,f.html())),Ja(f,b,c,d)});if(m&&(e=qa(b,a[0].ownerDocument,!1,a,d),f=e.firstChild,1===e.childNodes.length&&(e=f),f||d)){for(h=r.map(na(e,"script"),Fa),i=h.length;l")},clone:function(a,b,c){var d,e,f,g,h=a.cloneNode(!0),i=r.contains(a.ownerDocument,a);if(!(o.noCloneChecked||1!==a.nodeType&&11!==a.nodeType||r.isXMLDoc(a)))for(g=na(h),f=na(a),d=0,e=f.length;d0&&oa(g,!i&&na(a,"script")),h},cleanData:function(a){for(var b,c,d,e=r.event.special,f=0;void 0!==(c=a[f]);f++)if(U(c)){if(b=c[W.expando]){if(b.events)for(d in b.events)e[d]?r.event.remove(c,d):r.removeEvent(c,d,b.handle);c[W.expando]=void 0}c[X.expando]&&(c[X.expando]=void 0)}}}),r.fn.extend({detach:function(a){return Ka(this,a,!0)},remove:function(a){return Ka(this,a)},text:function(a){return T(this,function(a){return void 0===a?r.text(this):this.empty().each(function(){1!==this.nodeType&&11!==this.nodeType&&9!==this.nodeType||(this.textContent=a)})},null,a,arguments.length)},append:function(){return Ja(this,arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=Ea(this,a);b.appendChild(a)}})},prepend:function(){return Ja(this,arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=Ea(this,a);b.insertBefore(a,b.firstChild)}})},before:function(){return Ja(this,arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this)})},after:function(){return Ja(this,arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this.nextSibling)})},empty:function(){for(var a,b=0;null!=(a=this[b]);b++)1===a.nodeType&&(r.cleanData(na(a,!1)),a.textContent="");return this},clone:function(a,b){return a=null!=a&&a,b=null==b?a:b,this.map(function(){return r.clone(this,a,b)})},html:function(a){return T(this,function(a){var b=this[0]||{},c=0,d=this.length;if(void 0===a&&1===b.nodeType)return b.innerHTML;if("string"==typeof a&&!Aa.test(a)&&!ma[(ka.exec(a)||["",""])[1].toLowerCase()]){a=r.htmlPrefilter(a);try{for(;c1)}});function _a(a,b,c,d,e){return new _a.prototype.init(a,b,c,d,e)}r.Tween=_a,_a.prototype={constructor:_a,init:function(a,b,c,d,e,f){this.elem=a,this.prop=c,this.easing=e||r.easing._default,this.options=b,this.start=this.now=this.cur(),this.end=d,this.unit=f||(r.cssNumber[c]?"":"px")},cur:function(){var a=_a.propHooks[this.prop];return a&&a.get?a.get(this):_a.propHooks._default.get(this)},run:function(a){var b,c=_a.propHooks[this.prop];return this.options.duration?this.pos=b=r.easing[this.easing](a,this.options.duration*a,0,1,this.options.duration):this.pos=b=a,this.now=(this.end-this.start)*b+this.start,this.options.step&&this.options.step.call(this.elem,this.now,this),c&&c.set?c.set(this):_a.propHooks._default.set(this),this}},_a.prototype.init.prototype=_a.prototype,_a.propHooks={_default:{get:function(a){var b;return 1!==a.elem.nodeType||null!=a.elem[a.prop]&&null==a.elem.style[a.prop]?a.elem[a.prop]:(b=r.css(a.elem,a.prop,""),b&&"auto"!==b?b:0)},set:function(a){r.fx.step[a.prop]?r.fx.step[a.prop](a):1!==a.elem.nodeType||null==a.elem.style[r.cssProps[a.prop]]&&!r.cssHooks[a.prop]?a.elem[a.prop]=a.now:r.style(a.elem,a.prop,a.now+a.unit)}}},_a.propHooks.scrollTop=_a.propHooks.scrollLeft={set:function(a){a.elem.nodeType&&a.elem.parentNode&&(a.elem[a.prop]=a.now)}},r.easing={linear:function(a){return a},swing:function(a){return.5-Math.cos(a*Math.PI)/2},_default:"swing"},r.fx=_a.prototype.init,r.fx.step={};var ab,bb,cb=/^(?:toggle|show|hide)$/,db=/queueHooks$/;function eb(){bb&&(d.hidden===!1&&a.requestAnimationFrame?a.requestAnimationFrame(eb):a.setTimeout(eb,r.fx.interval),r.fx.tick())}function fb(){return a.setTimeout(function(){ab=void 0}),ab=r.now()}function gb(a,b){var c,d=0,e={height:a};for(b=b?1:0;d<4;d+=2-b)c=ca[d],e["margin"+c]=e["padding"+c]=a;return b&&(e.opacity=e.width=a),e}function hb(a,b,c){for(var d,e=(kb.tweeners[b]||[]).concat(kb.tweeners["*"]),f=0,g=e.length;f1)},removeAttr:function(a){return this.each(function(){r.removeAttr(this,a)})}}),r.extend({attr:function(a,b,c){var d,e,f=a.nodeType;if(3!==f&&8!==f&&2!==f)return"undefined"==typeof a.getAttribute?r.prop(a,b,c):(1===f&&r.isXMLDoc(a)||(e=r.attrHooks[b.toLowerCase()]||(r.expr.match.bool.test(b)?lb:void 0)),void 0!==c?null===c?void r.removeAttr(a,b):e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:(a.setAttribute(b,c+""),c):e&&"get"in e&&null!==(d=e.get(a,b))?d:(d=r.find.attr(a,b), +null==d?void 0:d))},attrHooks:{type:{set:function(a,b){if(!o.radioValue&&"radio"===b&&B(a,"input")){var c=a.value;return a.setAttribute("type",b),c&&(a.value=c),b}}}},removeAttr:function(a,b){var c,d=0,e=b&&b.match(L);if(e&&1===a.nodeType)while(c=e[d++])a.removeAttribute(c)}}),lb={set:function(a,b,c){return b===!1?r.removeAttr(a,c):a.setAttribute(c,c),c}},r.each(r.expr.match.bool.source.match(/\w+/g),function(a,b){var c=mb[b]||r.find.attr;mb[b]=function(a,b,d){var e,f,g=b.toLowerCase();return d||(f=mb[g],mb[g]=e,e=null!=c(a,b,d)?g:null,mb[g]=f),e}});var nb=/^(?:input|select|textarea|button)$/i,ob=/^(?:a|area)$/i;r.fn.extend({prop:function(a,b){return T(this,r.prop,a,b,arguments.length>1)},removeProp:function(a){return this.each(function(){delete this[r.propFix[a]||a]})}}),r.extend({prop:function(a,b,c){var d,e,f=a.nodeType;if(3!==f&&8!==f&&2!==f)return 1===f&&r.isXMLDoc(a)||(b=r.propFix[b]||b,e=r.propHooks[b]),void 0!==c?e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:a[b]=c:e&&"get"in e&&null!==(d=e.get(a,b))?d:a[b]},propHooks:{tabIndex:{get:function(a){var b=r.find.attr(a,"tabindex");return b?parseInt(b,10):nb.test(a.nodeName)||ob.test(a.nodeName)&&a.href?0:-1}}},propFix:{"for":"htmlFor","class":"className"}}),o.optSelected||(r.propHooks.selected={get:function(a){var b=a.parentNode;return b&&b.parentNode&&b.parentNode.selectedIndex,null},set:function(a){var b=a.parentNode;b&&(b.selectedIndex,b.parentNode&&b.parentNode.selectedIndex)}}),r.each(["tabIndex","readOnly","maxLength","cellSpacing","cellPadding","rowSpan","colSpan","useMap","frameBorder","contentEditable"],function(){r.propFix[this.toLowerCase()]=this});function pb(a){var b=a.match(L)||[];return b.join(" ")}function qb(a){return a.getAttribute&&a.getAttribute("class")||""}r.fn.extend({addClass:function(a){var b,c,d,e,f,g,h,i=0;if(r.isFunction(a))return this.each(function(b){r(this).addClass(a.call(this,b,qb(this)))});if("string"==typeof a&&a){b=a.match(L)||[];while(c=this[i++])if(e=qb(c),d=1===c.nodeType&&" "+pb(e)+" "){g=0;while(f=b[g++])d.indexOf(" "+f+" ")<0&&(d+=f+" ");h=pb(d),e!==h&&c.setAttribute("class",h)}}return this},removeClass:function(a){var b,c,d,e,f,g,h,i=0;if(r.isFunction(a))return this.each(function(b){r(this).removeClass(a.call(this,b,qb(this)))});if(!arguments.length)return this.attr("class","");if("string"==typeof a&&a){b=a.match(L)||[];while(c=this[i++])if(e=qb(c),d=1===c.nodeType&&" "+pb(e)+" "){g=0;while(f=b[g++])while(d.indexOf(" "+f+" ")>-1)d=d.replace(" "+f+" "," ");h=pb(d),e!==h&&c.setAttribute("class",h)}}return this},toggleClass:function(a,b){var c=typeof a;return"boolean"==typeof b&&"string"===c?b?this.addClass(a):this.removeClass(a):r.isFunction(a)?this.each(function(c){r(this).toggleClass(a.call(this,c,qb(this),b),b)}):this.each(function(){var b,d,e,f;if("string"===c){d=0,e=r(this),f=a.match(L)||[];while(b=f[d++])e.hasClass(b)?e.removeClass(b):e.addClass(b)}else void 0!==a&&"boolean"!==c||(b=qb(this),b&&W.set(this,"__className__",b),this.setAttribute&&this.setAttribute("class",b||a===!1?"":W.get(this,"__className__")||""))})},hasClass:function(a){var b,c,d=0;b=" "+a+" ";while(c=this[d++])if(1===c.nodeType&&(" "+pb(qb(c))+" ").indexOf(b)>-1)return!0;return!1}});var rb=/\r/g;r.fn.extend({val:function(a){var b,c,d,e=this[0];{if(arguments.length)return d=r.isFunction(a),this.each(function(c){var e;1===this.nodeType&&(e=d?a.call(this,c,r(this).val()):a,null==e?e="":"number"==typeof e?e+="":Array.isArray(e)&&(e=r.map(e,function(a){return null==a?"":a+""})),b=r.valHooks[this.type]||r.valHooks[this.nodeName.toLowerCase()],b&&"set"in b&&void 0!==b.set(this,e,"value")||(this.value=e))});if(e)return b=r.valHooks[e.type]||r.valHooks[e.nodeName.toLowerCase()],b&&"get"in b&&void 0!==(c=b.get(e,"value"))?c:(c=e.value,"string"==typeof c?c.replace(rb,""):null==c?"":c)}}}),r.extend({valHooks:{option:{get:function(a){var b=r.find.attr(a,"value");return null!=b?b:pb(r.text(a))}},select:{get:function(a){var b,c,d,e=a.options,f=a.selectedIndex,g="select-one"===a.type,h=g?null:[],i=g?f+1:e.length;for(d=f<0?i:g?f:0;d-1)&&(c=!0);return c||(a.selectedIndex=-1),f}}}}),r.each(["radio","checkbox"],function(){r.valHooks[this]={set:function(a,b){if(Array.isArray(b))return a.checked=r.inArray(r(a).val(),b)>-1}},o.checkOn||(r.valHooks[this].get=function(a){return null===a.getAttribute("value")?"on":a.value})});var sb=/^(?:focusinfocus|focusoutblur)$/;r.extend(r.event,{trigger:function(b,c,e,f){var g,h,i,j,k,m,n,o=[e||d],p=l.call(b,"type")?b.type:b,q=l.call(b,"namespace")?b.namespace.split("."):[];if(h=i=e=e||d,3!==e.nodeType&&8!==e.nodeType&&!sb.test(p+r.event.triggered)&&(p.indexOf(".")>-1&&(q=p.split("."),p=q.shift(),q.sort()),k=p.indexOf(":")<0&&"on"+p,b=b[r.expando]?b:new r.Event(p,"object"==typeof b&&b),b.isTrigger=f?2:3,b.namespace=q.join("."),b.rnamespace=b.namespace?new RegExp("(^|\\.)"+q.join("\\.(?:.*\\.|)")+"(\\.|$)"):null,b.result=void 0,b.target||(b.target=e),c=null==c?[b]:r.makeArray(c,[b]),n=r.event.special[p]||{},f||!n.trigger||n.trigger.apply(e,c)!==!1)){if(!f&&!n.noBubble&&!r.isWindow(e)){for(j=n.delegateType||p,sb.test(j+p)||(h=h.parentNode);h;h=h.parentNode)o.push(h),i=h;i===(e.ownerDocument||d)&&o.push(i.defaultView||i.parentWindow||a)}g=0;while((h=o[g++])&&!b.isPropagationStopped())b.type=g>1?j:n.bindType||p,m=(W.get(h,"events")||{})[b.type]&&W.get(h,"handle"),m&&m.apply(h,c),m=k&&h[k],m&&m.apply&&U(h)&&(b.result=m.apply(h,c),b.result===!1&&b.preventDefault());return b.type=p,f||b.isDefaultPrevented()||n._default&&n._default.apply(o.pop(),c)!==!1||!U(e)||k&&r.isFunction(e[p])&&!r.isWindow(e)&&(i=e[k],i&&(e[k]=null),r.event.triggered=p,e[p](),r.event.triggered=void 0,i&&(e[k]=i)),b.result}},simulate:function(a,b,c){var d=r.extend(new r.Event,c,{type:a,isSimulated:!0});r.event.trigger(d,null,b)}}),r.fn.extend({trigger:function(a,b){return this.each(function(){r.event.trigger(a,b,this)})},triggerHandler:function(a,b){var c=this[0];if(c)return r.event.trigger(a,b,c,!0)}}),r.each("blur focus focusin focusout resize scroll click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup contextmenu".split(" "),function(a,b){r.fn[b]=function(a,c){return arguments.length>0?this.on(b,null,a,c):this.trigger(b)}}),r.fn.extend({hover:function(a,b){return this.mouseenter(a).mouseleave(b||a)}}),o.focusin="onfocusin"in a,o.focusin||r.each({focus:"focusin",blur:"focusout"},function(a,b){var c=function(a){r.event.simulate(b,a.target,r.event.fix(a))};r.event.special[b]={setup:function(){var d=this.ownerDocument||this,e=W.access(d,b);e||d.addEventListener(a,c,!0),W.access(d,b,(e||0)+1)},teardown:function(){var d=this.ownerDocument||this,e=W.access(d,b)-1;e?W.access(d,b,e):(d.removeEventListener(a,c,!0),W.remove(d,b))}}});var tb=a.location,ub=r.now(),vb=/\?/;r.parseXML=function(b){var c;if(!b||"string"!=typeof b)return null;try{c=(new a.DOMParser).parseFromString(b,"text/xml")}catch(d){c=void 0}return c&&!c.getElementsByTagName("parsererror").length||r.error("Invalid XML: "+b),c};var wb=/\[\]$/,xb=/\r?\n/g,yb=/^(?:submit|button|image|reset|file)$/i,zb=/^(?:input|select|textarea|keygen)/i;function Ab(a,b,c,d){var e;if(Array.isArray(b))r.each(b,function(b,e){c||wb.test(a)?d(a,e):Ab(a+"["+("object"==typeof e&&null!=e?b:"")+"]",e,c,d)});else if(c||"object"!==r.type(b))d(a,b);else for(e in b)Ab(a+"["+e+"]",b[e],c,d)}r.param=function(a,b){var c,d=[],e=function(a,b){var c=r.isFunction(b)?b():b;d[d.length]=encodeURIComponent(a)+"="+encodeURIComponent(null==c?"":c)};if(Array.isArray(a)||a.jquery&&!r.isPlainObject(a))r.each(a,function(){e(this.name,this.value)});else for(c in a)Ab(c,a[c],b,e);return d.join("&")},r.fn.extend({serialize:function(){return r.param(this.serializeArray())},serializeArray:function(){return this.map(function(){var a=r.prop(this,"elements");return a?r.makeArray(a):this}).filter(function(){var a=this.type;return this.name&&!r(this).is(":disabled")&&zb.test(this.nodeName)&&!yb.test(a)&&(this.checked||!ja.test(a))}).map(function(a,b){var c=r(this).val();return null==c?null:Array.isArray(c)?r.map(c,function(a){return{name:b.name,value:a.replace(xb,"\r\n")}}):{name:b.name,value:c.replace(xb,"\r\n")}}).get()}});var Bb=/%20/g,Cb=/#.*$/,Db=/([?&])_=[^&]*/,Eb=/^(.*?):[ \t]*([^\r\n]*)$/gm,Fb=/^(?:about|app|app-storage|.+-extension|file|res|widget):$/,Gb=/^(?:GET|HEAD)$/,Hb=/^\/\//,Ib={},Jb={},Kb="*/".concat("*"),Lb=d.createElement("a");Lb.href=tb.href;function Mb(a){return function(b,c){"string"!=typeof b&&(c=b,b="*");var d,e=0,f=b.toLowerCase().match(L)||[];if(r.isFunction(c))while(d=f[e++])"+"===d[0]?(d=d.slice(1)||"*",(a[d]=a[d]||[]).unshift(c)):(a[d]=a[d]||[]).push(c)}}function Nb(a,b,c,d){var e={},f=a===Jb;function g(h){var i;return e[h]=!0,r.each(a[h]||[],function(a,h){var j=h(b,c,d);return"string"!=typeof j||f||e[j]?f?!(i=j):void 0:(b.dataTypes.unshift(j),g(j),!1)}),i}return g(b.dataTypes[0])||!e["*"]&&g("*")}function Ob(a,b){var c,d,e=r.ajaxSettings.flatOptions||{};for(c in b)void 0!==b[c]&&((e[c]?a:d||(d={}))[c]=b[c]);return d&&r.extend(!0,a,d),a}function Pb(a,b,c){var d,e,f,g,h=a.contents,i=a.dataTypes;while("*"===i[0])i.shift(),void 0===d&&(d=a.mimeType||b.getResponseHeader("Content-Type"));if(d)for(e in h)if(h[e]&&h[e].test(d)){i.unshift(e);break}if(i[0]in c)f=i[0];else{for(e in c){if(!i[0]||a.converters[e+" "+i[0]]){f=e;break}g||(g=e)}f=f||g}if(f)return f!==i[0]&&i.unshift(f),c[f]}function Qb(a,b,c,d){var e,f,g,h,i,j={},k=a.dataTypes.slice();if(k[1])for(g in a.converters)j[g.toLowerCase()]=a.converters[g];f=k.shift();while(f)if(a.responseFields[f]&&(c[a.responseFields[f]]=b),!i&&d&&a.dataFilter&&(b=a.dataFilter(b,a.dataType)),i=f,f=k.shift())if("*"===f)f=i;else if("*"!==i&&i!==f){if(g=j[i+" "+f]||j["* "+f],!g)for(e in j)if(h=e.split(" "),h[1]===f&&(g=j[i+" "+h[0]]||j["* "+h[0]])){g===!0?g=j[e]:j[e]!==!0&&(f=h[0],k.unshift(h[1]));break}if(g!==!0)if(g&&a["throws"])b=g(b);else try{b=g(b)}catch(l){return{state:"parsererror",error:g?l:"No conversion from "+i+" to "+f}}}return{state:"success",data:b}}r.extend({active:0,lastModified:{},etag:{},ajaxSettings:{url:tb.href,type:"GET",isLocal:Fb.test(tb.protocol),global:!0,processData:!0,async:!0,contentType:"application/x-www-form-urlencoded; charset=UTF-8",accepts:{"*":Kb,text:"text/plain",html:"text/html",xml:"application/xml, text/xml",json:"application/json, text/javascript"},contents:{xml:/\bxml\b/,html:/\bhtml/,json:/\bjson\b/},responseFields:{xml:"responseXML",text:"responseText",json:"responseJSON"},converters:{"* text":String,"text html":!0,"text json":JSON.parse,"text xml":r.parseXML},flatOptions:{url:!0,context:!0}},ajaxSetup:function(a,b){return b?Ob(Ob(a,r.ajaxSettings),b):Ob(r.ajaxSettings,a)},ajaxPrefilter:Mb(Ib),ajaxTransport:Mb(Jb),ajax:function(b,c){"object"==typeof b&&(c=b,b=void 0),c=c||{};var e,f,g,h,i,j,k,l,m,n,o=r.ajaxSetup({},c),p=o.context||o,q=o.context&&(p.nodeType||p.jquery)?r(p):r.event,s=r.Deferred(),t=r.Callbacks("once memory"),u=o.statusCode||{},v={},w={},x="canceled",y={readyState:0,getResponseHeader:function(a){var b;if(k){if(!h){h={};while(b=Eb.exec(g))h[b[1].toLowerCase()]=b[2]}b=h[a.toLowerCase()]}return null==b?null:b},getAllResponseHeaders:function(){return k?g:null},setRequestHeader:function(a,b){return null==k&&(a=w[a.toLowerCase()]=w[a.toLowerCase()]||a,v[a]=b),this},overrideMimeType:function(a){return null==k&&(o.mimeType=a),this},statusCode:function(a){var b;if(a)if(k)y.always(a[y.status]);else for(b in a)u[b]=[u[b],a[b]];return this},abort:function(a){var b=a||x;return e&&e.abort(b),A(0,b),this}};if(s.promise(y),o.url=((b||o.url||tb.href)+"").replace(Hb,tb.protocol+"//"),o.type=c.method||c.type||o.method||o.type,o.dataTypes=(o.dataType||"*").toLowerCase().match(L)||[""],null==o.crossDomain){j=d.createElement("a");try{j.href=o.url,j.href=j.href,o.crossDomain=Lb.protocol+"//"+Lb.host!=j.protocol+"//"+j.host}catch(z){o.crossDomain=!0}}if(o.data&&o.processData&&"string"!=typeof o.data&&(o.data=r.param(o.data,o.traditional)),Nb(Ib,o,c,y),k)return y;l=r.event&&o.global,l&&0===r.active++&&r.event.trigger("ajaxStart"),o.type=o.type.toUpperCase(),o.hasContent=!Gb.test(o.type),f=o.url.replace(Cb,""),o.hasContent?o.data&&o.processData&&0===(o.contentType||"").indexOf("application/x-www-form-urlencoded")&&(o.data=o.data.replace(Bb,"+")):(n=o.url.slice(f.length),o.data&&(f+=(vb.test(f)?"&":"?")+o.data,delete o.data),o.cache===!1&&(f=f.replace(Db,"$1"),n=(vb.test(f)?"&":"?")+"_="+ub++ +n),o.url=f+n),o.ifModified&&(r.lastModified[f]&&y.setRequestHeader("If-Modified-Since",r.lastModified[f]),r.etag[f]&&y.setRequestHeader("If-None-Match",r.etag[f])),(o.data&&o.hasContent&&o.contentType!==!1||c.contentType)&&y.setRequestHeader("Content-Type",o.contentType),y.setRequestHeader("Accept",o.dataTypes[0]&&o.accepts[o.dataTypes[0]]?o.accepts[o.dataTypes[0]]+("*"!==o.dataTypes[0]?", "+Kb+"; q=0.01":""):o.accepts["*"]);for(m in o.headers)y.setRequestHeader(m,o.headers[m]);if(o.beforeSend&&(o.beforeSend.call(p,y,o)===!1||k))return y.abort();if(x="abort",t.add(o.complete),y.done(o.success),y.fail(o.error),e=Nb(Jb,o,c,y)){if(y.readyState=1,l&&q.trigger("ajaxSend",[y,o]),k)return y;o.async&&o.timeout>0&&(i=a.setTimeout(function(){y.abort("timeout")},o.timeout));try{k=!1,e.send(v,A)}catch(z){if(k)throw z;A(-1,z)}}else A(-1,"No Transport");function A(b,c,d,h){var j,m,n,v,w,x=c;k||(k=!0,i&&a.clearTimeout(i),e=void 0,g=h||"",y.readyState=b>0?4:0,j=b>=200&&b<300||304===b,d&&(v=Pb(o,y,d)),v=Qb(o,v,y,j),j?(o.ifModified&&(w=y.getResponseHeader("Last-Modified"),w&&(r.lastModified[f]=w),w=y.getResponseHeader("etag"),w&&(r.etag[f]=w)),204===b||"HEAD"===o.type?x="nocontent":304===b?x="notmodified":(x=v.state,m=v.data,n=v.error,j=!n)):(n=x,!b&&x||(x="error",b<0&&(b=0))),y.status=b,y.statusText=(c||x)+"",j?s.resolveWith(p,[m,x,y]):s.rejectWith(p,[y,x,n]),y.statusCode(u),u=void 0,l&&q.trigger(j?"ajaxSuccess":"ajaxError",[y,o,j?m:n]),t.fireWith(p,[y,x]),l&&(q.trigger("ajaxComplete",[y,o]),--r.active||r.event.trigger("ajaxStop")))}return y},getJSON:function(a,b,c){return r.get(a,b,c,"json")},getScript:function(a,b){return r.get(a,void 0,b,"script")}}),r.each(["get","post"],function(a,b){r[b]=function(a,c,d,e){return r.isFunction(c)&&(e=e||d,d=c,c=void 0),r.ajax(r.extend({url:a,type:b,dataType:e,data:c,success:d},r.isPlainObject(a)&&a))}}),r._evalUrl=function(a){return r.ajax({url:a,type:"GET",dataType:"script",cache:!0,async:!1,global:!1,"throws":!0})},r.fn.extend({wrapAll:function(a){var b;return this[0]&&(r.isFunction(a)&&(a=a.call(this[0])),b=r(a,this[0].ownerDocument).eq(0).clone(!0),this[0].parentNode&&b.insertBefore(this[0]),b.map(function(){var a=this;while(a.firstElementChild)a=a.firstElementChild;return a}).append(this)),this},wrapInner:function(a){return r.isFunction(a)?this.each(function(b){r(this).wrapInner(a.call(this,b))}):this.each(function(){var b=r(this),c=b.contents();c.length?c.wrapAll(a):b.append(a)})},wrap:function(a){var b=r.isFunction(a);return this.each(function(c){r(this).wrapAll(b?a.call(this,c):a)})},unwrap:function(a){return this.parent(a).not("body").each(function(){r(this).replaceWith(this.childNodes)}),this}}),r.expr.pseudos.hidden=function(a){return!r.expr.pseudos.visible(a)},r.expr.pseudos.visible=function(a){return!!(a.offsetWidth||a.offsetHeight||a.getClientRects().length)},r.ajaxSettings.xhr=function(){try{return new a.XMLHttpRequest}catch(b){}};var Rb={0:200,1223:204},Sb=r.ajaxSettings.xhr();o.cors=!!Sb&&"withCredentials"in Sb,o.ajax=Sb=!!Sb,r.ajaxTransport(function(b){var c,d;if(o.cors||Sb&&!b.crossDomain)return{send:function(e,f){var g,h=b.xhr();if(h.open(b.type,b.url,b.async,b.username,b.password),b.xhrFields)for(g in b.xhrFields)h[g]=b.xhrFields[g];b.mimeType&&h.overrideMimeType&&h.overrideMimeType(b.mimeType),b.crossDomain||e["X-Requested-With"]||(e["X-Requested-With"]="XMLHttpRequest");for(g in e)h.setRequestHeader(g,e[g]);c=function(a){return function(){c&&(c=d=h.onload=h.onerror=h.onabort=h.onreadystatechange=null,"abort"===a?h.abort():"error"===a?"number"!=typeof h.status?f(0,"error"):f(h.status,h.statusText):f(Rb[h.status]||h.status,h.statusText,"text"!==(h.responseType||"text")||"string"!=typeof h.responseText?{binary:h.response}:{text:h.responseText},h.getAllResponseHeaders()))}},h.onload=c(),d=h.onerror=c("error"),void 0!==h.onabort?h.onabort=d:h.onreadystatechange=function(){4===h.readyState&&a.setTimeout(function(){c&&d()})},c=c("abort");try{h.send(b.hasContent&&b.data||null)}catch(i){if(c)throw i}},abort:function(){c&&c()}}}),r.ajaxPrefilter(function(a){a.crossDomain&&(a.contents.script=!1)}),r.ajaxSetup({accepts:{script:"text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"},contents:{script:/\b(?:java|ecma)script\b/},converters:{"text script":function(a){return r.globalEval(a),a}}}),r.ajaxPrefilter("script",function(a){void 0===a.cache&&(a.cache=!1),a.crossDomain&&(a.type="GET")}),r.ajaxTransport("script",function(a){if(a.crossDomain){var b,c;return{send:function(e,f){b=r(" + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Birds of a Feather +

+
+
+
+
+ +
+
+
+
+
+
+

+ Bird of a Feather (BoF) events are typically associated with a major conference/meeting in which + researchers, developers, and users from distinct workflow systems and applications meet to discuss the + current state-of-the-art and crucial challenges in the workflow community. +

+
+
+ +
+ + +
+
+
+
+ Nov 19, 2024 +
+

SC24 BoF

+ Collaborative Pathways for Designing an Integrated Infrastructure for Research Excellence +
+
+
+ +
+
+
+
+ Nov 19, 2024 +
+

SC24 Data Streaming BoF

+ Real-Time Scientific Data Streaming to HPC Nodes: Challenges and Innovations +
+
+
+ +
+
+
+
+ Nov 14, 2023 +
+

SC23 BoF

+ Modern Workflows for Continuum and Cross-Facility Computing +
+
+
+ +
+
+
+
+ Jan 19, 2023 +
+

2023 ECP Annual Meeting BoF

+ Exascale Workflows Community: A Post-ECP Roadmap for Workflow Systems and Applications +
+
+
+ +
+
+
+
+ Nov 15, 2022 +
+

SC22 BoF

+ An Update on the Community Roadmap for HPC and AI Scientific Workflows Research and Development +
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/bof/ecpam23/index.html b/bof/ecpam23/index.html new file mode 100644 index 0000000000..ce1c25360a --- /dev/null +++ b/bof/ecpam23/index.html @@ -0,0 +1,474 @@ + + + + + 2023 ECP Annual Meeting BoF - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ 2023 ECP Annual Meeting BoF +

+
+
+
+
+ +
+
+
+
+
+
+ Exascale Workflows Community: A Post-ECP Roadmap for Workflow Systems and Applications +

2023 ECP Annual Meeting BoF

+
+
+

+ Thursday - Jan 19, 2023
+ 1:30pm-2:15pm CST
+ Founders 3+4 +

+

+ Complex workflows have increasingly high computational and I/O demand and are composed of many communicating + orchestrators, services, and simulations. The ECP ecosystem has observed an increasing pervasiveness of + workflow + systems to handle these classes of complex, distributed applications. The interplay of workflow technologies + and + HPC has been challenged by the fast rise of ML technologies: ML needs to be integrated within workflows to + ease + their development and portability; workflows must benefit from ML to scale and increase efficiency of + executions; HPC must embrace workflows to democratize access to its resources, as workflow systems should + better + exploit the power of HPC systems; ML must adapt to HCP architectures to scale to real-world large settings, + and + HCP must adjust to ML requirements to provide the required computational resources to scale up to extremely + large data sets. Furthermore, HPC resource allocation policies and scheduler designs typically provide a + simple + "job" abstraction instead of workflow-aware abstractions. As a result, it is difficult to run exascale + workflows + efficiently and conveniently on HPC systems without extending resource management/scheduling approaches. In + this + BoF, we will bring together researchers and DOE facility representatives from the workflows, HPC, and AI/ML + communities that work on scientific research questions requiring large-scale, distributed, and AI-heavy + computing at exascale as well as workflows that allow the integration of (physical) experiments and + computational facilities. The session will discuss challenges, opportunities, and future pathways, and will + seek + input for a post-ECP community roadmap focused on the sustainability of HPC and AI workflows software and + applications. +

+ +

Specifically, the BoF session discussions will focus on the following questions: +

+
    +
  • In the era of exascale and ML/AI, what are the emerging and future crucial challenges for post-ECP + workflows?
    • +
  • Considering workflows sustainability, what are the key constraints and opportunities to attain + sustainability?
    • +
  • Which software/technology are essential for enabling sustainable workflows post-ECP?
    • +
+
+
+ +
+
+

Agenda

+
+
+
    +
  • + 1:30pm-1:40pm — + Opening remarks
    +

    + Rafael Ferreira da Silva – Oak Ridge National + Laboratory +

    +
    • +
  • + 1:40pm-2:15pm — Panel Discussion
    +

    + Shantenu Jha (Moderator) - Brookhaven National + Laboratory +

    +

    + Katie Antypas - Lawrence Berkeley National + Laboratory +

    +

    + Todd Gamblin - Lawrence Livermore National + Laboratory +

    +

    + Andrew Gallo - GE Research +

    +

    + Arjun Shankar - Oak Ridge National Laboratory +

    +
    • +
+
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + +
+
+ + +
+
+

Participants Contributions

+
+
+ In the era of exascale and ML/AI, what are the emerging and future crucial challenges for post-ECP + workflows? +
+
    +
  • Managing dynamic workflows at scale
    • +
  • Near term we need to put in place services and capabilities in data centers that enable data + management + and movement in a portable way and de-emphasize filesystems as the main orchestration mechanism. +
    • +
  • (1) Support for diverse coupling of HPC and AI/ML components, and integration scenarios without + wholesale refactoring of applications. Flexible frameworks that enable a range are needed. + (2) Simplicity of deployment of ML/AI on HPC
    • +
  • Data continuum to/from ML/AI workflows and traditional workflows
    • +
  • Data, data, and data. Locality, provenance, movement and cost
    • +
  • Cross facility integration; Robust standards for apis and interfaces
    • +
  • Challenge Problems that integrate HPC Simulations and Measurement/Observations are: Digital Twins, + Validation and Verification, Experiment Design or steering. What are the workflows that support + these + use cases? What are their differences?
    • +
  • From Tuesdays talk different tasks in a workflow may need to be able to be submitted on different + systems
    • +
  • Leveraging ML/AI to reduce the turnaround time of completing a workflow.
    • +
  • Interactive, human-in-the-loop model evolution/iteration is a must. How that fits into existing + workflow + engine designs is an interesting question
    • +
  • Difficulty providimg infrastructure for workflows that require dependable realtime turnaround
    • +
  • Interconnection of systems; Standardized APIs; Data management
    • +
  • One issue is that training data is often generated by physics models. These models take a lot more + time + and resources than a typical ML model for either training or inference. So there is a “length scale” + problem.
    • +
  • Reproducibility - retain how and where the code was run (environment, parameters, configuration, + dependencies, etc)
    • +
  • Dealing with heterogeneity of compute; Analysis of performance; Finding the shortest path to a + solution; + Reproducibility of workflows; Policy driven behavior vs technology behaviors
    • +
+
+
+ Considering workflows sustainability, what are the key constraints and opportunities to attain + sustainability? +
+
    +
  • Funding specific software vs applications vs workflows
    • +
  • If we can not have a unified funding stream for sustainability, we should encourage agencies and + program + managers to encourage participation and collaboration in common software infrastructures and + processes. +
    • +
  • Building blocks that existing and future developers can use to customize/extend/ develop their own + workflow capabilities.
    • +
  • A cognizant and consistent workforce that understands the workflow
    • +
  • Reaching critical mass
    • +
  • Workflows that cross institutional or organizational domains of ownership/control. We need policies + and + support from DOE
    • +
  • Future funding
    • +
  • Availability of no-code or low-code tools for defining and managing a workflow that lowers the + barrier + of leveraging workflows.
    • +
  • The key opportunity is to create a wealth of knowledge and reusable capabilities. With a critical + mass + of workflows, I foresee a path to autonomous AI/ML-driven exploration of scientific questions. One + constraint is that we need to think about how sustain workflows at scale, at a population-level. +
    • +
  • Opportunities - containerized and cloud technology for resilience
    • +
  • Standardized formats; Portability
    • +
  • If workflows are complicated enough then managing the decencies becomes a challenge. You need to + test + all the interdependencies to ensure that the whole workflow keeps working.
    • +
  • Opportunity: define benchmarks around workflows (and hope this benchmark lives like linpack did); + Constraint: to some extent a workflow with science is often something that is implemented to + something + for the first time ( never done before experiment) the tools required for production workflows vs + experimental workflows are not the same
    • +
+
+
+ Which software/technology are essential for enabling sustainable workflows post-ECP? +
+
    +
  • Workflow systems and data management systems
    • +
  • Cloud and classic-HPC interoperability and portability
    • +
  • Depends upon workflow applications; in addition to application kernels, it includes libraries, + workflow + and resource management middleware, automation capabilities, data management software etc.
    • +
  • Containers
    • +
  • Collaboration. far more important than point solutions.
    • +
  • Containers; Standardized apis and interface with a clear governance model
    • +
  • Automated builds, tools like containers and space
    • +
  • Package manager, build tools, Python, resource manager, GUI/CLI/API
    • +
  • There's a need for cyberinfrastructures to enable the curation and maintenance of workflows, and + policies for governance for workflows as an enduring institutional resource. There is ongoing work + at + Sandia on this front.
    • +
  • Containers, cloud-like services, systems with failovers or ability to burst to cloud
    • +
  • Support for Resource/Workload Managers; Workflow-aware schedulers
    • +
  • Ultimately it would be nice if the scale could be flexible. Some steps may need only a couple of + nodes + others could use thousands. To avoid wasting resources it would be nice if different phases could + use + different resource allocations.
    • +
+
+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/bof/sc22/index.html b/bof/sc22/index.html new file mode 100644 index 0000000000..c61f34668f --- /dev/null +++ b/bof/sc22/index.html @@ -0,0 +1,364 @@ + + + + + SC22 BoF - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SC22 BoF +

+
+
+
+
+ +
+
+
+
+
+
+ An Update on the Community Roadmap for HPC and AI Scientific Workflows Research and Development +

SC22 BoF

+
+
+

+ Tuesday - Nov 15, 2022
+ 12:15pm-1:15pm CT
+ Room D221 +

+

+ The interplay of workflow technologies and HPC has been challenged by the fast rise of AI and ML + technologies. + Workflows empowered with ML techniques largely differ from traditional workflows running on HPC machines. In + this BoF, we bring together researchers from the workflows, HPC, and AI/ML + communities that work on scientific research questions that require large-scale, distributed, and AI-heavy + computing. The session presented an update on challenges, opportunities, new research directions, and future + pathways, and sought input for updating a community roadmap on HPC and AI workflows research and + development. +

+

+ In this first edition of this BoF session (Tuesday Nov 15, 2022, + 12:15pm-1:15pm CT), we + brought together members of the Workflows Community Initiative to provide an update on challenges, + opportunities, new research directions, and future pathways on HPC and AI workflows. +

+

+ This BoF will produce tangible outputs both in terms of a package of materials (lightning talks, live-poll + questions and responses) and a draft of an updated community roadmap (based on + + + https://doi.org/10.1109/WORKS54523.2021.00016). +

+
+
+ +
+
+

Agenda

+
+
+ +
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/bof/sc23/index.html b/bof/sc23/index.html new file mode 100644 index 0000000000..3d7977d52b --- /dev/null +++ b/bof/sc23/index.html @@ -0,0 +1,381 @@ + + + + + SC23 BoF - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SC23 BoF +

+
+
+
+
+ +
+
+
+
+
+
+ Modern Workflows for Continuum and Cross-Facility Computing +

SC23 BoF

+
+
+

+ Tuesday - Nov 14, 2023
+ 12:15pm-1:15pm MT
+ Room 503-504 +

+

+ Science discovery relies increasingly on workflows to coordinate large and complex scientific experiments, + ranging from cloud-based data preprocessing pipelines to multi-facility instrument-to-edge-to-HPC + computational workflows. Continuum and cross-facility workflows have become prominent in + computational sciences. Continuum workflows represent analysis pipelines that require continuous computing + access, while cross-facility workflows span multiple sites, encompassing experiments and computing + facilities. Cross-facility workflows offer resiliency for real-time workflows and can be viewed as a + solution for the needs of continuum workflows. It is also important to consider continuum and cross-facility + computing from a data perspective, ensuring workflow systems can handle different representations and + storage systems. +

+

+ In the second edition of this BoF (Tuesday Nov 14, 2023, 12:15pm-1:15pm MT), we + will convene to discuss challenges, opportunities, research directions, and future pathways for continuum + and cross-facility workflows. The perspectives of scientists as users of workflow systems will also be + included, with users providing insights into the challenges specific to their science domains. Topics for + discussion will encompass coordination and cooperation among computing and experimental facilities, metadata + tracking across different sites, co-design of experiment facilities, standardization of task descriptions, + edge-to-cloud continuum and data exchange, adaptive compression techniques, and the definition of common + terms, building blocks, and concepts in workflows. +

+

+ This BoF will yield tangible outputs, including lightning talks, live-poll questions and responses, and a + draft of an updated community roadmap. Participants will be encouraged to join the Workflows Community + Initiative to facilitate networking and foster potential international collaborations beyond the conference. +

+
+
+ +
+
+

Agenda

+
+
+ +
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + + + + +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/bof/sc24-streaming/index.html b/bof/sc24-streaming/index.html new file mode 100644 index 0000000000..e75e9224f9 --- /dev/null +++ b/bof/sc24-streaming/index.html @@ -0,0 +1,383 @@ + + + + + SC24 Data Streaming BoF - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SC24 Data Streaming BoF +

+
+
+
+
+ +
+
+
+
+
+
+
+ Real-Time Scientific Data Streaming to HPC Nodes: Challenges and Innovations +

SC24 Data Streaming BoF

+
+
+

+ Tuesday - Nov 19, 2024
+ 12:15pm-1:15pm ET
+ Room B213 +

+

+ The most common way scientific data arrives at HPC facilities today is through a set of border gateway nodes + connected to some form of shared file systems. Dataflow orchestration tools like Globus have made this + approach popular by being programmable, easy to use, and efficient. This approach works well when the + subsequent compute job for data analysis can afford to wait in the scheduler’s queue, with the overall + completion time being mostly dominated by that wait time. +

+

+ However, as HPC centers and experimental and observational facilities become more integrated, workflows will + demand immediate, real-time feedback where the latency and performance variability that comes with a shared + file system is no longer acceptable. While a few streaming workflows have emerged recently, many HPC, data, + or network user facilities are not set out to support these workflows out-of-gate, for policy, scheduler, or + hardware reasons. However, these workflows are the cornerstone of the DOE Integrated Research Infrastructure + (IRI) program, as their stringent timing requirements benchmark the ultimate integration of HPC, data, and + networks into seamless compute-in-the-loop workflows for experimental or observational user facilities. +

+

+ This BoF discusses this alternative way of using HPC by opening with a science use case that exemplifies + this new class of emerging workflows. Through a set of lightning talks from user facilities, the BoF will + survey how HPC centers address this need today and what they have planned for the near future. These + presentations aim to seed the ensuing discussion where the audience can ask questions to key staff of HPC + facilities or can bring their specific streaming workflow to the attention of the workflow community. +

+ +
+
+ +
+
+

Agenda

+
+
+
    +
  • + 12:15pm-12:20pm — Welcome and set up of polling infrastructure + +

    + Bjoern Enders — National Energy Research + Scientific Computing Center (NERSC)
    + Rafael Ferreira da Silva — Oak Ridge Leadership Computing Facility (OLCF)
    +

    +
    • +
  • + 12:20pm-12:30pm — Science use case + +

    + Peter Ercius — Lawrence Berkeley National Laboratory (LBNL)
    + Sam Welborn — Lawrence Berkeley National Laboratory (LBNL)
    +

    +
    • +
  • + 12:30pm-12:50pm — Lightning talks: By User Facilities on Streaming Needs and Solutions
    +

    + + Network Streaming vs File Transfer
    + Eli Dart, Energy Sciences Network (ESnet) +

    +

    + + Data Streaming at ALCF: Future Directions and Use Cases
    + Cristine Simpson, Argonne Leadership Computing Facility (ALCF) +

    +

    + + The OLCF Data Streaming to HPC Capability
    + Michael Brim, Oak Ridge Leadership Computing Facility (OLCF) +

    +

    + + AIsB — High Performance Access to ECMWF Weather & Climate Data
    + Alex Upton, Swiss National Supercomputing Centre (CSCS) +

    +
    • +
  • + 12:50pm-1:10pm — Panel discussion and Open Q&A
    + Session leaders and presenters will answer questions from the poll and seeded questions +
    • +
  • + 1:10pm-1:15pm — Closing remarks
    + Planning of a Full Day Workshop on Streaming at an ASCR User Facility in the Near Future +
    • +
+
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + + + + + + + +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/bof/sc24/index.html b/bof/sc24/index.html new file mode 100644 index 0000000000..a20b9bdb7c --- /dev/null +++ b/bof/sc24/index.html @@ -0,0 +1,394 @@ + + + + + SC24 BoF - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SC24 BoF +

+
+
+
+
+ +
+
+
+
+
+
+
+ Collaborative Pathways for Designing an Integrated Infrastructure for Research Excellence +

SC24 BoF

+
+
+

+ Tuesday - Nov 19, 2024
+ 5:15pm-6:45pm ET
+ Room B212 +

+

+ In modern science, integrating scientific workflows, especially those involving AI and spanning multiple + facilities, is paramount. AI workflows, leveraging machine learning and data analytics, are crucial for + processing and interpreting vast amounts of data, driving unprecedented breakthroughs. Multi-facility + workflows have expanded the horizons of scientific research by enabling the seamless integration of + computational resources, data, and experiments across different locations, fostering collaboration and + resource sharing. +

+

+ The inaugural BoF session at SC22 focused on integrating HPC and AI workflows. + Building on this, the second BoF at SC23 gathered the Workflows Community to explore + challenges, opportunities, and future pathways for continuum and multi-facility workflows. Scientists + provided insights into domain-specific challenges, discussing coordination among computing and experimental + facilities, metadata tracking, co-design of experiment facilities, task standardization, edge-to-cloud data + exchange, adaptive compression, and defining common workflow concepts. These sessions highlighted the + importance of seamless integration across cloud-based data pipelines, multi-facility instruments, and HPC + infrastructures. The enthusiasm and feedback underscored the need for deeper exploration of continuum and + multi-facility workflows, critical for the resilience and real-time demands of modern scientific workflows. +

+

+ In this BoF session, we will deepen the discourse initiated during the previous BoF sessions and elevate + these discussions by incorporating a wider array of perspectives, including those of scientists who develop + and utilize these workflow systems within their specific domains. By examining the challenges and + opportunities within multi-facility workflows, the session will explore themes such as near real-time + processing and integration of data from multiple sources and further discuss the topics of coordination + among different computing and experimental facilities, and co-design of experiment facilities. This + initiative is motivated by the need to address the continuum of workflows that demand uninterrupted + computing access and multi-facility workflows that enhance resilience and efficiency across distributed + environments. +

+ +
+
+ +
+
+

Agenda

+
+
+ +
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/contact.html b/contact.html new file mode 100644 index 0000000000..e53adc2c8d --- /dev/null +++ b/contact.html @@ -0,0 +1,331 @@ + + + + + Get in touch - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Get in touch +

+
+
+
+
+ +
+
+
+
+
+
+ There are multiple ways for you to get in touch and join the Workflows Community + Initiative +

Contact Us

+
+

+ You may contact the WCI leadership team through:
+ + contact@workflows.community +
+ + @WorkflowsCI +
+ + workflowscommunity.slack.com + +

+
+ +
+
+ Become a Member +

Join Us

+

+ Join + WCI   +

+
+
+

Anyone who supports the Workflows Community Initiative's mission are free to + join + as a WCI member. +

+

+ You may also consider joining one of the working groups and task forces. +

+

+ An informal + Slack + chat + allows communication between WCI members and is available for anyone interested in workflows. +

+
+
+ +
+
+ There are multiple ways you can contribute to the Workflows Community Initiative +

Contribute

+
+

+ The Workflows Community Initiative (WCI) provides curated collections of open source or freely + accessible tools, research frameworks, and workflow registries. This website also provides a + collection of workflow-related events, working groups, and job openings. We invite all workflow + researchers, developers, and users to contribute to these collections: +

+
+
Contribute with a Workflow System
+
A curated collection of actively-developed open source workflow systems
+ +
Contribute with a Research Framework
+
A curated collection of open source or freely accessible tools and frameworks that can be used to + support workflow research and development
+ +
Contribute with a Workflow Registry
+
A curated collection of workflow applications or repositories that host workflows
+ +
Add a Workflow-related Event
+
A curated list of workflow-related community events suitable for workflow researchers, developers, + and users
+ +
Post a Job Opening
+
A common place for posting jobs related to workflows research and development
+
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/education.html b/education.html new file mode 100644 index 0000000000..20bc168934 --- /dev/null +++ b/education.html @@ -0,0 +1,301 @@ + + + + + Education and Training - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Education and Training +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of educational and training materials agnostic to workflow systems +

+
+
+ +
+ + +
+
+
+ +

ELIXIR Research Data Management Kit (RDMKit)

+
+ The ELIXIR Research Data Management Kit (RDMkit) is an online guide +containing good data management practices applicable to research projects +in life sciences, including data analysis. + +
+
+
+
+ +
+
+
+ +

+ + eduWRENCH: Parallel and Distributed Computing Courseware + +

+ +

eduWRENCH: Parallel and Distributed Computing Courseware

+
+ A set of pedagogic modules for teaching workflow concepts and practices. +These modules include simulation-based pedagogic activities through which +users can learn in a hands-on manner by experimenting with various +application and platform scenarios. + +
+
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/events.html b/events.html new file mode 100644 index 0000000000..1c0ed93872 --- /dev/null +++ b/events.html @@ -0,0 +1,408 @@ + + + + + Workflow-Related Events - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflow-Related Events +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of conferences, workshops, meetings, etc. relevant to the workflows community suitable for + workflows research +

+ Add an Event +
+
+ +
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/events/add.html b/events/add.html new file mode 100644 index 0000000000..65fe8b59c5 --- /dev/null +++ b/events/add.html @@ -0,0 +1,305 @@ + + + + + Contribute: Events - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Contribute: Events +

+
+
+
+
+ +
+
+
+
+
+
+ Register a conference, workshop, meeting, etc. relevant to the workflows community +

How to Publicize an Event

+ All Events +
+ +
+

+ The Workflows Community Initiative (WCI) provides a curated list of workflow-related + community events suitable for workflow researchers, developers, and users. We invite all members of + the workflows community to publicize their events through this list. +

+ +

Adding a Workflow-Related Event

+

+ To add an event, you only need to add the framework information into an YAML file hosted as part of the WCI GitHub + repository. The preferred way to submit your changes is via creating a pull request with the + changes. + To this end, these are the recommended steps for adding an event: +

+
    +
  1. Fork the WCI GitHub repository
    2. +
  2. Clone your forked repository: + 
    git clone https://github.com/<your_username>/workflowscommunity.github.io
    +
    3. +
  3. Edit the _data/events.yml file, and add the information + regarding the event: + 
    +- name: "Event Name"
+  short_name: "Event Series or Acronym" # optional
+  location: "Event Location" # format: "City, Country" or "Virtual"
+  start_date: <event_start_date> # format: YYYY-MM-DD
+  end_date: <event_end_date> # format: YYYY-MM-DD
+  url: <event_url>
+  type: <event_type> # options: Conference, Workshop, Summit, Forum, Meeting, Other
+  deadlines: # optional: provide up to 3 deadlines
+    - name: "Deadline Title 1"
+      date: <deadline_date_1> # format: YYYY-MM-DD
+    - name: "Deadline Title 2"
+      date: <deadline_date_2> # format: YYYY-MM-DD
+    - name: "Deadline Title 3"
+      date: <deadline_date_3> # format: YYYY-MM-DD
+
    +
    4. +
  4. Commit the changes, and create a pull request for the WCI GitHub + repository.
    5. +
  5. The WCI team will then evaluate your pull request, and merge the changes if the event is considered + relevant to the community.
    6. +
+
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/favicon.ico b/favicon.ico new file mode 100644 index 0000000000..46c1a7ed7e Binary files /dev/null and b/favicon.ico differ diff --git a/feed.xml b/feed.xml new file mode 100644 index 0000000000..954589dcfe --- /dev/null +++ b/feed.xml @@ -0,0 +1 @@ +Jekyll2025-01-25T01:07:05+00:00/feed.xmlWorkflows Community InitiativeWorkflows Community Initiative \ No newline at end of file diff --git a/files/bof/bof_ecpam_23_opening_remarks.pdf b/files/bof/bof_ecpam_23_opening_remarks.pdf new file mode 100644 index 0000000000..085992e6af Binary files /dev/null and b/files/bof/bof_ecpam_23_opening_remarks.pdf differ diff --git a/files/bof/bof_sc22_ai_workflows.pdf b/files/bof/bof_sc22_ai_workflows.pdf new file mode 100644 index 0000000000..1a0267cd6e Binary files /dev/null and b/files/bof/bof_sc22_ai_workflows.pdf differ diff --git a/files/bof/bof_sc22_ams.pdf b/files/bof/bof_sc22_ams.pdf new file mode 100644 index 0000000000..4ed7af0df3 Binary files /dev/null and b/files/bof/bof_sc22_ams.pdf differ diff --git a/files/bof/bof_sc22_european_initiatives.pdf b/files/bof/bof_sc22_european_initiatives.pdf new file mode 100644 index 0000000000..1288c9edc2 Binary files /dev/null and b/files/bof/bof_sc22_european_initiatives.pdf differ diff --git a/files/bof/bof_sc22_iri.pdf b/files/bof/bof_sc22_iri.pdf new file mode 100644 index 0000000000..589464ce72 Binary files /dev/null and b/files/bof/bof_sc22_iri.pdf differ diff --git a/files/bof/bof_sc22_opening_remarks.pdf b/files/bof/bof_sc22_opening_remarks.pdf new file mode 100644 index 0000000000..56b429ae3c Binary files /dev/null and b/files/bof/bof_sc22_opening_remarks.pdf differ diff --git a/frameworks.html b/frameworks.html new file mode 100644 index 0000000000..99e1447a38 --- /dev/null +++ b/frameworks.html @@ -0,0 +1,419 @@ + + + + + Research Frameworks - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Research Frameworks +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of open source or freely accessible tools and frameworks that can be used to support workflow + research and development +

+ Contribute +
+
+ +
+ + +
+
+
+ +

CWFR: Canonical Workflow Framework for Research

+
+ A proposed framework for building workflow systems that support canonical workflows through FAIR Digital Objects (FDO), by identifying recurring canonical steps, building libraries of these steps, with corresponding tuned packages. +
+

+ + + +   Documentation + +

+ +

+ + + / FAIR + + / FDO + +

+ +
+
+
+ +
+
+
+ +

+ + RO-Crate: Research Object Crate + +

+ +

RO-Crate: Research Object Crate

+
+ RO-Crate is a community effort to establish a lightweight approach to packaging research data with their metadata. It aims to make best-practice in formal metadata description accessible and practical for use in a wider variety of situations, from an individual researcher working with a folder of data, to large data-intensive computational research environments. +
+

+ +   GitHub + + + +   Documentation + +

+ +

+ + + / metadata + + / packaging + + / provenance + +

+ +
+
+
+ +
+
+
+ +

+ + WRENCH: Cyberinfrastructure Simulation Workbench + +

+ +

WRENCH: Cyberinfrastructure Simulation Workbench

+
+ A framework for implementing simulators of workflow management systems, with the goal of producing simulators that are accurate and can run scalably on a single computer while requiring minimal software development effort +
+

+ +   GitHub + + + +   Documentation + +

+ +

+ + + / modeling + + / simulation + +

+ +
+
+
+ +
+
+
+ +

+ + WfCommons: A Framework for Enabling Scientific Workflow Research and Development + +

+ +

WfCommons: A Framework for Enabling Scientific Workflow Research and Development

+
+ Foundational tools for analyzing workflow execution instances, generating workflow recipes, and generating synthetic, yet realistic, workflow instances that can be used to develop new techniques, algorithms and systems that can overcome the challenges of efficient and robust execution of ever larger workflows on increasingly complex distributed infrastructures +
+

+ +   GitHub + + + +   Documentation + +

+ +

+ + + / benchmark + + / generator + + / modeling + +

+ +
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/frameworks/contribute.html b/frameworks/contribute.html new file mode 100644 index 0000000000..f08f11d619 --- /dev/null +++ b/frameworks/contribute.html @@ -0,0 +1,301 @@ + + + + + Contribute: Frameworks - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Contribute: Frameworks +

+
+
+
+
+ +
+
+
+
+
+
+ Register an actively-developed open source workflow-related research frameworks +

How to Contribute with a Research Framework

+ All Research Frameworks +
+ +
+

+ The Workflows Community Initiative (WCI) provides a curated collection of open source or + freely accessible tools and frameworks that can be used to support workflow research and development. The + main goal of this collection is to showcase workflow system capabilities developed by the community. We + invite all workflow researchers to share their tools and frameworks through this collection. +

+ +

Adding a Workflow Research Framework

+

+ To add a workflow research framework, you only need to add the framework information into an YAML file + hosted as part of the WCI GitHub repository. The preferred way to submit your changes is via creating a + pull request with the changes. To this end, these are the recommended steps for adding a workflow research + framework: +

+
    +
  1. Fork the WCI GitHub repository
    2. +
  2. Clone your forked repository: + 
    git clone https://github.com/<your_username>/workflowscommunity.github.io
    +
    3. +
  3. Edit the _data/research_frameworks.yml file, and add the information + regarding the workflow research framework: + 
    +- name: "Research Framework Name"
+  url: <framework_url>
+  description: "Short framework description" 
+  icon: <url_to_framework_logo> # square images are preferred (1:1 aspect ratio)
+  github: <url_to_github_repository> # do not provide if hosted at GitLab
+  gitlab: <url_to_gitlab_repository> # do not provide if hosted at GitHub
+  documentation: <documentation_url> # optional
+  tags: # optional: provide up to 5 tags
+    - my_tag_1
+    - my_tag_2
+
    +
    4. +
  4. Commit the changes, and create a pull request for the WCI GitHub + repository.
    5. +
  5. The WCI team will then evaluate your pull request, and merge the changes if the workflow research + framework and examples are properly documented.
    6. +
+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups.html b/groups.html new file mode 100644 index 0000000000..513ae675da --- /dev/null +++ b/groups.html @@ -0,0 +1,390 @@ + + + + + Working Groups - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Working Groups +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of working group and task forces efforts related to workflows research, development, and + application +

+
+
+ +
+ + + + + +
+
+
+

WfBG: Workflow Benchmarking Group

+
+ Define methodology to collect meaningful performance metrics; share exemplar workflows written in multiple workflow languages +
+

+   4 Members
+  Establishing +

+
+
+
+ + + +
+
+
+

FAIR Computational Workflows

+
+ Define FAIR principles for computational workflows that consider the complex lifecycle from specification to execution and data products +
+

+   15 Members
+  Active +

+
+
+
+ + + + + + + +
+
+
+

CWFR: Canonical Workflow Framework for Research

+
+ This group at the FAIR Digital Objects Forum is working on building a workflow framework that enables FAIR practices and provides reusable canonical components. +
+

+  Active + (External) +

+
+
+
+ + + +
+
+
+

CWL4HPC

+
+ This group aims to identify workflow patterns capable of modeling large-scale scientific applications and implement the related Common Workflow Language enhancement proposals. +
+

+  Active + (External) +

+
+
+
+ + + +
+
+
+

FONDA - Foundations of Workflows for Large-Scale Scientific Data Analysis

+
+ DFG Collaborative Research Center 1404 at Humboldt-Universität zu Berlin, Germany +
+

+  Active + (External) +

+
+
+
+ + + +
+
+
+

RO-Crate community

+
+ This community group is evolving RO-Crate – a FAIR data packaging standard. Two monthly calls and Slack channel. +
+

+  Active + (External) +

+
+
+
+ + + +
+
+
+

Workflow Run Crate working group

+
+ This working group is defining Workflow Run Crate – a profile of RO-Crate for capturing the provenance of an execution of a computational workflow. Bi-weekly calls and Slack channel. +
+

+  Active + (External) +

+
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/benchmarking/index.html b/groups/benchmarking/index.html new file mode 100644 index 0000000000..67d9002929 --- /dev/null +++ b/groups/benchmarking/index.html @@ -0,0 +1,467 @@ + + + + + WfBG: Workflow Benchmarking Group - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ WfBG: Workflow Benchmarking Group +

+
+
+
+
+ +
+
+
+
+ + + +
+
+ + Join

+ +   4 members +   |   +  Establishing +
+ +
+

Goals

+ +

In this working group, we seek to:

+
    +
  • Define a shared vocabulary of performance metrics of interest for diverse workflow domains
    • +
  • Design, maintain and share benchmarking suites of real-world workflows to help evaluate those metrics
    • +
  • Develop community agreement on features that such benchmarks should possess
    • +
  • Collaboratively maintain a catalogue of state-of-art implementations of these real-world workflows for various workflow languages/frameworks.
    • +
  • Define a reproducible and agnostic methodology to collect and report benchmark results
    • +
+ +

Anti-Goals

+ +

We do NOT aim to do any of the following:

+
    +
  • Test workflows using minimized data sets that are not representative of actual workflow uses
    • +
  • Define which performance metrics are essential for the workflow research domain. Instead, we want to define several benchmarking suites to evaluate +different metrics
    • +
  • Determine the universally best tool for running workflows. Instead, we want to help users compare the performances of the different Workflow +Management Systems for their specific needs
    • +
+ +

Why is benchmarking important?

+ +

The intrinsic generality of the workflow paradigm makes it a powerful abstraction for designing complex applications and executing them on large-scale +distributed infrastructures, such as HPC centres, Grid environments, and Cloud providers. However, such generality becomes an obstacle when evaluating +workflow implementations or Workflow Management Systems (WMSs), as no consistent and commonly agreed key performance metrics exist in the state-of-art +computer science literature.

+ +

Instead, different application domains tend to privilege different aspects of the workflow execution process when designing their ideal workflow system. +For example, minimising the control-plane overhead is fundamental when running compute-intensive workflows with billions of fine-grained tasks, while +for data-intensive workflows with few giant steps overlapping computation and communication is far more prominent.

+ +

Consequently, different workflow systems excel in handling different kinds of workflows. Still, the lack of community consensus on workflow benchmarking +suites represents a massive obstacle for domain experts trying to compare WMSs based on their needs. Indeed, a direct and fair comparison is possible only +by running multiple state-of-art implementations of the same application on the same execution environment.

+ +

Defining several benchmarking suites to evaluate different metrics of interest would represent a crucial improvement for the workflow research +community. Still, benchmarks have no value without building community consensus around them. Conversely, history tells us that highly recognised +benchmarks can tremendously impact research communities, fostering a positive continuous improvement process for years. For example, think about +the role of HPLinpack in the High-Performance Computing community or the ongoing efforts around mastering the training of Deep Neural Networks +(DNNs) on the ImageNet dataset.

+ +

Events and talks

+ + + +

https://github.com/inutano/cwl-metrics

+ +

https://elixir-europe.org/internal-projects/commissioned-services/performance-benchmarking / https://openebench.bsc.es/dashboard

+ +

https://github.com/SooLee/Benchmark

+ +

https://wfcommons.org/

+ +

Potential performance reporting formats:

+ +
    +
  1. Workflow Trace Archive
    2. +
  2. Workflow Run RO-Crate
    3. +
  3. WfFormat
    4. +
+ + + +

References

+ +

Articles below are published as Open Access, +or with green open access preprints +where gold open access is not possible. Please let us know if you are +unable to access any of these publications. To add to this list, please +suggest a change.

+ +

Benchmark suites

+ +

Tainã Coleman, Henri Casanova, Ketan Maheshwari, Loïc Pottier, Sean R. Wilkinson, Justin Wozniak, Frédéric Suter, Mallikarjun Shankar, Rafael Ferreira da Silva (2022): +WfBench: Automated Generation of Scientific Workflow Benchmarks +2022 IEEE/ACM International Workshop on Performance Modeling, Benchmarking and Simulation of High Performance Computer Systems (PMBS), pp. 100-111 +https://doi.org/10.1109/PMBS56514.2022.00014 (arXiv:2210.03170)

+ +

Elliott Slaughter, Wei Wu, Yuankun Fu, Legend Brandenburg, Nicolai Garcia, Wilhem Kautz, Emily Marx, Kaleb S. Morris, Qinglei Cao, George Bosilca, +Seema Mirchandaney, Wonchan Lee, Sean Treichler, Patrick S. McCormick, Alex Aiken (2020): +Task bench: a parameterized benchmark for evaluating parallel runtime performance +International Conference for High Performance Computing, Networking, Storage and Analysis (SC), 62, pp. 1-15 +https://doi.org/10.1109/SC41405.2020.00066 (arXiv:1908.05790)

+ +

E. Larsonneur, J. Mercier, N. Wiart, E. L. Floch, O. Delhomme and V. Meyer (2018): +Evaluating Workflow Management Systems: A Bioinformatics Use Case +2018 IEEE International Conference on Bioinformatics and Biomedicine (BIBM), pp. 2773-2775 +https://doi.org/10.1109/BIBM.2018.8621141

+ +

Patterns for scientific workflows

+ +

Tainã Coleman, Henri Casanova, Rafael Ferreira da Silva (2021): +WfChef: Automated Generation of Accurate Scientific Workflow Generators +17th IEEE EScience Conference, pp. 159–168 +https://doi.org/10.1109/eScience51609.2021.00026 (arXiv:2105.00129)

+ +

Daniel S. Katz, Andre Merzky, Zhao Zhang, Shantenu Jha (2016): +Application skeletons: Construction and use in eScience +Future Generation Computer Systems, 59, pp. 114-124 +https://doi.org/10.1016/j.future.2015.10.001

+ +

Daniel Garijo, Pinar Alper, Khalid Belhajjame, Óscar Corcho, Yolanda Gil, Carole A. Goble (2014): +Common motifs in scientific workflows: An empirical analysis +Future Generation Computer Systems, 36, pp. 338-351 +https://doi.org/10.1016/j.future.2013.09.018

+ +

Sara Migliorini, Mauro Gambini, Marcello La Rosa, Arthur H.M. ter Hofstede (2011): +Pattern-Based Evaluation of Scientific Workflow Management Systems +Unpublished +https://eprints.qut.edu.au/216123/

+ +

Ustun Yildiz, Adnene Guabtni, Anne H. H. Ngu (2009): +Towards scientific workflow patterns +4th Workshop on Workflows in Support of Large-Scale Science (WORKS) +https://doi.org/10.1145/1645164.1645177

+ +

Robert Stevens, Carole A. Goble, Patricia G. Baker, Andy Brass (2001): +A classification of tasks in bioinformatics +Bioinformatics, 17:1, pp. 180-188 +https://doi.org/10.1093/bioinformatics/17.2.180

+ +

Performance metrics formats

+ +

Rafael Ferreira da Silva (2021): +wfcommons/wfformat +Zenodo +https://doi.org/10.5281/zenodo.4587921

+ +

L. Versluis, Roland Mathá, Sacheendra Talluri, Tim Hegeman, Radu Prodan, Ewa Deelman, Alexandru Iosup (2020): +The Workflow Trace Archive: Open-Access Data From Public and Private Computing Infrastructures +IEEE Transactions on Parallel and Distributed Systems, 31:9, pp. 2170-2184 +https://doi.org/10.1109/TPDS.2020.2984821 (arXiv:1906.07471)

+ +

Tazro Ohta, Tomoya Tanjo, Osamu Ogasawara (2019): +Accumulating computational resource usage of genomic data analysis workflow +to optimize cloud computing instance selection. +GigaScience, 8:4, giz052 +https://doi.org/10.1093/gigascience/giz052 (bioRxiv:456756)

+ +

Workflow benchmarking tools

+ +

Tainã Coleman, Henri Casanova, Loïc Pottier, Manav Kaushik, Ewa Deelman, Rafael Ferreira da Silva (2022): +WfCommons: A framework for enabling scientific workflow research and development +Future Generation Computer Systems, 128, pp. 16-27 +https://doi.org/10.1016/j.future.2021.09.043 (arXiv:2105.14352)

+ +

Salvador Capella-Gutierrez, Diana de la Iglesia, Juergen Haas, Analia Lourenco, José María Fernández, Dmitry Repchevsky, Christophe Dessimoz, +Torsten Schwede, Cedric Notredame, Josep Ll Gelpi, Alfonso Valencia (2017): +Lessons Learned: Recommendations for Establishing Critical Periodic Scientific Benchmarking +bioRxiv:181677 +https://doi.org/10.1101/181677

+ +
+ + +
+

Members

+

The WfBG: Workflow Benchmarking Group working group is composed of 4 members.

+ + Join Working Group   + +
+
+ +
+ + Iacopo Colonnelli + +   Chair +
+ +
+ + Michael R. Crusoe + +   Chair +
+ +
+ + Rafael Ferreira da Silva + + +
+ +
+ + Javier Conejero + + +
+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/best-practices/index.html b/groups/fair/best-practices/index.html new file mode 100644 index 0000000000..7397aae95d --- /dev/null +++ b/groups/fair/best-practices/index.html @@ -0,0 +1,303 @@ + + + + + Best Practices for FAIR Computational Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Best Practices for FAIR Computational Workflows +

+
+
+
+
+ +
+
+
+
+

This is a list of best practices references for FAIR Computational Workflows. Please help us by contributing to this list!

+ +

General FAIR & workflow practices

+ + + +

Best practices for Common Workflow Language

+ + + +

Best practices for Galaxy

+ + + +

Best practices for Snakemake

+ + + +

Best practices for Nextflow

+ + + + + + +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/bibliography/index.html b/groups/fair/bibliography/index.html new file mode 100644 index 0000000000..7703e7e0e0 --- /dev/null +++ b/groups/fair/bibliography/index.html @@ -0,0 +1,565 @@ + + + + + Bibliography of FAIR Computational Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Bibliography of FAIR Computational Workflows +

+
+
+
+
+ +
+
+
+
+

This is a list of academic publications related to FAIR Computational Workflows.

+ +

References

+ +

Articles below are published as Open Access, or with green open access preprints where gold open access is not possible. Please let us know if you are unable to access any of our publications. To add to this list, please suggest a change.

+ +

2024

+ +

Sean Wilkinson, Meznah Aloqalaa, Khalid Belhajjame, Michael R. Crusoe, Bruno de Paula Kinoshita, Luiz Gadelha, Daniel Garijo, Ove Johan Ragnar Gustafsson, Nick Juty, Sehrish Kanwal, Farah Zaib Khan, Johannes Köster, Karsten Peters-von Gehlen, Line Pouchard, Randy K. Rannow, Stian Soiland-Reyes, Nicola Soranzo, Shoaib Sufi, Ziheng Sun, Baiba Vilne, Merridee A. Wouters, Denis Yuen, Carole Goble (2024):
+Applying the FAIR Principles to Computational Workflows.
+arXiv 2410.03490 [cs.DL]
+https://doi.org/10.48550/arXiv.2410.03490

+ +

Ove Johan Ragnar Gustafsson, Sean R. Wilkinson, Finn Bacall, Stian Soiland-Reyes, Simone Leo, Luca Pireddu, Stuart Owen, Nick Juty, José Mª Fernández, Tom Brown, Hervé Ménager, Björn Grüning, Salvador Capella-Gutierrez, Frederik Coppens, Carole Goble (2024):
+WorkflowHub: a registry for computational workflows.
+arXiv:2410.06941 [cs.DL]
+https://doi.org/10.48550/arXiv.2410.06941

+ +

Simone Leo, Michael R. Crusoe, Laura Rodríguez-Navas, Raül Sirvent, Alexander Kanitz, Paul De Geest, Rudolf Wittner, Luca Pireddu, Daniel Garijo, José M. Fernández, Iacopo Colonnelli, Matej Gallo, Tazro Ohta, Hirotaka Suetake, Salvador Capella-Gutierrez, Renske de Wit, Bruno P. Kinoshita, Stian Soiland-Reyes (2024):
+Recording provenance of workflow runs with RO-Crate.
+PLOS One 19(9):e0309210
+https://doi.org/10.1371/journal.pone.0309210

+ +

Scott Edmunds (2024):
+A Decade of FAIR – and what next? Q&A on FAIR workflows with the Netherlands X-omics Initiative.
+GIGAblog
+http://gigasciencejournal.com/blog/fair-workflows/

+ +

Anna Niehues, Casper de Visser, Fiona A Hagenbeek, Purva Kulkarni, René Pool, Naama Karu, Alida S D Kindt, Gurnoor Singh, Robert R J M Vermeiren, Dorret I Boomsma, Jenny van Dongen, Peter A C ’t Hoen, Alain J van Gool (2024):
+A multi-omics data analysis workflow packaged as a FAIR Digital Object.
+GigaScience 13:giad115
+https://doi.org/10.1093/gigascience/giad115

+ +

Magali Do Patrocínio Gonçalves (2024):
+Workflow Sharing Based on Semantics - A Case Study in Marine Spatial Planning.
+Utrecht University (dissertation)
+https://hdl.handle.net/20.500.12932/47041

+ +

George Marchment, Bryan Brancotte, Marie Schmit, Frédéric Lemoine, Sarah Cohen-Boulakia (2024):
+BioFlow-Insight: facilitating reuse of Nextflow workflows with structure reconstruction and visualization.
+NAR Genomics and Bioinformatics 6(3):lqae092
+https://doi.org/10.1093/nargab/lqae092

+ +

Florian Schintke, Khalid Belhajjame, Ninon De Mecquenem, David Frantz, Vanessa Emanuela Guarino, Marcus Hilbrich, Fabian Lehmann, Paolo Missier, Rebecca Sattler, Jan Arne Sparka, Daniel T. Speckhard, Hermann Stolte, Anh Duc Vu, Ulf Leser (2024):
+Validity constraints for data analysis workflows.
+Future Generation Computer Systems 157
+https://doi.org/10.1016/j.future.2024.03.037

+ +

Nathan Maligeay, Noémie Bossut, Khalid Belhajjame (2024):
+Why Do Scientific Workflows Still Break?
+Proceedings of the 36th International Conference on Scientific and Statistical Database Management (SSDBM ‘24)
+https://doi.org/10.1145/3676288.3676300

+ +

José M. Fernández, Paula Iborra, Sébastien Moretti, Arun Isaac, Paul De Geest, Stian Soiland-Reyes (2024):
+BioHackEU23: FAIR Workflow Execution with WfExS and Workflow Run Crate.
+BioHackrXiv
+https://doi.org/10.37044/osf.io/7f94w

+ +

2023

+ +

Casper de Visser, Lennart F. Johansson, Purva Kulkarni, Hailiang Mei, Pieter Neerincx, K. Joeri van der Velde, Péter Horvatovich, Alain J. van Gool, Morris A. Swertz, Peter A. C. ‘t Hoen, Anna Niehues (2023):
+Ten quick tips for building FAIR workflows.
+PLOS Computational Biology 19(9): e1011369
+https://doi.org/10.1371/journal.pcbi.1011369

+ +

Marine Djaffardjy, George Marchment, Clémence Sebe, Raphael Blanchet, Khalid Bellajhame, Alban Gaignard, Frédéric Lemoine, Sarah Cohen-Boulakia (2023):
+Developing and reusing bioinformatics data analysis pipelines using scientific workflow systems.
+Computational and Structural Biotechnology Journal 21
+https://doi.org/10.1016/j.csbj.2023.03.003

+ +

Hirotaka Suetake, Tsukasa Fukusato, Takeo Igarashi, Tazro Ohta (2023):
+Workflow sharing with automated metadata validation and test execution to improve the reusability of published workflows.
+GigaScience 12:giad006
+https://doi.org/10.1093/gigascience/giad006

+ +

Line Pouchard (2023):
+FAIR enabling reuse of data-intensive workflows and scientific reproducibility.
+ICPE ‘23 Companion: Companion of the 2023 ACM/SPEC International Conference on Performance Engineering
+https://doi.org/10.1145/3578245.3586012

+ +

Fadoua Rafii, Horacio Gonzalez-Velez, Adriana E. Chis (2023):
+Automatic FAIR Provenance Collection and Visualization for Time Series.
+ICPE ‘23 Companion: Companion of the 2023 ACM/SPEC International Conference on Performance Engineering
+https://doi.org/10.1145/3578245.3585026

+ +

2022

+ +

Sonia Natalie Mitchell, Andrew Lahiff, Nathan Cummings, Jonathan Hollocombe, Bram Boskamp, Ryan Field, Dennis Reddyhoff, Kristian Zarebski, Antony Wilson, Bruno Viola, Martin Burke, Blair Archibald, Paul Bessell, Richard Blackwell, Lisa A. Boden, Alys Brett, Sam Brett, Ruth Dundas, Jessica Enright, Alejandra N. Gonzalez-Beltran, Claire Harris, Ian Hinder, Christopher David Hughes, Martin Knight, Vino Mano, Ciaran McMonagle, Dominic Mellor, Sibylle Mohr, Glenn Marion, Louise Matthews, Iain J. McKendrick, Christopher Mark Pooley, Thibaud Porphyre, Aaron Reeves, Edward Townsend, Robert Turner, Jeremy Walton, Richard Reeve (2022):
+FAIR data pipeline: provenance-driven data management for traceable scientific workflows.
+Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences 380(2232)
+https://doi.org/10.1098/rsta.2021.0300

+ +

Sean R. Wilkinson, Greg Eisenhauer, Anuj J. Kapadia, Kathryn Knight, Jeremy Logan, Patrick Widener, Matthew Wolf (2022):
+F*** workflows: when parts of FAIR are missing.
+IEEE 18th International Conference on e-Science (e-Science 2022)
+https://doi.org/10.1109/eScience55777.2022.00090 +arXiv:2209.09022

+ +

Raül Sirvent, Javier Conejero, Francesc Lordan, Jorge Ejarque, Laura Rodríguez-Navas, José M. Fernández, Salvador Capella-Gutiérrez, Rosa M. Badia (2022):
+Automatic, Efficient and Scalable Provenance Registration for FAIR HPC Workflows.
+2022 IEEE/ACM Workshop on Workflows in Support of Large-Scale Science (WORKS)
+https://doi.org/10.1109/WORKS56498.2022.00006 +[preprint] +[slides]

+ +

Rudolf Wittner, Cecilia Mascia, Matej Gallo, Francesca Frexia, Heimo Müller, Markus Plass, Jörg Geiger, Petr Holub (2022):
+Lightweight Distributed Provenance Model for Complex Real–world Environments.
+Scientific Data 9(1)
+https://doi.org/10.1038/s41597-022-01537-6

+ +

J. Machicao, A. Ben Abbes, L. Meneguzzi, P. L. P. Corrêa, A. Specht, R. David, G. Subsol, D. Vellenich, R. Devillers, S. Stall, N. Mouquet, M. Chaumont, L. Berti‐Equille, D. Mouillot (2022):
+Mitigation Strategies to Improve Reproducibility of Poverty Estimations From Remote Sensing Images Using Deep Learning.
+Earth and Space Science 9(8)
+https://doi.org/10.1029/2022ea002379

+ +

Mahmood Shad, Ana Trisovic, Sonia Barbosa, Gustavo Durand, Katherine McNeill, Ceilyn Boyd, Robin Wendler, Julian Gautier, Tania Schlatter, Krista Valladares (2022): +Supporting FAIR Workflows at Harvard Data Commons.
+17th International Digital Curation Conference (IDCCC 2022, 2022-06-13/–16.
+https://doi.org/10.5281/zenodo.6640461

+ +

Michael R. Crusoe, Sanne Abeln, Alexandru Iosup, Peter Amstutz, John Chilton, Nebojša Tijanić, Hervé Ménager, Stian Soiland-Reyes, Carole Goble, CWL Community (2022):
+Methods Included: Standardizing Computational Reuse and Portability with the Common Workflow Language.
+Communications of the ACM 65(6)
+https://doi.org/10.1145/3486897

+ +

Peter Wittenburg, Alex Hardisty, Amirpasha Mozzafari, Limor Peer, Nikolay Skvortsov, Alessandro Spinuso, Zhiming Zhao (2022):
+Editors’ Note: Special Issue on Canonical Workflow Frameworks for Research.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_e_00122

+ +

Stian Soiland-Reyes, Genís Bayarri, Pau Andrio, Robin Long, Douglas Lowe, Ania Niewielska, Adam Hospital, Paul Groth (2022):
+Making Canonical Workflow Building Blocks interoperable across workflow languages.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00135

+ +

Alex Hardisty, Paul Brack, Carole Goble, Laurence Livermore, Ben Scott, Quentin Groom, Stuart Owen, Stian Soiland-Reyes (2022):
+The Specimen Data Refinery: A canonical workflow framework and FAIR Digital Object approach to speeding up digital mobilisation of natural history collections.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00134

+ +

Amirpasha Mozaffari, Michael Langguth, Bing Gong, Jessica Ahring, Adrian Rojas Campos, Pascal Nieters, Otoniel José Campos Escobar, Martin Wittenbrink, +Peter Baumann, Martin G. Schultz (2022):
+HPC-oriented Canonical Workflows for Machine Learning Applications in Climate and Weather Prediction.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00131

+ +

Peter Wittenburg, Alex Hardisty, Yann Le Franc, Amirpasha Mozaffari, Limor Peer, Nikolay A. Skvortsov, Zhiming Zhao, Alessandro Spinuso (2022):
+Canonical Workflows to Make Data FAIR.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00132

+ +

Beatriz Serrano-Solano, Anne Fouilloux, Ignacio Eguinoa, Matúš Kalaš, Björn Grüning, Frederik Coppens (2022):
+Galaxy: A Decade of Realising CWFR Concepts.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00136

+ +

Thomas Jejkal, Sabrine Chelbi, Andreas Pfeil, Peter Wittenburg (2022):
+Evaluation of Application Possibilities for Packaging Technologies in Canonical Workflows.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00137

+ +

Hendrik Nolte, Philipp Wieder (2022):
+Realising Data-Centric Scientific Workflows with Provenance-Capturing on Data Lakes.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00141

+ +

Nikolay A. Skvortsov, Sergey A. Stupnikov (2022):
+A Semantic Approach to Workflow Management and Reuse for Research Problem Solving.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00142

+ +

Alessandro Spinuso, Mats Veldhuizen, Daniele Bailo, Valerio Vinciarelli, Tor Langeland (2022):
+SWIRRL. Managing Provenance-aware and Reproducible Workspaces.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00129

+ +

Christian Ohmann, Romain David, Mónica Cano Abadia, Florence Bietrix, Jan-Willem Boiten, Steve Canham, Maria Luisa Chiusano, Walter Dastrù, Arnaud Laroquette, Dario Longo, Michaela Theresia Mayrhofer, Maria Panagiotopoulou, Audrey Richard, Pablo Emilio Verde (2022):
+Pilot Study on the Intercalibration of a Categorisation System for FAIRer Digital Objects Related to Sensitive Data in the Life Sciences.
+Data Intelligence 4(2)
+https://doi.org/10.1162/dint_a_00126

+ +

Stian Soiland-Reyes, Peter Sefton, Mercè Crosas, Leyla Jael Castro, Frederik Coppens, José M. Fernández, Daniel Garijo, Björn Grüning, Marco La Rosa, Simone Leo, Eoghan Ó Carragáin, Marc Portier, Ana Trisovic, RO-Crate Community, Paul Groth, Carole Goble (2022):
+Packaging research artefacts with RO-Crate.
+Data Science 5(2)
+https://doi.org/10.3233/DS-210053

+ +

Paul Brack, Peter Crowther, Stian Soiland-Reyes, Stuart Owen, Douglas Lowe, Alan R Williams, Quentin Groom, Mathias Dillen, Frederik Coppens, Björn Grüning, Ignacio Eguinoa, Philip Ewels, Carole Goble (2022):
+10 Simple Rules for making a software tool workflow-ready
+PLOS Computational Biology 18(3):e1009823 +https://doi.org/10.1371/journal.pcbi.1009823

+ +

Neil P. Chue Hong, Daniel S. Katz, Michelle Barker; Anna-Lena Lamprecht, Carlos Martinez, Fotis E. Psomopoulos, Jen Harrow, Leyla Jael Castro, Morane Gruenpeter, Paula Andrea Martinez, Tom Honeyman; Alexander Struck, Allen Lee, Axel Loewe, Ben van Werkhoven, Catherine Jones, Daniel Garijo, Esther Plomp, Francoise Genova, Hugh Shanahan, Joanna Leng, Maggie Hellström, Malin Sandström, Manodeep Sinha, Mateusz Kuzak, Patricia Herterich, Qian Zhang, Sharif Islam, Susanna-Assunta Sansone, Tom Pollard, Udayanto Dwi Atmojo; Alan Williams, Andreas Czerniak, Anna Niehues, Anne Claire Fouilloux, Bala Desinghu, Carole Goble, Céline Richard, Charles Gray, Chris Erdmann, Daniel Nüst, Daniele Tartarini, Elena Ranguelova, Hartwig Anzt, Ilian Todorov, James McNally, Javier Moldon, Jessica Burnett, Julián Garrido-Sánchez, Khalid Belhajjame, Laurents Sesink, Lorraine Hwang, Marcos Roberto Tovani-Palone, Mark D. Wilkinson, Mathieu Servillat, Matthias Liffers, Merc Fox, Nadica Miljković, Nick Lynch, Paula Martinez Lavanchy, Sandra Gesing, Sarah Stevens, Sergio Martinez Cuesta, Silvio Peroni, Stian Soiland-Reyes, Tom Bakker, Tovo Rabemanantsoa, Vanessa Sochat, Yo Yehudi, FAIR4RS WG (2022):
+FAIR Principles for Research Software version 1.0 (FAIR4RS Principles v1.0).
+Research Data Alliance
+https://doi.org/10.15497/RDA00068

+ +

2021

+ +

Rafael Ferreira da Silva, Henri Casanova, Kyle Chard, Ilkay Altintas, Rosa M Badia, Bartosz Balis, Tainã Coleman, Frederik Coppens, Frank Di Natale, Bjoern Enders, Thomas Fahringer, Rosa Filgueira, Grigori Fursin, Daniel Garijo, Carole Goble, Dorran Howell, Shantenu Jha, Daniel S. Katz, Daniel Laney, Ulf Leser, Maciej Malawski, Kshitij Mehta, Loïc Pottier, Jonathan Ozik, J. Luc Peterson, Lavanya Ramakrishnan, Stian Soiland-Reyes, Douglas Thain, Matthew Wolf (2021):
+A Community Roadmap for Scientific Workflows Research and Development.
+arXiv:2110.02168 [cs.DC] +2021 IEEE Workshop on Workflows in Support of Large-Scale Science (WORKS), pp 81–90.
+https://doi.org/10.1109/WORKS54523.2021.00016

+ +

Robin A Richardson, Remzi Celebi, Sven van der Burg, Djura Smits, Lars Ridder, Michel Dumontier, Tobias Kuhn (2021):
+User-friendly Composition of FAIR Workflows in a Notebook Environment.
+The Eleventh International Conference on Knowledge Capture (K-Cap2021).
+https://arxiv.org/abs/2111.00831

+ +

Jeremy Leipzig, Daniel Nüst, Charles Tapley Hoyt, Karthik Ram, Jane Greenberg (2021):
+The role of metadata in reproducible computational research
+Patterns 2(1):100322
+https://doi.org/10.1016/j.patter.2021.100322

+ +

Sveinung Gundersen, Sanjay Boddu, Salvador Capella-Gutierrez, Finn Drabløs, José M. Fernández, Radmila Kompova, Kieron Taylor, Dmytro Titov, Daniel Zerbino, Eivind Hovig (2021):
+Recommendations for the FAIRification of genomic track metadata [version 1; peer review: 2 approved].
+F1000Research 10(ELIXIR):268
+https://doi.org/10.12688/f1000research.28449.1

+ +

Anna-Lena Lamprecht, Magnus Palmblad, Jon Ison, Veit Schwämmle, +Mohammad Sadnan Al Manir, Ilkay Altintas, Christopher J. O. Baker, Ammar Ben Hadj Amor, Salvador Capella-Gutierrez, +Paulos Charonyktakis, Michael R. Crusoe, +Yolanda Gil, Carole Goble, Timothy J. Griffin, +Paul Groth, Hans Ienasescu, Pratik Jagtap, +Matúš Kalaš, Vedran Kasalica, Alireza Khanteymoori, +Tobias Kuhn, Hailiang Mei, Hervé Ménager, Steffen Möller, Robin A. Richardson, +Vincent Robert, Stian Soiland-Reyes, Robert Stevens, Szoke Szaniszlo, +Suzan Verberne, Aswin Verhoeven, Katherine Wolstencroft (2021):
+Perspectives on automated composition of workflows in the life sciences [version 1; peer review: 2 approved].
+F1000Research 10:897
+https://doi.org/10.12688/f1000research.54159.1

+ +

Rafael Ferreira da Silva, Henri Casanova, Kyle Chard, Dan Laney, Dong Ahn, Shantenu Jha, Carole Goble, Lavanya Ramakrishnan, Luc Peterson, Bjoern Enders, Douglas Thain, Ilkay Altintas, Yadu Babuji, Rosa Badia, Vivien Bonazzi, Taina Coleman, Michael Crusoe, Ewa Deelman, Frank Di Natale & Paolo Di Tommaso (2021):
+Workflows Community Summit: Bringing the Scientific Workflows Community Together.
+Workflows RI Technical Report. arXiv:2103.09181
+https://doi.org/10.5281/zenodo.4606958

+ +

Carole Goble, Stian Soiland-Reyes, Finn Bacall, Stuart Owen, Alan Williams, Ignacio Eguinoa, Bert Droesbeke, Simone Leo, Luca Pireddu, Laura Rodriguez-Navas, José Mª Fernández, Salvador Capella-Gutierrez, Hervé Ménager, Björn Grüning, Beatriz Serrano-Solano, Philip Ewels, Frederik Coppens (2021):
+Implementing FAIR Digital Objects in the EOSC-Life Workflow Collaboratory.
+Zenodo
+https://doi.org/10.5281/zenodo.4605654

+ +

Daniel S. Katz, Morane Gruenpeter, Tom Honeyman, Lorraine Hwang, Mark D. Wilkinson, Vanessa Sochat, Hartwig Anzt, Carole Goble, FAIR4RS Subgroup 1 (2021):
+A Fresh Look at FAIR for Research Software.
+arXiv:2101.10883 [pdf]

+ +

2020

+ +

Carole Goble, Sarah Cohen-Boulakia, Stian Soiland-Reyes, Daniel Garijo, Yolanda Gil, Michael R. Crusoe, Kristian Peters, Daniel Schober (2020):
+FAIR Computational Workflows.
+Data Intelligence 2(1):108–121 +https://doi.org/10.1162/dint_a_00033

+ +

Janno Harjes, Anton Link, Tanja Weibulat, Dagmar Triebel, Gerhard Rambold (2020):
+FAIR digital objects in environmental and life sciences should comprise workflow operation design data and method information for repeatability of study setups and reproducibility of results.
+Database 2020:baaa059
+https://doi.org/10.1093/database/baaa059

+ +

Anna-Lena Lamprecht, Leyla Garcia, Mateusz Kuzak, Carlos Martinez, Ricardo Arcila, Eva Martin Del Pico, Victoria Dominguez Del Angel, Stephanie Van De Sandt, Jon Ison, Paula Andrea Martinez, Peter Mcquilton, Alfonso Valencia, Jennifer Harrow, Fotis Psomopoulos, Josep Ll. Gelpi, Neil Chue Hong, Carole Goble, Salvador Capella-Gutierrez (2020):
+Towards FAIR principles for research software.
+Data Science 3(1) pp. 37–59.
+https://doi.org/10.3233/DS-190026

+ +

2019

+ +

Farah Zaib Khan, Stian Soiland-Reyes, Richard O. Sinnott, Andrew Lonie, Carole Goble, Michael R. Crusoe (2019):
+Sharing interoperable workflow provenance: A review of best practices and their practical application in CWLProv.
+GigaScience 8(11):giz095
+https://doi.org/10.1093/gigascience/giz095

+ +

Jeffrey M. Perkel (2019):
+Workflow systems turn raw data into scientific knowledge +Nature 573
+https://doi.org/10.1038/d41586-019-02619-z

+ +

2018

+ +

Jeffrey M. Perkel (2018):
+That’s the way we flow.
+Nature 573 149-150.
+https://doi.org/10.1038/d41586-019-02619-z

+ +

Natalie J Stanford, Finn Bacall, Fatemeh Zamanzad Ghavidel, Martin Golebiewski, Inge Jonassen, Rune Kleppe, Olga Krebs, Hadas Leonov, Stuart Owen, Kjell Petersen, Maja Rey, Stian Soiland-Reyes, Kidane Tekle, Andreas Weidemann, Alan Williams, Ulrike Wittig, Katy Wolstencroft, Anders Goksøyr, Jacky L. Snoep, Jon Olav Vik, Wolfgang Müller, Carole Goble (2018):
+FAIR Bioinformatics computation and data management: FAIRDOM and the Norwegian Digital Life initiative.
+NETTAB 2018 Network Tools and Applications in Biology.
+[preprint] +[preprint server]

+ +

Gil Alterovitz, Dennis A Dean II, Carole Goble, Michael R Crusoe, Stian Soiland-Reyes, Amanda Bell, Anais Hayes, Anita Suresh, Charles Hadley S King IV, Dan Taylor, KanakaDurga Addepalli, Elaine Johanson, Elaine E Thompson, Eric Donaldson, Hiroki Morizono, Hsinyi Tsang, Jeet K Vora, Jeremy Goecks, Jianchao Yao, Jonas S Almeida, Konstantinos Krampis, Krista Smith, Lydia Guo, Mark Walderhaug, Marco Schito, Matthew Ezewudo, Nuria Guimera, Paul Walsh, Robel Kahsay, Srikanth Gottipati, Timothy C Rodwell, Toby Bloom, Yuching Lai, Vahan Simonyan, Raja Mazumder (2018):
+Enabling Precision Medicine via standard communication of NGS provenance, analysis, and results.
+PLOS Biology. 16(12):e3000099
+https://doi.org/10.1371/journal.pbio.3000099 +(bioXriv:191783)

+ +

Pablo Carbonell, Adrian J. Jervis, Christopher J. Robinson, Cunyu Yan, Mark Dunstan, Neil Swainston, Maria Vinaixa, Katherine A. Hollywood, Andrew Currin, Nicholas J. W. Rattray, Sandra Taylor, Reynard Spiess, Rehana Sung, Alan R. Williams, Donal Fellows, Natalie J. Stanford, Paul Mulherin, Rosalind Le Feuvre, Perdita Barran, Royston Goodacre, Nicholas J. Turner, Carole Goble, George Guoqiang Chen, Douglas B. Kell, Jason Micklefield, Rainer Breitling, Eriko Takano, Jean-Loup Faulon, Nigel S. Scrutton (2018):
+An automated Design-Build-Test-Learn pipeline for enhanced microbial production of fine chemicals.
+Communications Biology 1:66
+https://doi.org/10.1038/s42003-018-0076-9

+ +

2017

+ +

Stephen J Eglen, Ben Marwick, Yaroslav O Halchenko, Michael Hanke, Shoaib Sufi, Padraig Gleeson, R Angus Silver, Andrew P Davison, Linda Lanyon, Mathew Abrams, Thomas Wachtler, David J Willshaw, Christophe Pouzat, Jean-Baptiste Poline (2017):
+Toward standard practices for sharing computer code and programs in neuroscience.
+Nature Neuroscience 20, 770–773. +https://doi.org/10.1038/nn.4550 [bioRxiv preprint]

+ +

Steffen Möller, Stuart W. Prescott, Lars Wirzenius; Petter Reinholdtsen, Brad Chapman, Pjotr Prins, Stian Soiland-Reyes, Fabian Klötzl, Andrea Bagnacani, Matúš Kalaš, Andreas Tille, Michael R. Crusoe (2017): +Robust cross-platform workflows: how technical and scientific communities collaborate to develop, test and share best practices for data analysis.
+Data Science and Engineering 2:232 pp 232–244.
+https://doi.org/10.1007/s41019-017-0050-4

+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/events/index.html b/groups/fair/events/index.html new file mode 100644 index 0000000000..4439eff9a7 --- /dev/null +++ b/groups/fair/events/index.html @@ -0,0 +1,347 @@ + + + + + Events on FAIR Computational Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Events on FAIR Computational Workflows +

+
+
+
+
+ +
+
+
+
+

This is a list of events and talks related to FAIR Computational Workflows.

+ +

Events, presentations and activities are also available in WorkflowHub in the FAIR Computational Workflows Team

+ +

Related past and upcoming events:

+ + + + +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/index.html b/groups/fair/index.html new file mode 100644 index 0000000000..b1f9c91d5b --- /dev/null +++ b/groups/fair/index.html @@ -0,0 +1,465 @@ + + + + + FAIR Computational Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ FAIR Computational Workflows +

+
+
+
+
+ +
+
+
+
+ + + +
+
+ + Join

+ +   15 members +   |   +  Active +
+ +
+

The FAIR principles have laid a foundation for sharing and publishing digital assets and, in particular, data. The +FAIR principles emphasize machine accessibility and that all digital assets should be Findable, Accessible, Interoperable, +and Reusable. Workflows encode the methods by which the scientific process is conducted and via which data are created. +It is thus important that workflows both support the creation of FAIR data and themselves adhere to the FAIR principles.

+ +

Subsections:

+ + + +
+ +

Goals

+ +

The working group is seeking workflow developers and users to directly inform the standards, processes and recommendations +that make computational workflows FAIR.

+ +

In this working group, we aim to:

+
    +
  • Define FAIR principles for computational workflows that consider the complex lifecycle from specification to execution and data products
    • +
  • Define metrics to measure the FAIRness of a workflow
    • +
  • Define recommendations for FAIR workflow developers and systems
    • +
  • Define processes to automate FAIRness in workflows by recording necessary provenance data
    • +
+ +

Working Group meetings

+ +

This working Group is open for anyone interested, please feel free to join the Workflows Community Initiative or attend one of our calls. To ensure more people can get involved in this international effort, the Australian BioCommons is collaborating with the WCI to run a second working group meeting at a time convenient for the Asia Pacific region. Everyone is welcome, regardless of your timezone.

+ +
    +
  • Meeting schedule: +
      +
    • Monthly 2nd Thursday 17:00 CET (note: daylight savings follows EU)
      • +
    • Monthly 2nd Thursday 13:30 AEDT (note: daylight savings follows Australia)
      • +
    • Monthly 4th Thursday 17:00 CET (note: daylight savings follows EU)
      • +
    +
    • +
  • Meeting agendas/telcon: Meeting notes
    • +
  • Slack chat: #fair-computational-workflows on workflowscommunity.slack.com (invite link)
    • +
+ +

What are FAIR Computational Workflows?

+ +

Adapted from the article FAIR Computational Workflows https://doi.org/10.1162/dint_a_00033:

+ +
+

Computational workflows describe the complex multi-step methods that are used for data collection, data preparation, analytics, predictive modelling, and simulation that lead to new data products.

+ +

Workflows can inherently contribute to the FAIR data principles: by processing data according to established metadata; by creating metadata themselves during the processing of data; and by tracking and recording data provenance.

+ +

These properties aid data quality assessment and contribute to secondary data usage. Moreover, workflows are digital objects in their own right.

+ +

We argue that FAIR principles for workflows need to address their specific nature in terms of their composition of executable software steps, their provenance, and their development.

+
+ +

This group is gathering community resources and literature on FAIR Computational Workflows. Feel free to suggest a change to help improve this page!

+ +

Cite FAIR Computational Workflows

+ +

Sean Wilkinson, Meznah Aloqalaa, Khalid Belhajjame, Michael R. Crusoe, Bruno de Paula Kinoshita, Luiz Gadelha, Daniel Garijo, Ove Johan Ragnar Gustafsson, Nick Juty, Sehrish Kanwal, Farah Zaib Khan, Johannes Köster, Karsten Peters-von Gehlen, Line Pouchard, Randy K. Rannow, Stian Soiland-Reyes, Nicola Soranzo, Shoaib Sufi, Ziheng Sun, Baiba Vilne, Merridee A. Wouters, Denis Yuen, Carole Goble (2024):
+Applying the FAIR Principles to Computational Workflows.
+arXiv 2410.03490 [cs.DL]
+https://doi.org/10.48550/arXiv.2410.03490

+ +

Carole Goble, Sarah Cohen-Boulakia, Stian Soiland-Reyes, Daniel Garijo, Yolanda Gil, Michael R. Crusoe, Kristian Peters, Daniel Schober (2020):
+FAIR Computational Workflows.
+Data Intelligence 2(1):108–121
+https://doi.org/10.1162/dint_a_00033

+ + +
+ + +
+

Members

+

The FAIR Computational Workflows working group is composed of 15 members.

+ + Join Working Group   + +
+
+ +
+ + Carole Goble + +   Chair +
+ +
+ + Stian Soiland-Reyes + +   Chair +
+ +
+ + Sean R. Wilkinson + +   Chair +
+ +
+ + Michael R. Crusoe + + +
+ +
+ + Rosa Figueira + + +
+ +
+ + Luiz Gadelha + + +
+ +
+ + Daniel Garijo + + +
+ +
+ + Sandra Gesing + + +
+ +
+ + Johan Gustafsson + + +
+ +
+ + Bruno de Paula Kinoshita + + +
+ +
+ + Farah Zaib Khan + + +
+ +
+ + Karsten Peters-von Gehlen + + +
+ +
+ + Randy K Rannow + + +
+ +
+ + Nicola Soranzo + + +
+ +
+ + Ziheng Sun + + +
+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/resources/index.html b/groups/fair/resources/index.html new file mode 100644 index 0000000000..5381da50b4 --- /dev/null +++ b/groups/fair/resources/index.html @@ -0,0 +1,297 @@ + + + + + FAIR Computational Workflows resources - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ FAIR Computational Workflows resources +

+
+
+
+
+ +
+
+
+
+

This is a list of registries, projects, initiatives and standards related to FAIR Computational Workflows.

+ +

Registries

+ + + +

Projects and initiatives

+ +

Related projects and initiatives supporting FAIR Computational Workflows aims:

+ + + +

Note that the similarly named project Implementing FAIR Workflows is about making the overall research process FAIR, not necessarily related to computational workflows.

+ +

Related standards for FAIR computational workflows:

+ + + + +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/groups/fair/training/index.html b/groups/fair/training/index.html new file mode 100644 index 0000000000..b7b00e80ba --- /dev/null +++ b/groups/fair/training/index.html @@ -0,0 +1,268 @@ + + + + + Training for FAIR Computational Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Training for FAIR Computational Workflows +

+
+
+
+
+ +
+
+
+
+

This is a list of training materials for FAIR Computational Workflows. Please help us by contributing to this list!

+ + + + +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/images/about/abramson.jpg b/images/about/abramson.jpg new file mode 100644 index 0000000000..9c80dada4f Binary files /dev/null and b/images/about/abramson.jpg differ diff --git a/images/about/altintas.jpeg b/images/about/altintas.jpeg new file mode 100644 index 0000000000..e6e9f4c437 Binary files /dev/null and b/images/about/altintas.jpeg differ diff --git a/images/about/badia.jpg b/images/about/badia.jpg new file mode 100644 index 0000000000..a6ac7f58c6 Binary files /dev/null and b/images/about/badia.jpg differ diff --git a/images/about/casanova.jpg b/images/about/casanova.jpg new file mode 100644 index 0000000000..6cb9f44d4d Binary files /dev/null and b/images/about/casanova.jpg differ diff --git a/images/about/chard.jpg b/images/about/chard.jpg new file mode 100644 index 0000000000..1e32437f6a Binary files /dev/null and b/images/about/chard.jpg differ diff --git a/images/about/crusoe.jpg b/images/about/crusoe.jpg new file mode 100644 index 0000000000..f5a6c46b0d Binary files /dev/null and b/images/about/crusoe.jpg differ diff --git a/images/about/deelman.jpg b/images/about/deelman.jpg new file mode 100644 index 0000000000..f89a95ed41 Binary files /dev/null and b/images/about/deelman.jpg differ diff --git a/images/about/dinatale.jpg b/images/about/dinatale.jpg new file mode 100644 index 0000000000..cb398fe18e Binary files /dev/null and b/images/about/dinatale.jpg differ diff --git a/images/about/ditommaso.jpg b/images/about/ditommaso.jpg new file mode 100644 index 0000000000..fa8f55d037 Binary files /dev/null and b/images/about/ditommaso.jpg differ diff --git a/images/about/enders.jpg b/images/about/enders.jpg new file mode 100644 index 0000000000..5470edb9f8 Binary files /dev/null and b/images/about/enders.jpg differ diff --git a/images/about/erdmann.jpg b/images/about/erdmann.jpg new file mode 100644 index 0000000000..cad4384399 Binary files /dev/null and b/images/about/erdmann.jpg differ diff --git a/images/about/fahringer.jpg b/images/about/fahringer.jpg new file mode 100644 index 0000000000..1c8f13654d Binary files /dev/null and b/images/about/fahringer.jpg differ diff --git a/images/about/ferreiradasilva.jpg b/images/about/ferreiradasilva.jpg new file mode 100644 index 0000000000..fd4b7b0a0d Binary files /dev/null and b/images/about/ferreiradasilva.jpg differ diff --git a/images/about/filgueira.jpg b/images/about/filgueira.jpg new file mode 100644 index 0000000000..95cb33d0e0 Binary files /dev/null and b/images/about/filgueira.jpg differ diff --git a/images/about/gallo.jpg b/images/about/gallo.jpg new file mode 100644 index 0000000000..4b08f384a5 Binary files /dev/null and b/images/about/gallo.jpg differ diff --git a/images/about/gibbs.png b/images/about/gibbs.png new file mode 100644 index 0000000000..f337fdd9e9 Binary files /dev/null and b/images/about/gibbs.png differ diff --git a/images/about/goble.jpg b/images/about/goble.jpg new file mode 100644 index 0000000000..7c47f0a5b9 Binary files /dev/null and b/images/about/goble.jpg differ diff --git a/images/about/groening.jpg b/images/about/groening.jpg new file mode 100644 index 0000000000..67b76c6f8a Binary files /dev/null and b/images/about/groening.jpg differ diff --git a/images/about/jha.jpg b/images/about/jha.jpg new file mode 100644 index 0000000000..71f1dcc6e8 Binary files /dev/null and b/images/about/jha.jpg differ diff --git a/images/about/katz.jpg b/images/about/katz.jpg new file mode 100644 index 0000000000..73bc323c8c Binary files /dev/null and b/images/about/katz.jpg differ diff --git a/images/about/koster.jpg b/images/about/koster.jpg new file mode 100644 index 0000000000..cf31f59341 Binary files /dev/null and b/images/about/koster.jpg differ diff --git a/images/about/leser.jpg b/images/about/leser.jpg new file mode 100644 index 0000000000..130fcb0841 Binary files /dev/null and b/images/about/leser.jpg differ diff --git a/images/about/mattoso.jpg b/images/about/mattoso.jpg new file mode 100644 index 0000000000..b5e79a8f0c Binary files /dev/null and b/images/about/mattoso.jpg differ diff --git a/images/about/peterson.jpg b/images/about/peterson.jpg new file mode 100644 index 0000000000..14ef916ab3 Binary files /dev/null and b/images/about/peterson.jpg differ diff --git a/images/about/ramakrishnan.jpg b/images/about/ramakrishnan.jpg new file mode 100644 index 0000000000..d4e0fd365e Binary files /dev/null and b/images/about/ramakrishnan.jpg differ diff --git a/images/about/soiland-reys.jpg b/images/about/soiland-reys.jpg new file mode 100644 index 0000000000..dd07b0d8e3 Binary files /dev/null and b/images/about/soiland-reys.jpg differ diff --git a/images/about/suter.jpeg b/images/about/suter.jpeg new file mode 100644 index 0000000000..96b5391dc3 Binary files /dev/null and b/images/about/suter.jpeg differ diff --git a/images/about/thain.jpg b/images/about/thain.jpg new file mode 100644 index 0000000000..6ab7969265 Binary files /dev/null and b/images/about/thain.jpg differ diff --git a/images/about/wilkinson.jpg b/images/about/wilkinson.jpg new file mode 100644 index 0000000000..af5427b244 Binary files /dev/null and b/images/about/wilkinson.jpg differ diff --git a/images/about/wolf.jpg b/images/about/wolf.jpg new file mode 100644 index 0000000000..8a2e3750cf Binary files /dev/null and b/images/about/wolf.jpg differ diff --git a/images/about/wozniak.jpg b/images/about/wozniak.jpg new file mode 100644 index 0000000000..ef03319635 Binary files /dev/null and b/images/about/wozniak.jpg differ diff --git a/images/bof/ACROSS.jpeg b/images/bof/ACROSS.jpeg new file mode 100644 index 0000000000..86b3157aee Binary files /dev/null and b/images/bof/ACROSS.jpeg differ diff --git a/images/bof/DOE-SC-COLOR.png b/images/bof/DOE-SC-COLOR.png new file mode 100644 index 0000000000..b70d100fe2 Binary files /dev/null and b/images/bof/DOE-SC-COLOR.png differ diff --git a/images/bof/data_streaming_bof.jpg b/images/bof/data_streaming_bof.jpg new file mode 100644 index 0000000000..e70b02d26e Binary files /dev/null and b/images/bof/data_streaming_bof.jpg differ diff --git a/images/bof/ecp.png b/images/bof/ecp.png new file mode 100644 index 0000000000..d52e960a2d Binary files /dev/null and b/images/bof/ecp.png differ diff --git a/images/bof/eflows4hpc.png b/images/bof/eflows4hpc.png new file mode 100644 index 0000000000..6ada28409b Binary files /dev/null and b/images/bof/eflows4hpc.png differ diff --git a/images/bof/exaworks-bof-ecpam23.png b/images/bof/exaworks-bof-ecpam23.png new file mode 100644 index 0000000000..4f80f893b3 Binary files /dev/null and b/images/bof/exaworks-bof-ecpam23.png differ diff --git a/images/bof/wci-bof-sc22.png b/images/bof/wci-bof-sc22.png new file mode 100644 index 0000000000..aaa2f63cd7 Binary files /dev/null and b/images/bof/wci-bof-sc22.png differ diff --git a/images/bof/wci-bof-sc24.jpeg b/images/bof/wci-bof-sc24.jpeg new file mode 100644 index 0000000000..8bb37b7bbf Binary files /dev/null and b/images/bof/wci-bof-sc24.jpeg differ diff --git a/images/institutions/agu.png b/images/institutions/agu.png new file mode 100644 index 0000000000..4bc229a04f Binary files /dev/null and b/images/institutions/agu.png differ diff --git a/images/institutions/anl.png b/images/institutions/anl.png new file mode 100644 index 0000000000..f48712471e Binary files /dev/null and b/images/institutions/anl.png differ diff --git a/images/institutions/bnl.png b/images/institutions/bnl.png new file mode 100644 index 0000000000..84cdbe58a6 Binary files /dev/null and b/images/institutions/bnl.png differ diff --git a/images/institutions/bsc.png b/images/institutions/bsc.png new file mode 100644 index 0000000000..6088095c32 Binary files /dev/null and b/images/institutions/bsc.png differ diff --git a/images/institutions/ge-research.jpeg b/images/institutions/ge-research.jpeg new file mode 100644 index 0000000000..57358af212 Binary files /dev/null and b/images/institutions/ge-research.jpeg differ diff --git a/images/institutions/huberlin.png b/images/institutions/huberlin.png new file mode 100644 index 0000000000..e49e8137b4 Binary files /dev/null and b/images/institutions/huberlin.png differ diff --git a/images/institutions/lbnl.png b/images/institutions/lbnl.png new file mode 100644 index 0000000000..5ceeb1ad1f Binary files /dev/null and b/images/institutions/lbnl.png differ diff --git a/images/institutions/llnl.png b/images/institutions/llnl.png new file mode 100644 index 0000000000..cfd1dd2c81 Binary files /dev/null and b/images/institutions/llnl.png differ diff --git a/images/institutions/nd.png b/images/institutions/nd.png new file mode 100644 index 0000000000..d1b88978ad Binary files /dev/null and b/images/institutions/nd.png differ diff --git a/images/institutions/nersc.png b/images/institutions/nersc.png new file mode 100644 index 0000000000..3edcf62aed Binary files /dev/null and b/images/institutions/nersc.png differ diff --git a/images/institutions/nvidia.png b/images/institutions/nvidia.png new file mode 100644 index 0000000000..78c47e9f81 Binary files /dev/null and b/images/institutions/nvidia.png differ diff --git a/images/institutions/ornl.png b/images/institutions/ornl.png new file mode 100644 index 0000000000..1906d2178b Binary files /dev/null and b/images/institutions/ornl.png differ diff --git a/images/institutions/rutgers.png b/images/institutions/rutgers.png new file mode 100644 index 0000000000..c5e2db9c74 Binary files /dev/null and b/images/institutions/rutgers.png differ diff --git a/images/institutions/samsung.png b/images/institutions/samsung.png new file mode 100644 index 0000000000..3364e4059e Binary files /dev/null and b/images/institutions/samsung.png differ diff --git a/images/institutions/seqeralabs.png b/images/institutions/seqeralabs.png new file mode 100644 index 0000000000..48bd2ee58e Binary files /dev/null and b/images/institutions/seqeralabs.png differ diff --git a/images/institutions/uchicago.png b/images/institutions/uchicago.png new file mode 100644 index 0000000000..7652e252b4 Binary files /dev/null and b/images/institutions/uchicago.png differ diff --git a/images/institutions/ucsd.png b/images/institutions/ucsd.png new file mode 100644 index 0000000000..25e7bb8909 Binary files /dev/null and b/images/institutions/ucsd.png differ diff --git a/images/institutions/ude.png b/images/institutions/ude.png new file mode 100644 index 0000000000..327a486b37 Binary files /dev/null and b/images/institutions/ude.png differ diff --git a/images/institutions/ufreiburg.png b/images/institutions/ufreiburg.png new file mode 100644 index 0000000000..6eec706db0 Binary files /dev/null and b/images/institutions/ufreiburg.png differ diff --git a/images/institutions/ufrj.png b/images/institutions/ufrj.png new file mode 100644 index 0000000000..4ec8f53c01 Binary files /dev/null and b/images/institutions/ufrj.png differ diff --git a/images/institutions/uhm.png b/images/institutions/uhm.png new file mode 100644 index 0000000000..c0b82892e3 Binary files /dev/null and b/images/institutions/uhm.png differ diff --git a/images/institutions/uinnsbruck.png b/images/institutions/uinnsbruck.png new file mode 100644 index 0000000000..df321d2b7c Binary files /dev/null and b/images/institutions/uinnsbruck.png differ diff --git a/images/institutions/uiuc.png b/images/institutions/uiuc.png new file mode 100644 index 0000000000..8309b95e7c Binary files /dev/null and b/images/institutions/uiuc.png differ diff --git a/images/institutions/umanchester.png b/images/institutions/umanchester.png new file mode 100644 index 0000000000..4a11950d6c Binary files /dev/null and b/images/institutions/umanchester.png differ diff --git a/images/institutions/uq.png b/images/institutions/uq.png new file mode 100644 index 0000000000..14ee4cad89 Binary files /dev/null and b/images/institutions/uq.png differ diff --git a/images/institutions/usc.png b/images/institutions/usc.png new file mode 100644 index 0000000000..321321de3c Binary files /dev/null and b/images/institutions/usc.png differ diff --git a/images/institutions/ustandrews.png b/images/institutions/ustandrews.png new file mode 100644 index 0000000000..a79185b39c Binary files /dev/null and b/images/institutions/ustandrews.png differ diff --git a/images/newsletter/nap.jpeg b/images/newsletter/nap.jpeg new file mode 100644 index 0000000000..14e872b1bc Binary files /dev/null and b/images/newsletter/nap.jpeg differ diff --git a/images/reports/nas-2022.jpeg b/images/reports/nas-2022.jpeg new file mode 100644 index 0000000000..48fef18582 Binary files /dev/null and b/images/reports/nas-2022.jpeg differ diff --git a/images/reports/wcs-2021-community.png b/images/reports/wcs-2021-community.png new file mode 100644 index 0000000000..bbb1a7a30b Binary files /dev/null and b/images/reports/wcs-2021-community.png differ diff --git a/images/reports/wcs-2021-facility.png b/images/reports/wcs-2021-facility.png new file mode 100644 index 0000000000..630104d34c Binary files /dev/null and b/images/reports/wcs-2021-facility.png differ diff --git a/images/reports/wcs-2021-technical.png b/images/reports/wcs-2021-technical.png new file mode 100644 index 0000000000..4f42384cd1 Binary files /dev/null and b/images/reports/wcs-2021-technical.png differ diff --git a/images/reports/wcs-2022.png b/images/reports/wcs-2022.png new file mode 100644 index 0000000000..8f83b40f60 Binary files /dev/null and b/images/reports/wcs-2022.png differ diff --git a/images/reports/wcs-2024.png b/images/reports/wcs-2024.png new file mode 100644 index 0000000000..57f0695e48 Binary files /dev/null and b/images/reports/wcs-2024.png differ diff --git a/images/stories/anton-maksimov-5642-su-qM37iptlCNY-unsplash.jpg b/images/stories/anton-maksimov-5642-su-qM37iptlCNY-unsplash.jpg new file mode 100644 index 0000000000..3f6b7a6c82 Binary files /dev/null and b/images/stories/anton-maksimov-5642-su-qM37iptlCNY-unsplash.jpg differ diff --git a/images/stories/covalent-01.png b/images/stories/covalent-01.png new file mode 100644 index 0000000000..6924ce003f Binary files /dev/null and b/images/stories/covalent-01.png differ diff --git a/images/stories/covalent-02.png b/images/stories/covalent-02.png new file mode 100644 index 0000000000..97da4bdff7 Binary files /dev/null and b/images/stories/covalent-02.png differ diff --git a/images/stories/cunningham.jpg b/images/stories/cunningham.jpg new file mode 100644 index 0000000000..6739cf111b Binary files /dev/null and b/images/stories/cunningham.jpg differ diff --git a/images/stories/eduwrench.png b/images/stories/eduwrench.png new file mode 100644 index 0000000000..a4dd36df5f Binary files /dev/null and b/images/stories/eduwrench.png differ diff --git a/images/stories/eflows4hpc-methodology.png b/images/stories/eflows4hpc-methodology.png new file mode 100644 index 0000000000..97cd65e60a Binary files /dev/null and b/images/stories/eflows4hpc-methodology.png differ diff --git a/images/stories/eflows4hpc-stack.png b/images/stories/eflows4hpc-stack.png new file mode 100644 index 0000000000..1754eaa205 Binary files /dev/null and b/images/stories/eflows4hpc-stack.png differ diff --git a/images/stories/ellis.jpeg b/images/stories/ellis.jpeg new file mode 100644 index 0000000000..a313322f17 Binary files /dev/null and b/images/stories/ellis.jpeg differ diff --git a/images/stories/nextflow-story.png b/images/stories/nextflow-story.png new file mode 100644 index 0000000000..d9dc31890e Binary files /dev/null and b/images/stories/nextflow-story.png differ diff --git a/images/stories/nsf-ieee-tcpp.png b/images/stories/nsf-ieee-tcpp.png new file mode 100644 index 0000000000..6e2b2976ad Binary files /dev/null and b/images/stories/nsf-ieee-tcpp.png differ diff --git a/images/stories/scherer.jpeg b/images/stories/scherer.jpeg new file mode 100644 index 0000000000..0516a119eb Binary files /dev/null and b/images/stories/scherer.jpeg differ diff --git a/images/stories/shao.jpeg b/images/stories/shao.jpeg new file mode 100644 index 0000000000..c25e36a5b7 Binary files /dev/null and b/images/stories/shao.jpeg differ diff --git a/images/stories/smartsim.png b/images/stories/smartsim.png new file mode 100644 index 0000000000..6210c5baf8 Binary files /dev/null and b/images/stories/smartsim.png differ diff --git a/images/stories/smartsim2.png b/images/stories/smartsim2.png new file mode 100644 index 0000000000..07bc4b2180 Binary files /dev/null and b/images/stories/smartsim2.png differ diff --git a/images/stories/smartsim3.png b/images/stories/smartsim3.png new file mode 100644 index 0000000000..aa40cb9c3b Binary files /dev/null and b/images/stories/smartsim3.png differ diff --git a/images/stories/smartsim4.png b/images/stories/smartsim4.png new file mode 100644 index 0000000000..1f365fa7cd Binary files /dev/null and b/images/stories/smartsim4.png differ diff --git a/images/stories/thamsen.jpeg b/images/stories/thamsen.jpeg new file mode 100644 index 0000000000..b4389510a6 Binary files /dev/null and b/images/stories/thamsen.jpeg differ diff --git a/images/summits/covalent.png b/images/summits/covalent.png new file mode 100644 index 0000000000..b542d012fc Binary files /dev/null and b/images/summits/covalent.png differ diff --git a/images/summits/wcs-2022-banner.png b/images/summits/wcs-2022-banner.png new file mode 100644 index 0000000000..da49421559 Binary files /dev/null and b/images/summits/wcs-2022-banner.png differ diff --git a/images/summits/wcs-2022-day1.png b/images/summits/wcs-2022-day1.png new file mode 100644 index 0000000000..f2518696b2 Binary files /dev/null and b/images/summits/wcs-2022-day1.png differ diff --git a/images/summits/wcs-2022-day2.png b/images/summits/wcs-2022-day2.png new file mode 100644 index 0000000000..9e03a6dd10 Binary files /dev/null and b/images/summits/wcs-2022-day2.png differ diff --git a/images/summits/wcs-2022-short-banner.png b/images/summits/wcs-2022-short-banner.png new file mode 100644 index 0000000000..3014e76ce4 Binary files /dev/null and b/images/summits/wcs-2022-short-banner.png differ diff --git a/images/summits/wcs-2022.png b/images/summits/wcs-2022.png new file mode 100644 index 0000000000..26ffb847fe Binary files /dev/null and b/images/summits/wcs-2022.png differ diff --git a/images/summits/wcs-2024-participants.jpg b/images/summits/wcs-2024-participants.jpg new file mode 100644 index 0000000000..a79f5b6f36 Binary files /dev/null and b/images/summits/wcs-2024-participants.jpg differ diff --git a/images/summits/wcs-2024.png b/images/summits/wcs-2024.png new file mode 100644 index 0000000000..8cc54b848c Binary files /dev/null and b/images/summits/wcs-2024.png differ diff --git a/images/summits/wcs-community-participants.png b/images/summits/wcs-community-participants.png new file mode 100644 index 0000000000..ce7ac87d73 Binary files /dev/null and b/images/summits/wcs-community-participants.png differ diff --git a/images/summits/wcs-facilities-participants.png b/images/summits/wcs-facilities-participants.png new file mode 100644 index 0000000000..877afe09cc Binary files /dev/null and b/images/summits/wcs-facilities-participants.png differ diff --git a/images/summits/wcs-technical-participants.png b/images/summits/wcs-technical-participants.png new file mode 100644 index 0000000000..6f61c05652 Binary files /dev/null and b/images/summits/wcs-technical-participants.png differ diff --git a/images/summits/workflowhub.png b/images/summits/workflowhub.png new file mode 100644 index 0000000000..4bfe421943 Binary files /dev/null and b/images/summits/workflowhub.png differ diff --git a/images/wci-default-card.png b/images/wci-default-card.png new file mode 100644 index 0000000000..c041d9d6a4 Binary files /dev/null and b/images/wci-default-card.png differ diff --git a/images/wci-white-logo.png b/images/wci-white-logo.png new file mode 100644 index 0000000000..f3e41fb570 Binary files /dev/null and b/images/wci-white-logo.png differ diff --git a/images/workflows-community-logo-horizontal.png b/images/workflows-community-logo-horizontal.png new file mode 100644 index 0000000000..8e6812f4f5 Binary files /dev/null and b/images/workflows-community-logo-horizontal.png differ diff --git a/images/workflows-community-logo.png b/images/workflows-community-logo.png new file mode 100644 index 0000000000..2c7acf3351 Binary files /dev/null and b/images/workflows-community-logo.png differ diff --git a/index.html b/index.html new file mode 100644 index 0000000000..80630c7c2e --- /dev/null +++ b/index.html @@ -0,0 +1,1076 @@ + + + + + Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ + + +

+
+

+ Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists and workflow systems developers to discover software products, related efforts, + events, technical reports, etc. and engage in community-wide efforts to tackle workflows grand + challenges. +

+
+ + +

+
+ +
+
+
+
+
+ +
+ + + + + + + + + + +
+
+
+
+ Perspectives on workflows-related topics from + the community +

Stories

+
+
+
+
+
+ +
+ + +
+

SmartSim: Combining Machine Learning and HPC Workflows

+

+ Apr 02, 2023 +

+
+ + Matthew Ellis – HPE
+ + Bill Scherer – HPE
+ + Andrew Shao – HPE
+ +
+
+ +
+ +
+ + +
+

The Elephant in the Data Center – Energy Consumption of Workflow Executions

+

+ Jan 13, 2023 +

+
+ + Ulf Leser – Humboldt-Universität zu Berlin
+ + Lauritz Thamsen – University of Glasgow
+ +
+
+ +
+ +
+ + +
+

Covalent: Workflow Orchestration on Highly Heterogeneous Infrastructure

+

+ Oct 24, 2022 +

+
+ + Will Cunningham – Agnostiq
+ +
+
+ +
+ +
+ + +
+

Widening Workflows usage: the eFlows4HPC project

+

+ Sep 29, 2022 +

+
+ + Rosa M. Badia – Barcelona Supercomputing Center
+ +
+
+ +
+ +
+ + +
+

A quick overview of Nextflow workflow system

+

+ Sep 28, 2022 +

+
+ + Paolo Di Tommaso – Nextflow creator and CTO of Seqera Labs
+ +
+
+ +
+ +
+ + +
+

Workflows Education: Underlying Computer Science Concepts

+

+ May 16, 2022 +

+
+ + Henri Casanova – University of Hawaii
+ +
+
+ +
+ +
+ +


+ +
+
+

See all Stories

+
+ +
+
+
+
+
+
+ + +
+
+
+
+

The Workflows Community in Numbers

+
+
+
+
+
+ + 0 + members + +
+
+
+
+ + 0 + workflow systems + +
+
+
+
+ + 0 + research frameworks + +
+
+
+
+ + 0 + working groups + +
+
+
+
+
+ + +
+
+
+
+ Last updated open-source workflow systems +

Workflow Systems

+
+
+
+
+
+ + + + + +
+ + +
+

TaskVine

+

+ An execution system for large scale data intensive dynamic workflows. +

+ Python
+ + release/7.14.3
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

Snakemake

+

+ This is the development home of the workflow management system Snakemake. For general information, see +

+ Python
+ + v8.27.1
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

StreamFlow

+

+ Towards Cloud-HPC Continuum +

+ Python
+ + 0.2.0.dev11
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

AiiDA

+

+ A workflow manager for computational science with a strong focus on provenance, performance and extensibility. +

+ Python
+ + AiiDA v2.6.3
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

SmartSim

+

+ Machine learning workflows with HPC applications (Python, C++, C, and Fortran) +

+ Python
+ + 0.8.0
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

DagOnStar

+

+ DAGonStar is a simple Python-based workflow engine that runs jobs on everything from the local machine to distributed virtual HPC clusters hosted i... +

+ Python
+ + v1.0.2
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

Makeflow

+

+ Makeflow is a workflow system for parallel and distributed computing that uses a language very similar to Make. +

+ Make
+ + release/7.14.3
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

Nextflow

+

+ A DSL for data-driven computational pipelines +

+ Groovy
+ + Version 24.12.0-edge
+ 24 Jan 2025 +
+ +
+ +
+ + +
+

Covalent

+

+ Distributed workflows for quantum and HPC +

+ Python
+ + v0.237.0-rc.0
+ 23 Jan 2025 +
+ +
+ +
+ + +
+

Geoweaver

+

+ a lightweight workflow software to easily orchestrate pipelines from Python and shell scripts and preserve history of every execution +

+ JavaScript
+ + v1.8.6
+ 23 Jan 2025 +
+ +
+ +
+ +


+ +
+
+

See all Systems

+
+ +
+
+
+
+
+
+ + +
+
+
+
+ + +
+
+ +
+ Upcoming Community Events +

Events

+ +
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+

See all events...

+
+
+
+
+
+
+ + + + + +
+
+
+
+
+ 0 Open Positions from the Community +

Jobs

+
+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ +

+ +
+ See all Jobs +
+ +
+
+
+
+
+
+
+ + +
+
+
+
+ Since 2021 +

Founding Members

+ +
+ + +
+ + Oak Ridge National Laboratory + +
+ +
+ + University of Chicago + +
+ +
+ + Argonne National Laboratory + +
+ +
+ + University of Hawaii + +
+ +
+ + University of Manchester + +
+ +
+ + University of Notre Dame + +
+ +
+ + Barcelona Supercomputing Center + +
+ +
+ + National Energy Research Scientific Computing Center + +
+ +
+ + Lawrence Berkeley National Laboratory + +
+ +
+ + University of Illinois at Urbana-Champaign + +
+ +
+ + Federal University of Rio de Janeiro + +
+ +
+ + University of California San Diego + +
+ +
+ + University of Innsbruck + +
+ +
+ + Brookhaven National Laboratory + +
+ +
+ + Rutgers University + +
+ +
+ + University of St Andrews + +
+ +
+ + Humboldt University of Berlin + +
+ +
+ + Nvidia + +
+ +
+ + Lawrence Livermore National Laboratory + +
+ +
+ + Seqera Labs + +
+ +
+ + University of Queensland, Australia + +
+ +
+ + University of Freiburg + +
+ +
+ + American Geophysical Union + +
+ +
+ + University of Duisburg-Essen + +
+ +
+ + GE Research + +
+ +
+
+
+
+
+ + + + +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/jobs.html b/jobs.html new file mode 100644 index 0000000000..d78b567f00 --- /dev/null +++ b/jobs.html @@ -0,0 +1,295 @@ + + + + + Jobs - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Jobs +

+
+
+
+
+ +
+
+
+
+ + + + + +
+
+

+ Open positions from the community.
There are currently 0 open positions. +

+ Add an Open Job Position +
+
+ +
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/add.html b/jobs/add.html new file mode 100644 index 0000000000..20e141c59e --- /dev/null +++ b/jobs/add.html @@ -0,0 +1,324 @@ + + + + + Contribute: Jobs - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Contribute: Jobs +

+
+
+
+
+ +
+
+
+
+
+
+ Register open workflow-related positions from the community +

How to Post a Job Opening

+ All Jobs +
+ +
+

+ The Workflows Community Initiative (WCI) provides a common place for posting jobs related to workflows + research and development. Note that WCI does not conduct job interviews or provide references to + candidates. The goal of the jobs posting is to solely promote workflow-related job opennings to the + workflows community. +

+ +

Adding a Job Posting

+

+ At the WCI website, job opennings are described using a Markdown + file. + The preferred way to submit your changes is via creating a pull request with the changes. To this end, + these are the recommended steps for adding a job posting: +

+
    +
  1. Fork the WCI GitHub repository
    2. +
  2. Clone your forked repository: + 
    git clone https://github.com/<your_username>/workflowscommunity.github.io
    +
    3. +
  3. Create a Markdown file under the _jobs/ directory (e.g., + my_institution_position_title.md), and + add the information regarding the job posting (see below how to structure your .md file). +
    4. +
  4. Commit the changes, and create a pull request for the WCI GitHub + repository.
    5. +
  5. The WCI team will then evaluate your pull request, and merge the changes if the job posting information + is properly documented.
    6. +
+

+ Note: If you need to update the job posting, we recommend you to follow the same steps listed + above, except instead of creating a new file you would edit your own file(s). +

+ + +

Creating your Markdown File

+

+ In the WCI website, each job posting is described in a separate Markdown file. Although we do not enforce a strict + convention for the file name, we strongly encourage you to choose a unique and informative file name, such as + my_institution_position_title.md. If two positions have the file name, the newest one will be renamed + to avoid conflicts. +

+

The following example shows the structure of the Markdown file and summarizes the keywords that should be provided: +

+ 
+--- 
+layout: jobs # do not change this line
+title: "Position Title"
+organization: "Institution/Organization Name"
+organization_logo: "URL to institution logo"
+location: "Job Location" # e.g., "Los Angeles, CA, USA" or "Full Remote", etc.
+application_deadline: "Application deadline date" # format: YYYY-MM-DD
+apply_link: "URL to job application"
+employment_type: "Type of employment" # e.g., Full-time, Part-time, Internship, etc.
+---
+            
+Job description using Markdown syntax.         
+
+ +

+ WCI uses GitHub actions to build the job opening pages, which are currently processed at every 12 + hours. +

+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/bsc_exascale_research_engineer/index.html b/jobs/bsc_exascale_research_engineer/index.html new file mode 100644 index 0000000000..b5408e3e7c --- /dev/null +++ b/jobs/bsc_exascale_research_engineer/index.html @@ -0,0 +1,395 @@ + + + + + Exascale Supercomputer Software Container Engineer (RE1) - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Exascale Supercomputer Software Container Engineer (RE1) +

+
+
+
+
+ +
+
+
+
+
+
+ Barcelona Supercomputing Center +

Exascale Supercomputer Software Container Engineer (RE1)

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ Jun 30, 2023 + +
+
+ +    Location
+ Barcelona, Spain + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

About BSC

+ +

The Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 770 staff from 55 countries.

+ +

Look at the BSC experience:

+ + +

Context And Mission

+ +

BSC is looking for a research engineer that contributes to the container support and to an ecosystem targeting RISC-V-based ISA for a European HPC accelerator. The position is funded by a project aiming to build the software infrastructure and toolchain for an FPGA-based emulator for an energy-efficient Exascale system.

+ +

More specifically, the candidate will collaborate with the Workflows and Distributed Computing (WDC) group to validate container images running PyCOMPSs applications (compss.bsc.es). PyCOMPSs is a task-based programming model developed by the WDC group, that aims at easing the development of parallel applications for distributed computing. Between the applications to validate, the candidate will work with machine learning applications (dislib scripts, see dislib.bsc.es) parallelized with COMPSs. In addition, the candidate will support the whole project on its CD/CI infrastructure.

+ +

Key Duties

+ +
    +
  • Validation of COMPSs container images for RISC-V architecture
    • +
  • Validation of COMPSs applications on top of containers for RISC-V
    • +
  • Validate machine learning applications on the RISC-V architecture
    • +
  • Extend containers and the container ecosystem to RISC-V based hardware.
    • +
  • Build and maintain high-performance runtime frameworks, libraries, and services
    • +
+ +

Requirements

+ +

Education

+
    +
  • Master in Computer Science, or related Engineering degree or equivalent level of professional experience.
    • +
+ +

Essential Knowledge and Professional Experience

+
    +
  • Experience with container technologies, such as Docker and orchestration platforms like Kubernetes.
    • +
  • Good knowledge of Linux OS (not necessarily all): +
      +
    • Linux filesystems
      • +
    • Image distribution
      • +
    • Content storage and management
      • +
    • Kernel and container security
      • +
    • Linux containerization
      • +
    +
    • +
+ +

Additional Knowledge and Professional Experience

+
    +
  • Knowledge on parallel and distributed computing
    • +
  • Experience with Continuous Integration/Continuous Deployment frameworks
    • +
  • Agile development and open source development, deployment, and support, including GitHub or equivalent
    • +
  • Open source software committer a plus
    • +
+ +

Competences

+
    +
  • Effective communication, multitasking, and working well on collaborative designs.
    • +
  • Ability to think creatively.
    • +
  • Ability to take initiative, prioritize and work under set deadlines and pressure.
    • +
  • Fluency in English is essential, Spanish is welcome.
    • +
+ +

Conditions

+ +
    +
  • The position will be located at BSC within the Computer Sciences Department
    • +
  • We offer a full-time contract, a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, tickets restaurant, private health insurance, fully support to the relocation procedures
    • +
  • Duration: Temporary - 31/12/2023 renewable
    • +
  • Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona
    • +
  • Starting date: ASAP
    • +
+ +

Applications procedure and process

+ +

All applications must be made through BSC website and contain:

+ +
    +
  • A full CV in English including contact details
    • +
  • A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be considered
    • +
+ +

In accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.

+ +

The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.

+ +

At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.

+ +

For more information follow this link.

+ +

Deadline

+ +

The vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.

+ +

OTM-R principles for selection processes

+ +

BSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.

+ +

BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.

+ +

For more information follow this link.

+ +

This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/bsc_postdoc_colmena/index.html b/jobs/bsc_postdoc_colmena/index.html new file mode 100644 index 0000000000..95310d5227 --- /dev/null +++ b/jobs/bsc_postdoc_colmena/index.html @@ -0,0 +1,392 @@ + + + + + Post-Doc - COLMENA Project (R2) - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Post-Doc - COLMENA Project (R2) +

+
+
+
+
+ +
+
+
+
+
+
+ Barcelona Supercomputing Center +

Post-Doc - COLMENA Project (R2)

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Barcelona, Spain + +
+
+ +   Employment Type
+ Postdoc + +
+
+
+ +
+

About BSC

+ +

The Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 800 staff from 55 countries.

+ +

Look at the BSC experience:

+ + +

We are particularly interested for this role in the strengths and lived experiences of women and underrepresented groups to help us avoid perpetuating biases and oversights in science and IT research.

+ +

Context And Mission

+ +

The Computer Sciences (CS) department of the Barcelona Supercomputing Center aims to carry out research and development to influence the way computing machines are built, programmed and used. The Workflows and Distributed Computing group at the Barcelona Supercomputing Center aims to carry out research on programming models for distributed computing. More specifically, this group will be contributing to the COLMENA project (Spanish funded project) which contributes to the definition of next-generation computing and data technologies by proposing a framework to ease the programming, deployment and maintenance of hyper-distributed applications on the device-edge-cloud Continuum.The group will have a significant effort devoted to the definition of the COLMENA programming model and its software platform.

+ +

The new programming model environment will be inspired on organic colonies: collections of autonomous individuals with heterogeneous characteristics that cooperate forming different social organizations. In this new approach, each smart device (IoT sensor/actuators, network access point/router or Edge/Cloud server) composing a cyber-infrastructure is considered as an Autonomous ageNT (ANT) aware of its own IT capabilities (data processing power, storage capacity, sensors and actuators equipped, available network interfaces, etc.) and context (geo-location, owner, etc.). In such an environment, services will be described as a society with different roles. Each role is defined by behaviour (program logic), the necessary software dependencies and the hardware requirements to play it. The role composition of such a society will be defined by a set of rules that indicate the number of players of each role. ANTs autonomously pick one or more roles to play according to its characteristics, the requirements of each role and the current role distribution. Upon their decision, they contextualize themselves downloading the necessary software and start the execution.

+ +

At any point, the infrastructure may change; a new ANT can join in or leave the Colony, the service may be in a peak or valley workload moment, or a network service may be disrupted. To rapidly adapt to these changes, ANTs constantly revisit their roles and consider any possible reconfiguration that may improve the service. The goal of the project is to develop a platform to create, deploy and operate services on the device-edge-cloud continuum. A programming framework capable of reducing the complexity of programming swarms. The “roles” will be programmable through simple, high-level programming interfaces, where no low level details are exposed. The project will also develop the necessary libraries and layers to support such an interface.

+ +

For this research, the group is looking for an postdoc to contribute in this research, with the design and implementation of the COLMENA programming model and software platform. The job also includes active participation in the project, attending project meetings, collaborating with partners and writing deliverables.

+ +

The financing entities are the Ministry of Economic Affairs and Digital Transformation and the European Union-NextGenerationEU, within the framework of the PRTR and the MRR, all in accordance with what is established in this regard, in particular, in accordance with the provisions of article 34.2 of Regulation (EU) 2021/241 of the European Parliament and of the Council, of February 12, 2021.

+ +

Key Duties

+ +
    +
  • Design and development of the COLMENA programming model
    • +
  • Design and development of the COLMENA software platform
    • +
  • Development of tests to check the extensions with the COLMENA test infrastructure
    • +
  • Contribution to COLMENA documentation to illustrates how to use the programming model and platform
    • +
  • The candidate will work closely with other research members on the team of the Workflows and Distributed Computing group
    • +
+ +

Requirements

+ +

Education

+
    +
  • PhD on Computer science degree or similar
    • +
+ +

Essential Knowledge and Professional Experience

+
    +
  • Previous experience in runtime systems and system software
    • +
  • Knowledge of Distributed Computing
    • +
  • Good programming skills in Java and C, and/or Python
    • +
+ +

Additional Knowledge and Professional Experience

+
    +
  • Previous experience in distributed programming models
    • +
  • Experience in container management platforms (Docker, Kubernetes, …)
    • +
+ +

Competences

+
    +
  • Fluency in spoken and written English, while fluency in other European languages will be also valued
    • +
+ +

Conditions

+ +
    +
  • The position will be located at BSC within the Computer Sciences Department
    • +
  • We offer a full-time contract (37.5h/week), a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, restaurant tickets, private health insurance, support to the relocation procedures
    • +
  • Duration: Open-ended contract due to technical and scientific activities linked to the project and budget duration
    • +
  • Holidays: 23 paid vacation days plus 24th and 31st of December per our collective agreement
    • +
  • Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona
    • +
  • Starting date: April 2023
    • +
+ +

Applications procedure and process

+ +

All applications must be made through BSC website and contain:

+ +
    +
  • A full CV in English including contact details
    • +
  • A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be considered
    • +
+ +

In accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.

+ +

The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.

+ +

At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.

+ +

For more information follow this link.

+ +

Deadline

+ +

The vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.

+ +

OTM-R principles for selection processes

+ +

BSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.

+ +

BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.

+ +

For more information follow this link.

+ +

This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/bsc_programming_model_developer_colmena/index.html b/jobs/bsc_programming_model_developer_colmena/index.html new file mode 100644 index 0000000000..8a570887f5 --- /dev/null +++ b/jobs/bsc_programming_model_developer_colmena/index.html @@ -0,0 +1,392 @@ + + + + + Programming model developer - COLMENA Project (RE1) - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Programming model developer - COLMENA Project (RE1) +

+
+
+
+
+ +
+
+
+
+
+
+ Barcelona Supercomputing Center +

Programming model developer - COLMENA Project (RE1)

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Barcelona, Spain + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

About BSC

+ +

The Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 800 staff from 55 countries.

+ +

Look at the BSC experience:

+ + +

We are particularly interested for this role in the strengths and lived experiences of women and underrepresented groups to help us avoid perpetuating biases and oversights in science and IT research.

+ +

Context And Mission

+ +

The Computer Sciences (CS) department of the Barcelona Supercomputing Center aims to carry out research and development to influence the way computing machines are built, programmed and used. The Workflows and Distributed Computing group at the Barcelona Supercomputing Center aims to carry out research on programming models for distributed computing. More specifically, this group will be contributing to the COLMENA project (Spanish funded project) which contributes to the definition of next-generation computing and data technologies by proposing a framework to ease the programming, deployment and maintenance of hyper-distributed applications on the device-edge-cloud Continuum.The group will have a significant effort devoted to the definition of the COLMENA programming model and its software platform.

+ +

The new programming model environment will be inspired on organic colonies: collections of autonomous individuals with heterogeneous characteristics that cooperate forming different social organizations. In this new approach, each smart device (IoT sensor/actuators, network access point/router or Edge/Cloud server) composing a cyber-infrastructure is considered as an Autonomous ageNT (ANT) aware of its own IT capabilities (data processing power, storage capacity, sensors and actuators equipped, available network interfaces, etc.) and context (geo-location, owner, etc.). In such an environment, services will be described as a society with different roles. Each role is defined by behaviour (program logic), the necessary software dependencies and the hardware requirements to play it. The role composition of such a society will be defined by a set of rules that indicate the number of players of each role. ANTs autonomously pick one or more roles to play according to its characteristics, the requirements of each role and the current role distribution. Upon their decision, they contextualize themselves downloading the necessary software and start the execution.

+ +

At any point, the infrastructure may change; a new ANT can join in or leave the Colony, the service may be in a peak or valley workload moment, or a network service may be disrupted. To rapidly adapt to these changes, ANTs constantly revisit their roles and consider any possible reconfiguration that may improve the service. The goal of the project is to develop a platform to create, deploy and operate services on the device-edge-cloud continuum. A programming framework capable of reducing the complexity of programming swarms. The “roles” will be programmable through simple, high-level programming interfaces, where no low level details are exposed. The project will also develop the necessary libraries and layers to support such an interface.

+ +

For this research, the group is looking for an engineer to design and implement the COLMENA programming model and software platform. The job also includes active participation in the project, attending project meetings, collaborating with partners and writing deliverables.

+ +

The financing entities are the Ministry of Economic Affairs and Digital Transformation and the European Union-NextGenerationEU, within the framework of the PRTR and the MRR, all in accordance with what is established in this regard, in particular, in accordance with the provisions of article 34.2 of Regulation (EU) 2021/241 of the European Parliament and of the Council, of February 12, 2021.

+ +

Key Duties

+ +
    +
  • Design and development of the COLMENA programming model
    • +
  • Design and development of the COLMENA software platform
    • +
  • Supervision of the work performed by other partners in the project
    • +
  • Contribution to the elaboration of project reports
    • +
  • The candidate will work closely with other research members on the team of the Workflows and Distributed Computing group
    • +
+ +

Requirements

+ +

Education

+
    +
  • Computer science degree or similar, or a student finalizing the studies
    • +
+ +

Essential Knowledge and Professional Experience

+
    +
  • Previous experience in runtime systems and system software
    • +
  • Knowledge of Distributed Computing
    • +
  • Good programming skills in Java and C, and/or Python
    • +
+ +

Additional Knowledge and Professional Experience

+
    +
  • Previous experience in distributed programming models
    • +
  • Experience in container management platforms (Docker, Kubernetes, …)
    • +
+ +

Competences

+
    +
  • Fluency in spoken and written English, while fluency in other European languages will be also valued
    • +
+ +

Conditions

+ +
    +
  • The position will be located at BSC within the Computer Sciences Department
    • +
  • We offer a full-time contract (37.5h/week), a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, restaurant tickets, private health insurance, support to the relocation procedures
    • +
  • Duration: Open-ended contract due to technical and scientific activities linked to the project and budget duration
    • +
  • Holidays: 23 paid vacation days plus 24th and 31st of December per our collective agreement
    • +
  • Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona
    • +
  • Starting date: April 2023
    • +
+ +

Applications procedure and process

+ +

All applications must be made through BSC website and contain:

+ +
    +
  • A full CV in English including contact details
    • +
  • A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be considered
    • +
+ +

In accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.

+ +

The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.

+ +

At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.

+ +

For more information follow this link.

+ +

Deadline

+ +

The vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.

+ +

OTM-R principles for selection processes

+ +

BSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.

+ +

BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.

+ +

For more information follow this link.

+ +

This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/missouri_postdoctoral_bioinformatics/index.html b/jobs/missouri_postdoctoral_bioinformatics/index.html new file mode 100644 index 0000000000..5aeca87549 --- /dev/null +++ b/jobs/missouri_postdoctoral_bioinformatics/index.html @@ -0,0 +1,356 @@ + + + + + Postdoctoral Fellow - Bioinformatics & Computational Biology - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Postdoctoral Fellow - Bioinformatics & Computational Biology +

+
+
+
+
+ +
+
+
+
+
+
+ The University of Missouri +

Postdoctoral Fellow - Bioinformatics & Computational Biology

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Columbia, MO, USA + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

Job Description

+

Postdoctoral Fellow - Bioinformatics & Computational Biology, position in Christopher S. Bond Life Science Center, University of Missouri-Columbia.

+ +
    +
  1. Analyze diverse types of biological data, including next generation sequencing (NGS) such as RNA-seq, single cell RNA-seq, and others, multiomics data integration and microbiome data. Prepare and publish manuscripts and reports.
    2. +
  2. Develop machine learning and deep learning methods and algorithms for high-throughput biological phenotypic data, in silico hypothesis generation and predictions. Develop and maintain standalone software and web services in bioinformatics and computational biology such as IMPRes, G2PDeep and others.
    3. +
  3. Contribute towards web-based SoyKB and KBCommons framework and new tools development.
    4. +
  4. Build automatic workflow or pipelines for specific biological problems using HPC and cloud storage.
    5. +
  5. Assist in grant and proposal writing.
    6. +
  6. Coordinate or participate in collaborative bioinformatics research and training workshop and graduate course development.
    7. +
  7. Manage lab resources and train, supervise and review work of other lab members and students in the lab.
    8. +
+ +

Qualifications

+ +

Minimum Qualification

+ +
    +
  • Applicant must have a PhD degree in Bioinformatics, Computer Science or related field.
    • +
+ +

Candidates will be evaluated on:

+ +
    +
  • Experience in management and supervision of lab members and graduate and undergraduate students.
    • +
  • In-depth capabilities in understanding, implementing and developing bioinformatics data analytics tools, computational methods and algorithms, databases, web-development, multiomics data integration, modern machine learning / deep learning methods and statistics inferences algorithms and related tools.
    • +
  • Excellence in R, Python, Perl, JAVA, SQL, MongoDB and related web development in Unix/Linux environment.
    • +
  • Working experience in analysis of high-throughput bulk and single cell genomics, multiomics and microbiome data.
    • +
  • Knowledge of biological databases and their application for plant and biomedical sciences. In-depth knowledge in bioinformatics and systems biology algorithms.
    • +
  • Experiences with workflow management systems like Pegasus, Snakemake etc., High Performance Computers, Cloud storage and GPU programming.
    • +
  • Familiarity with use of Amazon web services (AWS) resources.
    • +
  • In-depth experience of bioinformatics problem solving, tools design and development process.
    • +
  • Proactive team player with excellent communication and presentation skills.
    • +
  • Application Materials
    • +
  • Complete online application; submit CV, 3 Recommendation letters, Publications 2-3
    • +
+ +

Benefit Eligibility

+ +

This position is eligible for University benefits. The University offers a comprehensive benefits package, including medical, dental and vision plans, retirement, and educational fee discounts. For additional information on University benefits, please visit the Faculty & Staff Benefits website at http://www.umsystem.edu/totalrewards/benefits

+ +

Diversity Commitment

+ +

The University of Missouri is fully committed to achieving the goal of a diverse and inclusive academic community of faculty, staff and students. We seek individuals who are committed to this goal and our core campus values of respect, responsibility, discovery and excellence.

+ +

Equal Employment Opportunity

+ +

Equal Opportunity is and shall be provided for all employees and applicants for employment on the basis of their demonstrated ability and competence without unlawful discrimination on the basis of their race, color, national origin, ancestry, religion, sex, pregnancy, sexual orientation, gender identity, gender expression, age, disability, protected veteran status, or any other status protected by applicable state or federal law. This policy shall not be interpreted in such a manner as to violate the legal rights of religious organizations or the recruiting rights of military organizations associated with the Armed Forces or the Department of Homeland Security of the United States of America. For more information, call the Vice Chancellor of Human Resource Services/Affirmative Action officer at 573-882-4256.

+ +

To request ADA accommodations, please call the Disability Inclusion and ADA Compliance Manager at 573-884-7278.

+ +

EEO IS THE LAW

+ +

To read more about Equal Employment Opportunity (EEO) please use the following links:

+ + + +

Columbia Missouri Information

+ +

Columbia, Mo., is known as an ideal college town, combining small-town comforts, community spirit and low cost of living with big-city culture, activities and resources. Home to nationally renowned public schools and other colleges and educational centers, Columbia is packed with restaurants and entertainment venues and hosts more than a dozen annual cultural festivals.

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/nrel_researcher/index.html b/jobs/nrel_researcher/index.html new file mode 100644 index 0000000000..f631e041a2 --- /dev/null +++ b/jobs/nrel_researcher/index.html @@ -0,0 +1,376 @@ + + + + + Researcher – Scalable, Accelerated Applications and Frameworks for Advanced Computing - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Researcher – Scalable, Accelerated Applications and Frameworks for Advanced Computing +

+
+
+
+
+ +
+
+
+
+
+
+ National Renewable Energy Laboratory +

Researcher – Scalable, Accelerated Applications and Frameworks for Advanced Computing

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Golden, CO, USA + +
+
+ +   Employment Type
+ Limited Term (Fixed Term) + +
+
+
+ +
+

Posting Title: Researcher – Scalable, Accelerated Applications and Frameworks for Advanced Computing

+ +

Location: CO - Golden

+ +

Position Type: Limited Term (Fixed Term)

+ +

Hours Per Week: 40

+ +

COVID-19 Safety Protocols

+

Employment at NREL is contingent upon your compliance with all NREL and U.S. Department of Energy (DOE) safety protocols and mitigation efforts directed at the COVID-19 pandemic.

+ +

Working at NREL

+

The National Renewable Energy Laboratory (NREL), located at the foothills of the Rocky Mountains in Golden, Colorado is the nation’s primary laboratory for research and development of renewable energy and energy efficiency technologies. +From day one at NREL, you’ll connect with coworkers driven by the same mission to save the planet. By joining an organization that values a supportive, inclusive, and flexible work environment, you’ll have the opportunity to engage through our eight employee resource groups, numerous employee-driven clubs, and learning and professional development classes.

+ +

NREL supports inclusive, diverse, and unbiased hiring practices that promote creativity and innovation. By collaborating with organizations that focus on diverse talent pools, reaching out to underrepresented demographics, and providing an inclusive application and interview process, our Talent Acquisition team aims to hear all voices equally. We strive to attract a highly diverse workforce and create a culture where every employee feels welcomed and respected and they can be their authentic selves.

+ +

Our planet needs us! Learn about NREL’s critical objectives, and see how NREL is focused on saving the planet.

+ +

Note: Research suggests that potential job seekers may self-select out of opportunities if they don’t meet 100% of the job requirements. We encourage anyone who is interested in this opportunity to apply. We seek dedicated people who believe they have the skills and ambition to succeed at NREL to apply for this role.

+ +

Job Description

+

The Complex Systems Simulation and Optimization Group in the NREL Computational Science Center has an opening for a full-time professional with competencies in advanced computing simulation, applied mathematics, optimization, machine learning and/or quantum computing research who will help to enable the effective utilization of scalable accelerated algorithms, applications, software, hardware, and/or workflows on advanced computing systems in support of clean energy research. Supported research projects may come from a variety of scientific domains and backgrounds but frequently include topics from energy systems integration, wind energy, solar energy, batteries, vehicle efficiency and electrification, electrification, power systems, buildings, chemistry, material science, fluid dynamics, structural analysis, engineering analysis, optimization, machine learning, resource analysis, durability, and resilience. We are particularly interested in a researcher with a background in one of the following: enabling scientific discovery, engineering innovation and credible energy analysis relying on advanced, parallel, scalable workflows, frameworks, simulations, optimization, machine learning and artificial intelligence frameworks and workflow deployment in high performance computing (HPC) or cloud environments. We are looking for a dynamic, motivated researcher with a strong technical background and an interest in the mission of NREL.

+ +

The successful candidate will collaborate with partners including NREL staff and researchers, other national laboratory staff, university researchers, and corporate partners on efforts to effectively carry out research and development from the atomic scale to the national scale utilizing NREL’s advanced computing capabilities on- and off-premises. They will be part of small teams identifying, designing, deploying, and supporting solutions for research and development on advanced, scalable, accelerated computing hardware, which may require consideration of parallel application and workflow deployment and support, cloud architectures, hardware and library performance, utilization of machine learning, and/or advanced math and programming skills.

+ +

Job duties and responsibilities of the position include:

+ +
    +
  • Operations and Research Support: Identifying, configuring, debugging, deploying, and supporting applications and workflows on scalable, accelerated advanced computing hardware and cloud architectures centered on simulations, optimization, and machine learning.
    • +
  • Application collaboration: Collaborate with NREL and research partners to identify, design, implement, and carry out execution of applications and workflows in clean energy research.
    • +
  • Research: Carry out computational and domain research, developing and using advanced algorithms, mathematics, modeling, simulation, optimization, and machine learning for clean energy systems research.
    • +
  • Community development: engage with and educate the clean energy research community through consultations, meetups, and groups to identify opportunities for ML and AI to accelerate research.
    • +
  • Evaluate and track the state of simulation, optimization, machine learning and artificial intelligence algorithms, frameworks, and workflows and their use of advanced, scalable, accelerated, and emerging computing architectures on premise and in the cloud.
    • +
  • Publications and presentations: Author, present, and assist in the preparation of technical papers, reports, and conference proceedings on topics.
    • +
+ +

Basic Qualifications

+ +

Relevant PhD . Or, relevant Master’s Degree and 3 or more years of experience . Or, relevant Bachelor’s Degree and 5 or more years of experience . Demonstrates complete understanding and wide application of scientific technical procedures, principles, theories and concepts in the field. General knowledge of other related disciplines. Demonstrates leadership in one or more areas of team, task or project lead responsibilities. Demonstrated experience in management of projects. Very good technical writing, interpersonal and communication skills.

+ +

*Must meet educational requirements prior to employment start date.

+ +

Additional Required Qualifications

+ +

Preferred Qualifications

+ +
    +
  • An interest in renewable energy, energy efficiency and supporting technologies; wind, solar, vehicles, biomass, hydrogen, buildings, batteries, and electric grid technologies.
    • +
  • Ability to quickly learn new programming languages and frameworks and adapt to changing research demands and simulation scales in a fast-paced scientific, engineering and analysis environment.
    • +
  • Demonstrated experience developing, programming, and/or utilizing algorithms and software for advanced, scalable, accelerated Linux computing systems.
    • +
  • Interest in simulation, optimization, machine learning and/or energy analysis on advanced computing systems and potentially quantum computers.
    • +
  • Background and experience in one or more of the following would be a plus: +
      +
    • Background in scalable accelerated applications.
      • +
    • Software engineering expertise coding and testing patterns, version control and CI/CD, engineering software platforms and large-scale simulation, learning and data workflows especially using open-source tools.
      • +
    • Managing software dependencies in HPC and Cloud environments with commons tools such as Modules, Conda, Spack, and containerization.
      • +
    • Developing workflows, including job scheduler integration, data management of big datasets, data movement, and data availability/sharing with remote users and systems.
      • +
    • Machine learning and artificial intelligence on scalable, accelerated computing systems.
      • +
    • Enabling user communities through documentation of best practices and community outreach.
      • +
    +
    • +
+ +

Annual Salary Range (based on full-time 40 hours per week)

+
    +
  • Job Profile: Researcher III / Annual Salary Range: $77,600 - $139,700
    • +
  • Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600
    • +
  • Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600
    • +
  • Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600
    • +
+ +

NREL takes into consideration a candidate’s education, training, and experience, expected quality and quantity of work, required travel (if any), external market and internal value, including seniority and merit systems, and internal pay alignment when determining the salary level for potential new employees. In compliance with the Colorado Equal Pay for Equal Work Act, a potential new employee’s salary history will not be used in compensation decisions.

+ +

Benefits Summary

+

Benefits include medical, dental, and vision insurance; short- and long-term disability insurance; pension benefits; 403(b) Employee Savings Plan with employer match; life and accidental death and dismemberment (AD&D) insurance; personal time off (PTO) and sick leave; paid holidays; and tuition reimbursement. NREL employees may be eligible for, but are not guaranteed, performance-, merit-, and achievement- based awards that include a monetary component. Some positions may be eligible for relocation expense reimbursement. Limited-term positions are not eligible for long-term disability or tuition reimbursement.

+ +

* Based on eligibility rules

+ +

Submission Guidelines

+

Please note that in order to be considered an applicant for any position at NREL you must submit an application form for each position for which you believe you are qualified. Applications are not kept on file for future positions. Please include a cover letter and resume with each position application.

+ +

EEO Policy

+

NREL is an Equal Opportunity/Affirmative Action Employer. All qualified applicants will receive consideration for employment without regard basis of age (40 and over), color, disability, gender identity, genetic information, marital status, military or veteran status, national origin/ancestry, race, religion, creed, sex (including pregnancy, childbirth, breastfeeding), sexual orientation, and any other applicable status protected by federal, state, or local laws.

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/ornl_lead_software_engineer/index.html b/jobs/ornl_lead_software_engineer/index.html new file mode 100644 index 0000000000..4263520306 --- /dev/null +++ b/jobs/ornl_lead_software_engineer/index.html @@ -0,0 +1,335 @@ + + + + + Lead Full Stack Software Developer - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Lead Full Stack Software Developer +

+
+
+
+
+ +
+
+
+
+
+
+ Oak Ridge National Laboratory +

Lead Full Stack Software Developer

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Oak Ridge, TN, USA + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

Overview

+ +

The Data Lifecycle and Scalable Workflows Group at Oak Ridge National Laboratory (ORNL) is seeking a Full Stack Software Developer to add to our team. In this position, you will provide products and services for scientific data management at leadership-class scale. The ideal candidate is a full-stack developer that is comfortable working across multiple technologies. Prior experience with C/C++/Python, data-heavy applications, distributed systems, and microservices is preferred but not required. To be successful in this role, you must be team oriented, well-versed in computer science fundamentals, and demonstrate a drive for self-learning. Our team has a diverse skill set and are natural problem solvers who share a passion about supporting scientists and enabling new discoveries for humanity, while working on some of the most challenging problems with cutting-edge technologies.

+ +

This position is part of the Advanced Technologies Section within the National Center for Computational Sciences (NCCS) Division at ORNL. NCCS has a deep legacy in High Performance Computing (HPC) operating leadership-class systems, deploying the world’s first exascale system (Frontier) and largest parallel file system. Data is at the heart of science and workflows reduce a scientist’s cognitive overhead and increase science reproducibility - the Data Lifecycle and Scalable Workflows Group tackles these challenges for supercomputing facilities.

+ +

Major Duties and Responsibilities

+ +
    +
  • Produce software applications and science-based systems to manage big data
    • +
  • Collaborate with other research and technical professionals to develop new capabilities that execute on ORNL’s leading data and compute infrastructures
    • +
  • Support multiple technology projects at the same time
    • +
  • Develop, test, and deploy distributed high-throughput services
    • +
  • Optimize software for speed and scalability
    • +
  • Evaluate and test software that might be deployed in the future
    • +
+ +

Basic Qualifications

+ +
    +
  • Bachelor’s degree in Computer Science, Software Engineering, or related field
    • +
  • 8+ years of software development experience (an equivalent combination of education and experience may be considered)
    • +
  • Proficiency with any of the following languages: C/C++, Go, or Python
    • +
  • Proficiency with any front-end languages (e.g., Javascript, AngularJS, React)
    • +
  • Experience with containers (e.g., Docker) and container orchestration (e.g., Kubernetes)
    • +
  • Experience with version control systems (e.g., Git)
    • +
+ +

Desired Qualifications

+ +
    +
  • 10+ years of software development
    • +
  • Experience with back end, middleware, and front-end
    • +
  • Experience with CI/CD practices, test methodologies
    • +
  • Knowledge of Agile development methodologies and tools
    • +
  • Familiarity with open-source development tools and techniques
    • +
  • Evaluating/integrating COTS/open-source software where appropriate (we don’t have time to reinvent the wheel)
    • +
  • Highly skilled in people management/development, team oriented, collaborative
    • +
  • Strong problem-solving skills
    • +
  • Ability to think critically
    • +
  • Excellent written and oral communication skills
    • +
+ + +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/university_innsbruck_phd/index.html b/jobs/university_innsbruck_phd/index.html new file mode 100644 index 0000000000..5f149749d7 --- /dev/null +++ b/jobs/university_innsbruck_phd/index.html @@ -0,0 +1,383 @@ + + + + + PhD Positions in Cloud-Edge Computing - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ PhD Positions in Cloud-Edge Computing +

+
+
+
+
+ +
+
+
+
+
+
+ University of Innsbruck +

PhD Positions in Cloud-Edge Computing

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Innsbruck, Austria + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

About the job

+ +

The Institute of Computer Science at the University of Innsbruck, Austria seeks for excellent PhD students to carry out research in Cloud and Edge computing.

+ +

Your profile

+ +

You are enthusiastic about developing and investigating innovative research ideas and systems within the discipline of distributed systems? You have a master’s or equivalent degree in computer science with excellent performance? You are a highly skilled Java programmer? You have good knowledge in programming with scripting languages? You have a strong background in distributed systems, Cloud computing and virtualization techniques? You stand out from your peers because of strong commitment and independent work? You are a team player and communicative (excellent oral and written English skills, good ability to write scientific publications)?

+ +

Our offer:

+ +

Successful candidates will join a dynamic, international and world-wide highly regarded research team. As fully funded PhD students they will investigate novel Cloud and Edge techniques that are built based on Java, modern virtualization methods and serverless technologies. The particular research topics of interest include

+ +
    +
  • application development
    • +
  • resilient and scalable runtime systems
    • +
  • robust, secure and service agnostic resource management,
    • +
  • data and work distribution,
    • +
  • scheduling and optimization
    • +
  • serverless architectures for distributed applications
    • +
  • AI-enabled cloud-edge framework and cognitive services
    • +
  • dynamic allocation of cloud services,
    • +
  • automatic discovery and composition of services,
    • +
  • orchestration and usage of services, and
    • +
  • programming for Cloud and Edge infrastructures.
    • +
+ +

The research of these PhD positions will be conducted as part of the APOLLO (application orchestration and runtime framework for leveraging the edge-cloud continuum - https://apollowf.github.io) system. Our PhD students are given the opportunity to work with some of the most advanced Cloud, Fog and Edge infrastructures in Europe and gain interdisciplinary expertise by participating in national and international (EU funded Horizon Europe) projects. Note that the working and study language as well as the entire PhD course and research program are held in English only. There is no need to learn German for these positions.

+ +

Required Skills:

+ +
    +
  • Java (expert programmer)
    • +
  • Docker
    • +
  • git and GitHub
    • +
  • experience with cloud platforms, e.g. AWS
    • +
+ +

Preferred Qualifications:

+ +
    +
  • Eclipse VertX
    • +
  • google guice
    • +
  • JUnit
    • +
  • Gradle
    • +
  • scripting language (e.g. python or node/typescript)
    • +
  • TerraForm
    • +
  • Serverless (FaaS) platform
    • +
  • edge and IoT computing infrastructures
    • +
  • Experience with ML/RL/DL
    • +
  • event-driven systems
    • +
+ +

The University of Innsbruck (UIBK):

+ +

Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment. We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/fog/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralized cloud to the edge and from network and computing infrastructure up to the application layer.

+ +

Innsbruck and its Environment:

+ +

The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.

+ +

Your application:

+ +

Candidates should submit their application as soon as possible.

+ +

Application documents:

+ +
    +
  • Motivation letter (Why does your expertise and vision fit the profile of the open PhD position? Refer to all required and preferred skills)
    • +
  • Full CV including at least 2 references
    • +
  • Copy of BSc and MSc degrees
    • +
  • Transcripts for all study programs
    • +
  • If available provide TOEFL and GRE test results
    • +
+ +

All documents must be submitted in English. The documents must be merged into a single zip file and sent to thomas.fahringer@uibk.ac.at (subject line: Full-time PhD Position in Cloud and Edge computing). For additional files such as theses and publications please add a link to a cloud repository and make it accessible. The candidate will receive an e-mail confirming receipt of the application.

+ +

Application Process and Interview:

+ +
    +
  • Interviews will take place in stages as soon as possible, perhaps via zoom.
    • +
  • Applicants are encouraged to apply immediately as the position will be filled upon finding the right candidate.
    • +
  • We reserve the right to hold applications on file for potential future job openings.
    • +
+ +

Please direct questions to:

+ +

Prof. Dr. Thomas Fahringer
+Institute of Computer Science, University of Innsbruck
+Technikerstr. 21a, A-6020 Innsbruck, Austria
+Email: Thomas.Fahringer@uibk.ac.at
+URL: https://dps.uibk.ac.at

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/university_innsbruck_phd_cloud_edge/index.html b/jobs/university_innsbruck_phd_cloud_edge/index.html new file mode 100644 index 0000000000..7cf2071f7e --- /dev/null +++ b/jobs/university_innsbruck_phd_cloud_edge/index.html @@ -0,0 +1,388 @@ + + + + + PhD Positions in Cloud-Edge Computing - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ PhD Positions in Cloud-Edge Computing +

+
+
+
+
+ +
+
+
+
+
+
+ University of Innsbruck +

PhD Positions in Cloud-Edge Computing

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ Feb 28, 2024 + +
+
+ +    Location
+ Innsbruck, Austria + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

About the job

+ +

The Institute of Computer Science at the University of Innsbruck, Austria seeks for excellent PhD students to carry out research in Cloud and Edge computing.

+ +

Your profile

+ +

You are enthusiastic about developing and investigating innovative research ideas and systems within the discipline of distributed systems? You have a master’s or equivalent degree in computer science with excellent performance? You are a highly skilled Java programmer? You have good knowledge in programming with scripting languages? You have a strong background in distributed systems, Cloud computing and virtualization techniques? You stand out from your peers because of strong commitment and independent work? You are a team player and communicative (excellent oral and written English skills, good ability to write scientific publications)?

+ +

Required Skills:

+ +
    +
  • Java (expert programmer)
    • +
  • Docker
    • +
  • git and GitHub
    • +
  • experience with cloud platforms, e.g. AWS
    • +
+ +

Preferred Qualifications:

+ +
    +
  • Eclipse VertX
    • +
  • Google Guice
    • +
  • JUnit
    • +
  • Gradle
    • +
  • scripting language (e.g. python or node/typescript)
    • +
  • TerraForm
    • +
  • Serverless (FaaS) platform
    • +
  • edge and IoT computing infrastructures
    • +
  • Experience with ML/RL/DL
    • +
  • event-driven systems
    • +
+ +

English language skills:

+ +

If you apply for a PhD study in computer science at UIBK, you must prove English language skills at level B2 of the Common European Framework of Reference for Languages (CEFR) at the time of application. For more information refer to this document (search for “Language of instruction English “)

+ +

Our offer:

+ +

Successful candidates will join a dynamic, international and world-wide highly regarded research team. As fully funded PhD students they will investigate novel Cloud and Edge techniques that are built based on Java and modern virtualization methods. The particular research topics of interest include

+ +
    +
  • robust, secure and service agnostic resource management,
    • +
  • data and work distribution,
    • +
  • serverless architectures for distributed applications
    • +
  • AI-enabled cloud-edge framework and cognitive services
    • +
  • dynamic allocation of cloud services,
    • +
  • automatic discovery and composition of services,
    • +
  • orchestration and usage of services,
    • +
  • scheduling and optimization,
    • +
  • resilient and secure runtime environments,
    • +
  • application development environments, and
    • +
  • programming +for Cloud and Edge infrastructures.
    • +
+ +

The research of these PhD positions will be conducted as part of the APOLLO (application orchestration and runtime framework for leveraging the edge-cloud continuum). Our PhD students are given the opportunity to work with some of the most advanced Cloud and Edge infrastructures in Europe and gain interdisciplinary expertise by participating in national and international (EU funded H2020) projects. Note that the working and study language as well as the entire PhD course and research program are held in English only. There is no need to learn German for these positions.

+ +

The University of Innsbruck (UIBK):

+ +

Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment (https://apollowf.github.io). We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralized cloud to the edge and from network and computing infrastructure up to the application layer.

+ +

Innsbruck and its Environment:

+ +

The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.

+ +

Your application:

+ +

Candidates should submit their application as soon as possible.

+ +

Application documents:

+ +
    +
  • Motivation letter (Why does your expertise and vision fit the profile of the open PhD position?)
    • +
  • Full CV including at least 2 references
    • +
  • Copy of BSc and MSc degrees
    • +
  • Transcripts for all study programs
    • +
  • If available provide TOEFL and GRE test result
    • +
+ +

All documents must be submitted in English. The documents must be merged into a single PDF file and sent to thomas.fahringer@uibk.ac.at (subject line: Full-time PhD Position in Cloud computing). For additional files such as theses and publications please add a link in the submitted pdf to a cloud repository and make it accessible. The candidate will receive an e-mail confirming receipt of the application.

+ +

Application Process and Interview:

+ +
    +
  • Interviews will take place in stages as soon as possible, perhaps via Skype.
    • +
  • Applicants are encouraged to apply immediately as the position will be filled upon finding the right candidate.
    • +
  • We reserve the right to hold applications on file for potential future job openings.
    • +
+ +

Please direct questions to:

+ +

Prof. Dr. Thomas Fahringer
+Institute of Computer Science, University of Innsbruck
+Technikerstr. 21a, A-6020 Innsbruck, Austria
+Email: Thomas.Fahringer@uibk.ac.at
+URL: https://dps.uibk.ac.at

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/jobs/university_innsbruck_postdoctoral_researcher/index.html b/jobs/university_innsbruck_postdoctoral_researcher/index.html new file mode 100644 index 0000000000..84684aee89 --- /dev/null +++ b/jobs/university_innsbruck_postdoctoral_researcher/index.html @@ -0,0 +1,380 @@ + + + + + Postdoctoral Research and Teaching Position in the field of Cloud-Edge Computing - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Postdoctoral Research and Teaching Position in the field of Cloud-Edge Computing +

+
+
+
+
+ +
+
+
+
+
+
+ University of Innsbruck +

Postdoctoral Research and Teaching Position in the field of Cloud-Edge Computing

+ + Apply Now + +
+ +
+
+
+ +   Application Deadline
+ May 31, 2023 + +
+
+ +    Location
+ Innsbruck, Austria + +
+
+ +   Employment Type
+ Full-time + +
+
+
+ +
+

About the job

+ +

The Institute of Computer Science at the University of Innsbruck, Austria, invites applications for a POSTDOCTORAL RESEARCH AND TEACHING POSITION IN THE FIELD OF CLOUD-EDGE COMPUTING.

+ +

This position will start on February 1, 2023 or as early as possible thereafter and it will run for 6 years.

+ +

Candidates with good background in distributed, cloud and edge computing and interested in one of the following research areas for cloud-edge infrastructures are encouraged to apply:

+ +
    +
  • programming APIs and application development for the cloud-edge continuum
    • +
  • scalable, resilient and autonomous runtime systems
    • +
  • resource management and provisioning
    • +
  • serverless architectures for distributed applications
    • +
  • distributed data management
    • +
  • AI-enabled cloud-edge framework and cognitive services
    • +
  • discovery, provisioning, orchestration and usage of edge-cloud services
    • +
  • scheduling and optimization for energy efficiency, economic cost, and performance
    • +
  • Quality of Service (QoS) provisioning and Service Level Agreements (SLA)
    • +
+ +

Prerequisites:

+ +

Applicants must hold a doctoral degree in computer science or in a similar field. Applicants must be willing to teach courses in English in distributed systems and programming both in bachelor and master degree programs. Furthermore, excellent written and oral communication skills in English as well as team and communication skills are expected.

+ +

Required Skills:

+ +
    +
  • Java (expert programmer)
    • +
  • Docker
    • +
  • git and GitHub
    • +
  • experience with cloud providers, e.g. AWS
    • +
+ +

Preferred Qualifications:

+ +
    +
  • Eclipse VertX
    • +
  • google guice
    • +
  • JUnit
    • +
  • Gradle
    • +
  • scripting language (e.g. python or node/typescript)
    • +
  • TerraForm
    • +
  • Serverless (FaaS) platform
    • +
  • edge and IoT computing infrastructures
    • +
  • Experience with ML/RL/DL
    • +
  • event-driven systems
    • +
+ +

Profile of our group:

+ +

The Distributed and Parallel Systems Group (DPS) of the Institute of Computer Science focuses on simplifying the effective use of heterogeneous multiprocessor architectures and geographically distributed resources (including Cloud-Edge infrastructures), which will provide the basis for the next generation of AI-enabled performance-oriented applications. Our main research system is APOLLO (https://apollowf.github.io).

+ +

Appointment:

+ +

The appointment is for six years full-time employment but can also be shorter if preferred by the applicant. The employment will start at 2023-02-01, or as otherwise agreed. The position comes with a competitive salary and opportunities for teaching (up to 20% of full-time). The annual gross salary for this position is € 60.000,-

+ +

Note that the working language and the research program is in English only. There is no need to learn German for this position.

+ +

About the University of Innsbruck (UIBK):

+ +

Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment (https://apollowf.github.io). We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/fog/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralised cloud to the edge and from network and computing infrastructure up to the application layer.

+ +

Innsbruck and its Environment:

+ +

The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.

+ +

How to apply:

+ +

Candidates should submit their application as soon as possible but no later than January 31, 2023.

+ +

Application documents:

+ +
    +
  • Motivation letter (Why does your expertise and vision fit the profile of the open position? explicitly refer to the required and preferred skills)
    • +
  • Full CV including at least 2 references
    • +
  • Copy of BSc, MSc and PhD degrees
    • +
  • Transcripts for all study programs
    • +
+ +

All documents must be submitted in English. The documents must be merged into a single PDF file and sent to thomas.fahringer@uibk.ac.at (subject line: Postdoc Position in Cloud-Edge Computing). For additional files such as theses and publications please add a link in the submitted pdf to a cloud repository and make it accessible or use WeTransfer. The candidate will receive an e-mail confirming receipt of the application.

+ +

Direct questions to:

+ +

Prof. Dr. Thomas Fahringer
+Institute of Computer Science, University of Innsbruck
+Technikerstr. 21a, A-6020 Innsbruck, Austria
+Email: Thomas.Fahringer@uibk.ac.at
+URL: https://dps.uibk.ac.at

+ +
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/members.html b/members.html new file mode 100644 index 0000000000..915c1f08e4 --- /dev/null +++ b/members.html @@ -0,0 +1,2839 @@ + + + + + Members - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Members +

+
+
+
+
+ +
+
+
+
+ + + + + +
+
+ The Workflows Community Initiative Currently has 243 + Members from 26 countries +

Members

+

+ + Become a Member (free) + +

+
+
+ +
+ + +
+ +
+ +
+ +
+ Somayeh Abdi
+ Mälardalen university
+
+ +
+ +
+ +
+ David Abramson
+ University of Queensland, Australia
+
+ +
+ +
+ +
+ Mohsin Alam
+ Netsol Technologies
+
+ +
+ +
+ +
+ Abubakari Alidu
+ University of Milano Bicocca
+
+ +
+ +
+ +
+ Miika Alonen
+ CSC - IT Center for Science
+
+ +
+ +
+ +
+ Meznah Aloqalaa
+ University of Manchester
+
+ +
+ +
+ +
+ İlkay Altintaş
+ University of California San Diego
+
+ +
+ +
+ +
+ Peter Amstutz
+ Curii
+
+ +
+ +
+ +
+ Vicente Antonio
+ AIEP
+
+ +
+ +
+ +
+ Juan Aznar
+ University of Innsbruck
+
+ +
+ +
+ +
+ Laure BERTI-EQUILLE
+ IRD
+
+ +
+ +
+ +
+ Yadu Babuji
+ University of Chicago
+
+ +
+ +
+ +
+ Jonathan Bader
+ Technical University of Berlin
+
+ +
+ +
+ +
+ Rosa M. Badia
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Bartosz Balis
+ AGH University of Science and Technology
+
+ +
+ +
+ +
+ Daniel Balouek-Thomert
+ University of Utah
+
+ +
+ +
+ +
+ Soeren Becker
+ Technical University of Berlin
+
+ +
+ +
+ +
+ Yannik Behr
+ GNS Science
+
+ +
+ +
+ +
+ Khalid Belhajjame
+ PSL, Paris Dauphine University
+
+ +
+ +
+ +
+ Parantapa Bhattacharya
+ University of Virginia
+
+ +
+ +
+ +
+ Rajat Bhattarai
+
+
+ +
+ +
+ +
+ Paul Brunk
+ University of Georgia
+
+ +
+ +
+ +
+ Ian Buckley
+ Agnostiq
+
+ +
+ +
+ +
+ Jean-Marie Burel
+ University of Dundee
+
+ +
+ +
+ +
+ Forrest Burt
+ CIQ
+
+ +
+ +
+ +
+ Silvina Caino-Lores
+ University of Tennessee
+
+ +
+ +
+ +
+ Salvador Capella-Gutierrez
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Henri Casanova
+ University of Hawaii
+
+ +
+ +
+ +
+ Bruno Casella
+ University of Turin
+
+ +
+ +
+ +
+ Daniela Cassol
+ JGI/LBNL
+
+ +
+ +
+ +
+ Steve Chan
+ Lawrence Berkeley National Lab
+
+ +
+ +
+ +
+ Kyle Chard
+ University of Chicago
+
+ +
+ +
+ +
+ Christina Chatzipantsiou
+ Lifebit
+
+ +
+ +
+ +
+ Yanni Chen
+ Texas Tech University
+
+ +
+ +
+ +
+ Justin Chigu
+ Egypt Japan University of Science and Technology
+
+ +
+ +
+ +
+ John Cobb
+ Prospero Knowledge Brokers
+
+ +
+ +
+ +
+ Hannah Cohoon
+ Lawrence Berkeley National Lab
+
+ +
+ +
+ +
+ Tainã Coleman
+ San Diego Supercomputing Center
+
+ +
+ +
+ +
+ Nick Collier
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Iacopo Colonnelli
+ University of Torino
+
+ +
+ +
+ +
+ Javier Conejero
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Frederik Coppens
+ VIB
+
+ +
+ +
+ +
+ Michael R. Crusoe
+
+
+ +
+ +
+ +
+ Will Cunningham
+ Agnostiq
+
+ +
+ +
+ +
+ Anderson Andrei Da Silva
+ Hewlett Packard Enterprise Labs
+
+ +
+ +
+ +
+ Pushkar Dakle
+ Monash University
+
+ +
+ +
+ +
+ Nicholas Danes
+ Colorado School of Mines
+
+ +
+ +
+ +
+ Ninon De Mecquenem
+ Humboldt University Berlin
+
+ +
+ +
+ +
+ Ciro De Vita
+ University of Naples "Parthenope"
+
+ +
+ +
+ +
+ Sue DeGram
+ Adaptive Computing
+
+ +
+ +
+ +
+ Ewa Deelman
+ University of Southern California
+
+ +
+ +
+ +
+ Diana Di Luccio
+ University of Naples "Parthenope"
+
+ +
+ +
+ +
+ Frank Di Natale
+ Nvidia
+
+ +
+ +
+ +
+ Paolo Di Tommaso
+ Seqera Labs
+
+ +
+ +
+ +
+ Sagar Dolas
+ SURF - Dutch ICT Cooperative for Education & Research
+
+ +
+ +
+ +
+ Mathieu Doucet
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Matthew Downton
+ NCI Australia
+
+ +
+ +
+ +
+ Dawn Duan
+ Northwestern University
+
+ +
+ +
+ +
+ Kevin Dudley
+ Queensland University of Technology
+
+ +
+ +
+ +
+ Juan J. Durillo
+ Leibniz Supercomputing Centre
+
+ +
+ +
+ +
+ Martin Eberlein
+ Humboldt-Universität zu Berlin
+
+ +
+ +
+ +
+ Jorge Ejarque
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Wael Elwasif
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Björn Enders
+ National Energy Research Scientific Computing Center
+
+ +
+ +
+ +
+ Christopher Erdmann
+ American Geophysical Union
+
+ +
+ +
+ +
+ Brian Etz
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Thomas Fahringer
+ University of Innsbruck
+
+ +
+ +
+ +
+ Reza Farahani
+ University of Klagenfurt
+
+ +
+ +
+ +
+ José María Fernández
+ Barcelona Supercomputing Center / ELIXIR ES
+
+ +
+ +
+ +
+ Rafael Ferreira da Silva
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Rosa Filgueira
+ EPCC, University of Edinburgh
+
+ +
+ +
+ +
+ Jacob Fosso Tande
+ North Carolina State University
+
+ +
+ +
+ +
+ Luiz Gadelha
+ National Laboratory for Scientific Computing
+
+ +
+ +
+ +
+ Andrew Gallo
+ GE Research
+
+ +
+ +
+ +
+ Alex Ganose
+ Imperial College London
+
+ +
+ +
+ +
+ Daniel Garijo
+ Universidad Politécnica de Madrid
+
+ +
+ +
+ +
+ Julian Geiger
+ Paul-Scherrer Institut
+
+ +
+ +
+ +
+ Yiannis Georgiou
+ Ryax Technologies
+
+ +
+ +
+ +
+ Saeid Ghafouri
+ Queen Mary University of London
+
+ +
+ +
+ +
+ Tom Gibbs
+ Nvidia
+
+ +
+ +
+ +
+ Manuel Giménez de Castro Marciani
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Carole Goble
+ University of Manchester
+
+ +
+ +
+ +
+ Andy Gotz
+ ESRF
+
+ +
+ +
+ +
+ Joshua Gourneau
+ Guardant Health
+
+ +
+ +
+ +
+ Cristian Grisales-Vargas
+ University of Antioquia
+
+ +
+ +
+ +
+ Philipp Gritsch
+ University of Innsbruck
+
+ +
+ +
+ +
+ Patricia Grubel
+ Los Alamos National Laboratory
+
+ +
+ +
+ +
+ Björn Grüning
+ University of Freiburg
+
+ +
+ +
+ +
+ Amal Gueroudji
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Johan Gustafsson
+ University of Melbourne
+
+ +
+ +
+ +
+ Kevin Hannon
+ NIH
+
+ +
+ +
+ +
+ Mihael Hategan
+ University of Chicago
+
+ +
+ +
+ +
+ Stephen Hudson
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Eric Irrgang
+ University of Virginia
+
+ +
+ +
+ +
+ Chela James
+ Institute of Child Health
+
+ +
+ +
+ +
+ Shantenu Jha
+ Brookhaven National Laboratory
+
+ +
+ +
+ +
+ Annika Johansson
+ Columbia University
+
+ +
+ +
+ +
+ Joe Jordan
+ Uppsala University
+
+ +
+ +
+ +
+ Alex Kanitz
+ Biozentrum, University of Basel
+
+ +
+ +
+ +
+ Sehrish Kanwal
+ University of Melbourne
+
+ +
+ +
+ +
+ Sehrish Kanwal
+ The University of Melbourne
+
+ +
+ +
+ +
+ Daniel S. Katz
+ University of Illinois at Urbana-Champaign
+
+ +
+ +
+ +
+ Trevor Keller
+ NIST
+
+ +
+ +
+ +
+ Farah Zaib Khan
+ Australian BioCommons
+
+ +
+ +
+ +
+ Erkan Kiliç
+ Constraction
+
+ +
+ +
+ +
+ Christine Kirkpatrick
+ SDSC
+
+ +
+ +
+ +
+ Kathryn Knight
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Vivek Kohar
+ Flagship Labs 75
+
+ +
+ +
+ +
+ Ivan Kondov
+ Karlsruhe Institute of Technology
+
+ +
+ +
+ +
+ Anthony Kougkas
+ Illinois Institute of Technology
+
+ +
+ +
+ +
+ Nate Kremer-Herman
+ Seattle University
+
+ +
+ +
+ +
+ Johannes Köster
+ University of Duisburg-Essen
+
+ +
+ +
+ +
+ Samuel Lampa
+ Savantic AB
+
+ +
+ +
+ +
+ Daniel Laney
+ Lawrence Livermore National Laboratory
+
+ +
+ +
+ +
+ Charalampos Lazaris
+ Whitehead Institute/Broad Institute of MIT and Harvard
+
+ +
+ +
+ +
+ Christopher Lazik
+ Humboldt-Universität zu Berlin
+
+ +
+ +
+ +
+ Thanh Le Viet
+ Quadram Institute Bioscience
+
+ +
+ +
+ +
+ Fabian Lehmann
+ Humboldt University of Berlin
+
+ +
+ +
+ +
+ Ulf Leser
+ Humboldt University of Berlin
+
+ +
+ +
+ +
+ Shiyong Lu
+ Wayne State University
+
+ +
+ +
+ +
+ Richard Lupat
+ Peter MacCallum Cancer Centre
+
+ +
+ +
+ +
+ Ketan Maheshwari
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Maciej Malawski
+ AGH University of Science and Technology
+
+ +
+ +
+ +
+ Fabrizio Marozzo
+ University of Calabria
+
+ +
+ +
+ +
+ Jack Marquez
+ University of Tennessee
+
+ +
+ +
+ +
+ Alberto Riccardo Martinelli
+ University of Turin
+
+ +
+ +
+ +
+ Motohiko Matsuda
+ RIKEN R-CCS
+
+ +
+ +
+ +
+ Marta Mattoso
+ Federal University of Rio de Janeiro
+
+ +
+ +
+ +
+ Jennifer Mays
+ Columbia University
+
+ +
+ +
+ +
+ Chris McBride
+ HPE - Cray
+
+ +
+ +
+ +
+ Doriana Medic
+ University of Turin
+
+ +
+ +
+ +
+ Kshitij Mehta
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Mario Melara
+ Joint Genome Institute
+
+ +
+ +
+ +
+ Timothy Middelkoop
+ Internet2
+
+ +
+ +
+ +
+ Paolo Missier
+ Newcastle University
+
+ +
+ +
+ +
+ Gianluca Mittone
+ University of Turin
+
+ +
+ +
+ +
+ Somayeh Mohammadi
+ Freie University of Berlin
+
+ +
+ +
+ +
+ Saim Momin
+ Max Planck Institute of Immunobiology and Epigenetics, Freiburg
+
+ +
+ +
+ +
+ Raffaele Montella
+ University of Naples "Parthenope"
+
+ +
+ +
+ +
+ Rowland Mosbergen
+ WEHI
+
+ +
+ +
+ +
+ Matthieu Muffato
+ Wellcome Sanger Institute
+
+ +
+ +
+ +
+ Naeem Muhammad
+ KU Leuven University
+
+ +
+ +
+ +
+ Etienne NDAMLABIN
+ Inria
+
+ +
+ +
+ +
+ Naira Naouar
+ Sorbonne Universite
+
+ +
+ +
+ +
+ Rupert Nash
+ The University of Edinburgh
+
+ +
+ +
+ +
+ Tazro Ohta
+ Database Center for Life Science
+
+ +
+ +
+ +
+ Michal Okoniewski
+ ETH Zurich
+
+ +
+ +
+ +
+ Jonathan Ozik
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Ludger Paehler
+ Technical University of Munich
+
+ +
+ +
+ +
+ Drew Paine
+ LBNL
+
+ +
+ +
+ +
+ Haochen Pan
+ University of Chicago
+
+ +
+ +
+ +
+ George Papadimitriou
+ University of Southern California
+
+ +
+ +
+ +
+ Taylor Paul
+ University of Maryland
+
+ +
+ +
+ +
+ Maciej Pawlik
+ AGH University of Science and Technology
+
+ +
+ +
+ +
+ Stefan Pedratscher
+ University of Innsbruck
+
+ +
+ +
+ +
+ J. Luc Peterson
+ Lawrence Livermore National Laboratory
+
+ +
+ +
+ +
+ Simon Pigot
+ CSIRO
+
+ +
+ +
+ +
+ Guilherme Piêgas Koslovski
+ Santa Catarina State University - UDESC
+
+ +
+ +
+ +
+ Loïc Pottier
+ Lawrence Livermore National Laboratory
+
+ +
+ +
+ +
+ Line Pouchard
+ Brookhaven National Lab
+
+ +
+ +
+ +
+ Christophe Pradal
+ CIRAD & Inria
+
+ +
+ +
+ +
+ Howard Pritchard
+ Los Alamos National Laboratory
+
+ +
+ +
+ +
+ Gabriel Puigdemunt
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Paul Quinn
+ STFC Scientific Computing
+
+ +
+ +
+ +
+ Mubdi Rahman
+ Sidrat Research
+
+ +
+ +
+ +
+ Lavanya Ramakrishnan
+ Lawrence Berkeley National Laboratory
+
+ +
+ +
+ +
+ Randy K Rannow
+ Silverdraft
+
+ +
+ +
+ +
+ Marcel Ribeiro-Dantas
+ Seqera Labs
+
+ +
+ +
+ +
+ Sashko Ristov
+ University of Innsbruck
+
+ +
+ +
+ +
+ Stefan Robila
+ Montclair State University
+
+ +
+ +
+ +
+ David Rogers
+ ORNL
+
+ +
+ +
+ +
+ Paul Romano
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Mehdi Roozmeh
+ Karlsruhe Institute of Technology
+
+ +
+ +
+ +
+ Kelly Rosa Braghetto
+ University of São Paulo
+
+ +
+ +
+ +
+ Andrew Rosen
+ Princeton University
+
+ +
+ +
+ +
+ William Rowell
+ Pacific Biosciences
+
+ +
+ +
+ +
+ William Rowell
+ Pacific Biosciences
+
+ +
+ +
+ +
+ Jedrzej Rybicki
+ Forschungszentrum Juelich GmbH
+
+ +
+ +
+ +
+ Celso Rêgo
+ Karlsruhe Institute of Technology
+
+ +
+ +
+ +
+ Nishant Saurabh
+ Utrecht University
+
+ +
+ +
+ +
+ Sumit Kumar Saurav
+ Centre for Development of Advanced Computing
+
+ +
+ +
+ +
+ Volodymyr Savchenko
+ EPFL
+
+ +
+ +
+ +
+ Juliane Schneider
+ Sage Bionetworks
+
+ +
+ +
+ +
+ Alberto Scionti
+ LINKS Foundation
+
+ +
+ +
+ +
+ Clint Seinen
+ The Canadian Centre for Climate Modelling and Analysis
+
+ +
+ +
+ +
+ Dinindu Senanayake
+ New Zealand eScience Infrastructure
+
+ +
+ +
+ +
+ Andrew Shao
+ HPE
+
+ +
+ +
+ +
+ Liwen Shih
+ U of Houston - Clear Lake
+
+ +
+ +
+ +
+ Spencer Shorte
+ Institut Pasteur
+
+ +
+ +
+ +
+ Christine Simpson
+ ALCF
+
+ +
+ +
+ +
+ Raül Sirvent
+ Barcelona Supercomputing Center
+
+ +
+ +
+ +
+ Tyler Skluzacek
+ Oak Ridge National Lab
+
+ +
+ +
+ +
+ Barry Sly-Delgado
+ University of Notre Dame
+
+ +
+ +
+ +
+ Stian Soiland-Reyes
+ The University of Manchester
+
+ +
+ +
+ +
+ Ana Solorzano
+ Northeastern University
+
+ +
+ +
+ +
+ Nicola Soranzo
+ Earlham Institute
+
+ +
+ +
+ +
+ Fabio Souza
+ Petrobras
+
+ +
+ +
+ +
+ Renan Souza
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Kelly Sovacool
+ University of Michigan
+
+ +
+ +
+ +
+ Jonathan Sparks
+ HPE
+
+ +
+ +
+ +
+ Jonathan Sparks
+ HPE
+
+ +
+ +
+ +
+ Shelley Stall
+ American Geophysical Union
+
+ +
+ +
+ +
+ Hermann Stolte
+ Humboldt University Berlin
+
+ +
+ +
+ +
+ Giovanni Stracquadanio
+ University of Edinburgh
+
+ +
+ +
+ +
+ Ziheng Sun
+ George Mason University
+
+ +
+ +
+ +
+ Priyanka Surana
+ Wellcome Sanger Institute
+
+ +
+ +
+ +
+ Alan Sussman
+ University of Maryland
+
+ +
+ +
+ +
+ Frédéric Suter
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Chinmaya Kumar Swain
+ SRM University, AP
+
+ +
+ +
+ +
+ Domenico Talia
+ Università della Calabria
+
+ +
+ +
+ +
+ Leopold Talirz
+ Microsoft
+
+ +
+ +
+ +
+ Nathan Tallent
+ Pacific Northwest National Laboratory
+
+ +
+ +
+ +
+ Douglas Thain
+ University of Notre Dame
+
+ +
+ +
+ +
+ Lauritz Thamsen
+ University of Glasgow
+
+ +
+ +
+ +
+ Mikhail Titov
+ Brookhaven National Laboratory
+
+ +
+ +
+ +
+ Ben Tovar
+ University of Notre Dame
+
+ +
+ +
+ +
+ Pawan Tripathi
+ Case Western Reserve University
+
+ +
+ +
+ +
+ Aalap Tripathy
+ Hewlett Packard Enterprise
+
+ +
+ +
+ +
+ Matteo Turilli
+ Rutgers University
+
+ +
+ +
+ +
+ Nick Tyler
+ NERSC
+
+ +
+ +
+ +
+ Aleem Uddin
+ Australian Research Data Commons
+
+ +
+ +
+ +
+ Edite Vartina
+ Riga Stradins University
+
+ +
+ +
+ +
+ Ricardo Vilaça
+ MACC
+
+ +
+ +
+ +
+ Baiba Vilne
+ Rīga Stradiņš University
+
+ +
+ +
+ +
+ Giacomo Vitali
+ LINKS Foundation
+
+ +
+ +
+ +
+ Aurelio Vivas
+ Universidad de los Andes
+
+ +
+ +
+ +
+ Paolo Viviani
+ LINKS Foundation
+
+ +
+ +
+ +
+ Yuandou Wang
+ University of Amsterdam
+
+ +
+ +
+ +
+ Heather Ward
+ DNAstack
+
+ +
+ +
+ +
+ David Waroquiers
+ Matgenix
+
+ +
+ +
+ +
+ Matthias Weidlich
+ Humboldt-Universität zu Berlin
+
+ +
+ +
+ +
+ Alainna White
+ NVIDIA
+
+ +
+ +
+ +
+ Patrick Widener
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Sean Wilkinson
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Alan Williams
+ The University of Manchester
+
+ +
+ +
+ +
+ Joel Witzke
+ Zuse Institute Berlin
+
+ +
+ +
+ +
+ Jason Wohlgemuth
+ Oak Ridge National Laboratory
+
+ +
+ +
+ +
+ Matthew Wolf
+ Samsung Electronics
+
+ +
+ +
+ +
+ Justin M. Wozniak
+ Argonne National Laboratory
+
+ +
+ +
+ +
+ Ruijie Zhu
+ Northwestern University
+
+ +
+ +
+ +
+ Mahnoor Zulfiqar
+ Friedrich Schiller University Jena
+
+ +
+ +
+ +
+ Daniel de Oliveira
+ Universidade Federal Fluminense
+
+ +
+ +
+ +
+ Bruno de Paula Kinoshita
+ Barcelona Supercomputing Center
+
+ +
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/registries.html b/registries.html new file mode 100644 index 0000000000..2f8fa0c5ff --- /dev/null +++ b/registries.html @@ -0,0 +1,340 @@ + + + + + Workflows Registries - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Registries +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of workflow repositories that host workflow applications +

+ Contribute +
+
+ +
+ + +
+
+
+ +

+ + Dockstore + +

+ +

Dockstore

+
+ Sharing Docker Tools and Workflows for the Sciences +
+
+
+
+ +
+
+
+ +

+ + Snakemake workflow catalog + +

+ +

Snakemake workflow catalog

+
+ A comprehensive catalog of standards compliant, public, Snakemake workflows +
+
+
+
+ +
+
+
+ +

+ + WorkflowHub + +

+ +

WorkflowHub

+
+ A registry for describing, sharing and publishing scientific computational workflows. WorkflowHub aims to facilitate discovery and reuse of workflows in an accessible and interoperable way. +
+
+
+
+ +
+
+
+ +

+ + nf-core + +

+ +

nf-core

+
+ A community effort to collect a curated set of analysis pipelines built using Nextflow. +
+
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/registries/contribute.html b/registries/contribute.html new file mode 100644 index 0000000000..389d983a96 --- /dev/null +++ b/registries/contribute.html @@ -0,0 +1,295 @@ + + + + + Contribute: Registries - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Contribute: Registries +

+
+
+
+
+ +
+
+
+
+
+
+ Register an actively-developed open source workflow-related research frameworks +

How to Contribute with a Workflow Registry

+ All Workflow Registries +
+ +
+

+ The Workflows Community Initiative (WCI) provides a curated collection of workflow applications or + repositories that host workflows. We invite all workflow researchers to share their tools and + frameworks through this collection. +

+ +

Adding a Workflow Registry

+

+ To add a workflow registry, you only need to add the registry information into an YAML file + hosted as part of the WCI GitHub repository. The preferred way to submit your changes is via creating a + pull request with the changes. To this end, these are the recommended steps for adding a workflow research + framework: +

+
    +
  1. Fork the WCI GitHub repository
    2. +
  2. Clone your forked repository: + 
    git clone https://github.com/<your_username>/workflowscommunity.github.io
    +
    3. +
  3. Edit the _data/registries.yml file, and add the information + regarding the workflow registry: + 
    +- name: "Workflow Registry Name"
+  url: <registry_url>
+  description: "Short registry description" 
+  icon: <url_to_registry_logo> # square images are preferred (1:1 aspect ratio)
+
    +
    4. +
  4. Commit the changes, and create a pull request for the WCI GitHub + repository.
    5. +
  5. The WCI team will then evaluate your pull request, and merge the changes if the workflow registry + is properly functioning.
    6. +
+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/reports.html b/reports.html new file mode 100644 index 0000000000..3ef668d764 --- /dev/null +++ b/reports.html @@ -0,0 +1,347 @@ + + + + + Reports - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Reports +

+
+
+
+
+ +
+
+
+
+
+
+

+ Collection of community reports related to workflows research +

+
+
+ +
+ + +
+
+ + +
+
Zenodo, 2024
+

Workflows Community Summit 2024

+
+ Future Trends and Challenges in Scientific Workflows +
+
+
+
+ +
+
+ + +
+
Zenodo, 2023
+

Workflows Community Summit

+
+ A Roadmap Revolution +
+
+
+
+ +
+
+ + +
+
National Academies of Sciences, Engineering, and Medicine, 2022
+

Automated Research Workflows for Accelerated Discovery

+
+ Closing the Knowledge Discovery Loop +
+
+
+
+ +
+
+ + +
+
Zenodo, 2022
+

Workflows Community Summit

+
+ Tightening the Integration between Computing Facilities and Scientific Workflows" +
+
+
+
+ +
+
+ + +
+
Zenodo, 2021
+

Workflows Community Summit

+
+ Advancing the State-of-the-art of Scientific Workflows Management Systems Research and Development +
+
+
+
+ +
+
+ + +
+
Zenodo, 2021
+

Workflows Community Summit

+
+ Bringing the Scientific Workflows Community Together +
+
+
+
+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/robots.txt b/robots.txt new file mode 100644 index 0000000000..e087884e68 --- /dev/null +++ b/robots.txt @@ -0,0 +1 @@ +Sitemap: /sitemap.xml diff --git a/scripts/process_systems.py b/scripts/process_systems.py new file mode 100644 index 0000000000..ad3aad9cf2 --- /dev/null +++ b/scripts/process_systems.py @@ -0,0 +1,216 @@ +#!/usr/bin/env python +# -*- coding: utf-8 -*- +# +# Copyright (c) 2023 Workflows Community Initiative. + +import datetime +import os +import requests +import yaml +import json + +from string import Template + + +def _get_value(key, obj, default_value): + return obj[key] if key in obj else default_value + + +systems = [] +headers = { + "Accept": "application/vnd.github.scarlet-witch-preview+json", + "Accept": "application/vnd.github.mercy-preview+json", + "Authorization": f"token {os.environ['JEKYLL_TOKEN']}" +} + +# read list of workflow system repositories +with open("_data/workflow_systems.yml") as f: + systems = yaml.safe_load(f) + +for s in systems: + print(s) + url = f"https://api.github.com/repos/{s['organization']}/{s['repository']}" + r = requests.get(url, headers=headers) + response = r.json() + # print(json.dumps(response, indent=2)) + + # repo general information + s["title"] = response["name"] + s["default_branch"] = response["default_branch"] + s["subtitle"] = response["description"] + s["description"] = response["description"] + s["license"] = response["license"]["spdx_id"] if response["license"] else "No license available" + s["issues"] = response["open_issues"] + s["forks"] = response["forks"] + s["stargazers"] = response["stargazers_count"] + s["avatar"] = response["owner"]["avatar_url"] + s["website"] = response["homepage"] + s["language"] = response['language'] + s["twitter"] = "" + s["youtube"] = "" + s["release"] = "" + s["release_name"] = "" + s["release_date"] = "" + s["release_url"] = "" + s["doc_general"] = "" + s["doc_installation"] = "" + s["doc_tutorial"] = "" + s["execution_environment"] = "" + s["wci_metadata"] = "false" + + # date + date = datetime.datetime.strptime( + response["updated_at"], "%Y-%m-%dT%H:%M:%SZ") + s["year"] = date.strftime("%Y") + s["month"] = date.strftime("%b") + s["monthn"] = date.strftime("%m") + s["day"] = date.strftime("%d") + + # topics + s["topics"] = "No topics available" + s["tags"] = "" + topics = response["topics"] + if len(topics) > 0: + s["topics"] = "" + for topic in topics: + s["topics"] += f"{topic}  " + s["tags"] += f"{topic} " + + # releases + url = response['releases_url'] + r = requests.get(url[:-5], headers=headers) + data = r.json() + if len(data) > 0: + date = datetime.datetime.strptime( + data[0]["published_at"], "%Y-%m-%dT%H:%M:%SZ") + release_date = date.strftime("%d %b %Y") + s["release_name"] = data[0]["name"] + s["release_date"] = release_date + s["release_url"] = data[0]["html_url"] + + # contributors + r = requests.get(response['contributors_url'], headers=headers) + data = r.json() + s["contributors"] = len(data) + s["contributors_list"] = "" + for c in data: + s["contributors_list"] += f'' \ + f'{c[' + + # metadata file + metadata = f"{s['metadata']}" if "metadata" in s else ".wci.yml" + if ".wci.yml" not in metadata: + metadata = f"{metadata}/.wci.yml" + r = requests.get( + f"https://raw.githubusercontent.com/{s['organization']}/{s['repository']}/{s['default_branch']}/{metadata}") + + if r.ok: + data = yaml.safe_load(r.text) + s["wci_metadata"] = "true" + print(data) + + # description + s["title"] = _get_value("name", data, s["title"]) + s["subtitle"] = _get_value("headline", data, s["subtitle"]) + s["description"] = _get_value("description", data, s["description"]) + s["website"] = _get_value("website", data, s["website"]) + s["avatar"] = _get_value("icon", data, s["avatar"]) + s["language"] = _get_value("language", data, s["language"]) + + # social + if "social" in data: + if "twitter" in data["social"]: + s["twitter"] = "" \ + f"" \ + f" https://twitter.com/{data['social']['twitter']}" + + if "youtube" in data["social"]: + s["youtube"] = "" \ + f"" \ + f" {data['social']['youtube']}" + + # release + if "release" in data: + if "date" in data["release"]: + s["release_date"] = data["release"]["date"].strftime("%d %b %Y") + s["release_name"] = _get_value("version", data["release"], s["release_name"]) + s["release_url"] = _get_value("url", data["release"], s["release_url"]) + + # documentation + if "documentation" in data: + s["doc_general"] = f"" \ + "
" \ + "
" \ + "
" \ + "
" \ + "

Docs

" if "general" in data["documentation"] else "" + s["doc_installation"] = f"" \ + "
" \ + "
" \ + "
" \ + "
" \ + "

Install

" if "installation" in data["documentation"] else "" + s["doc_tutorial"] = f"" \ + "
" \ + "
" \ + "
" \ + "
" \ + "

Tutorial

" if "tutorial" in data["documentation"] else "" + + # execution environment + if "execution_environment" in data: + s["execution_environment"] = "
" \ + "
" \ + "

Execution Environment

" \ + "
" + + # user interfaces + if "interfaces" in data["execution_environment"]: + s["execution_environment"] += "
" \ + "
    " \ + "

  • User Interfaces

    • " + for i in data["execution_environment"]["interfaces"]: + s["execution_environment"] += f"
  • {i}
    • " + s["execution_environment"] += "
" + + # resource managers + if "resource_managers" in data["execution_environment"]: + s["execution_environment"] += "
" \ + "
    " \ + "

  • Resource Managers

    • " + for rm in data["execution_environment"]["resource_managers"]: + s["execution_environment"] += f"
  • {rm}
    • " + s["execution_environment"] += "
" + + # transfer protocols + if "transfer_protocols" in data["execution_environment"]: + s["execution_environment"] += "
" \ + "
    " \ + "

  • Transfer Protocols

    • " + for tp in data["execution_environment"]["transfer_protocols"]: + s["execution_environment"] += f"
  • {tp}
    • " + s["execution_environment"] += "
" + + s["execution_environment"] += "
" + + # release component + if s["release_name"]: + if s["release_url"]: + s["release"] = f"{s['release_name']} " \ + f" — Released on: {s['release_date']}" + else: + s["release"] = f"{s['release_name']} " \ + f" — Released on: {s['release_date']}" + + # fill template + with open('scripts/systems.html.in') as f: + template = Template(f.read()) + contents = template.substitute(s) + + from pathlib import Path + Path("_systems").mkdir(parents=True, exist_ok=True) + + # write workflows data + filename = s["name"] if "name" in s else s["repository"] + with open(f"_systems/{filename}.html", 'w') as f: + f.write(contents) diff --git a/scripts/systems.html.in b/scripts/systems.html.in new file mode 100644 index 0000000000..4b10179f90 --- /dev/null +++ b/scripts/systems.html.in @@ -0,0 +1,311 @@ + + + + + $title - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ $title +

+
+
+
+
+ +
+
+
+
+
+
+ $website
+ $title +

$title

+ Last updated: $day $month $year
+ $release
+ + https://github.com/$organization/$repository
+ $twitter
+ $youtube +
+ +
+

$description

+
+
+ +
+ $doc_installation + $doc_tutorial + $doc_general +
+
+
+
+ +
+
+
+

$language

+
+
+
+
+ +$execution_environment + + +
+
+

Contributors

+

+ $forks +   |   + $stargazers +   |   + $issues +   |   + $license +

+
+
+ $contributors_list +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/search.json b/search.json new file mode 100644 index 0000000000..73101e8d64 --- /dev/null +++ b/search.json @@ -0,0 +1,768 @@ +[ + + { + "title" : "Apollo Runtime System", + "url" : "/systems/EE-Demo/", + "description" : "A runtime system for the orchestration of workflows across the cloud-edge-Iot continuum.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "SmartSim", + "url" : "/systems/SmartSim/", + "description" : "Machine learning workflows with HPC applications (Python, C++, C, and Fortran)", + "tags" : "hpc, machine-learning, simulation, workflow", + "category" : "system" + }, + + { + "title" : "AiiDA", + "url" : "/systems/aiida-core/", + "description" : "A workflow manager for computational science with a strong focus on provenance, performance and extensibility.", + "tags" : "aiida, computational-science, data-provenance, database, provenance, scheduler, ssh, workflow, workflow-engine, workflows", + "category" : "system" + }, + + { + "title" : "Common Workflow Language", + "url" : "/systems/common-workflow-language/", + "description" : "Interoperable workflow execution of containerized command line tools", + "tags" : "common-workflow-language, commonwl, containers, cwl, science, sciworkflows, workflow, workflows", + "category" : "system" + }, + + { + "title" : "PyCOMPSs/COMPSs", + "url" : "/systems/compss/", + "description" : "Easy task-based parallelization and efficient execution in distributed infrastructures.", + "tags" : "c, distributed-computing, docker, hpc, java, pipeline-framework, python, singularity, slurm, workflow-management-system, workflows", + "category" : "system" + }, + + { + "title" : "Covalent", + "url" : "/systems/covalent/", + "description" : "Distributed workflows for quantum and HPC", + "tags" : "covalent, data-pipeline, data-science, deep-learning, hacktoberfest, hpc, hpc-applications, machine-learning, machinelearning, machinelearning-python, orchestration, parallelization, pipelines, python, quantum, quantum-computing, quantum-machine-learning, workflow, workflow-automation, workflow-management", + "category" : "system" + }, + + { + "title" : "cromwell", + "url" : "/systems/cromwell/", + "description" : "Scientific workflow engine designed for simplicity & scalability. Trivially transition between one off use cases to massive scale production environments", + "tags" : "application, bioinformatics, cloud, containers, docker, executor, ga4gh, hpc, scala, wdl, workflow, workflow-description-language, workflow-execution", + "category" : "system" + }, + + { + "title" : "DagOnStar", + "url" : "/systems/dagonstar/", + "description" : "DAGonStar is a simple Python-based workflow engine that runs jobs on everything from the local machine to distributed virtual HPC clusters hosted in private and public clouds.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "dask", + "url" : "/systems/dask/", + "description" : "Parallel computing with task scheduling", + "tags" : "dask, numpy, pandas, pydata, python, scikit-learn, scipy", + "category" : "system" + }, + + { + "title" : "fireworks", + "url" : "/systems/fireworks/", + "description" : "The Fireworks Workflow Management Repo.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "galaxy", + "url" : "/systems/galaxy/", + "description" : "Data intensive science for everyone.", + "tags" : "bioinformatics, dna, genomics, hacktoberfest, ngs, pipeline, science, sequencing, usegalaxy, workflow, workflow-engine", + "category" : "system" + }, + + { + "title" : "Geoweaver", + "url" : "/systems/geoweaver/", + "description" : "a lightweight workflow software to easily orchestrate pipelines from Python and shell scripts and preserve history of every execution", + "tags" : "ai, earth-science, esip-lab, pipeline, pipeline-framework, productivity, scientific-computing, tangibility, workflow, workflow-engine, workflow-management, workflow-tool", + "category" : "system" + }, + + { + "title" : "jobflow", + "url" : "/systems/jobflow/", + "description" : "jobflow is a library for writing computational workflows.", + "tags" : "workflows", + "category" : "system" + }, + + { + "title" : "libEnsemble", + "url" : "/systems/libensemble/", + "description" : "Tool for running dynamic ensembles.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "Maestro Workflow Conductor", + "url" : "/systems/maestrowf/", + "description" : "Orchestrate your HPC workflows with ease", + "tags" : "hpc, python, radiuss, science-research, simulation-study, workflow, workflow-processes, workflows", + "category" : "system" + }, + + { + "title" : "Makeflow", + "url" : "/systems/makeflow/", + "description" : "Makeflow is a workflow system for parallel and distributed computing that uses a language very similar to Make.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "Merlin", + "url" : "/systems/merlin/", + "description" : "Enabling Machine Learning HPC Workflows", + "tags" : "big-data, celery-workers, hpc, machine-learning, radiuss, redis-server, simulation, workflow, workflows", + "category" : "system" + }, + + { + "title" : "mlflow", + "url" : "/systems/mlflow/", + "description" : "Open source platform for the machine learning lifecycle", + "tags" : "ai, apache-spark, machine-learning, ml, mlflow, model-management", + "category" : "system" + }, + + { + "title" : "Nextflow", + "url" : "/systems/nextflow/", + "description" : "A DSL for data-driven computational pipelines", + "tags" : "aws, bioinformatics, cloud, dataflow, docker, groovy, hello, hpc, nextflow, pipeline, pipeline-framework, reproducible-research, reproducible-science, sge, singularity, singularity-containers, slurm, workflow-engine", + "category" : "system" + }, + + { + "title" : "nipype", + "url" : "/systems/nipype/", + "description" : "Neuroimaging in Python: Pipelines and Interfaces", + "tags" : "big-data, brain-imaging, brainweb, data-science, dataflow, dataflow-programming, neuroimaging, python, workflow-engine", + "category" : "system" + }, + + { + "title" : "Parsl", + "url" : "/systems/parsl/", + "description" : "Productive parallel programming in Python", + "tags" : "hacktoberfest", + "category" : "system" + }, + + { + "title" : "pegasus", + "url" : "/systems/pegasus/", + "description" : "Pegasus Workflow Management System - Automate, recover, and debug scientific computations.", + "tags" : "bioinformatics, distributed-systems, hpc, workflow, workflow-management-system", + "category" : "system" + }, + + { + "title" : "prefect", + "url" : "/systems/prefect/", + "description" : "Prefect is a workflow orchestration framework for building resilient data pipelines in Python.", + "tags" : "automation, data, data-engineering, data-ops, data-science, infrastructure, ml-ops, observability, orchestration, pipeline, prefect, python, workflow, workflow-engine", + "category" : "system" + }, + + { + "title" : "pyiron", + "url" : "/systems/pyiron_base/", + "description" : "A workflow manager for scientific computing on high performance computing infrastructures", + "tags" : "workflow, workflow-automation, workflow-engine, workflow-management", + "category" : "system" + }, + + { + "title" : "radical.entk", + "url" : "/systems/radical.entk/", + "description" : "The RADICAL Ensemble Toolkit", + "tags" : "", + "category" : "system" + }, + + { + "title" : "SciPipe", + "url" : "/systems/scipipe/", + "description" : "Robust, flexible and resource-efficient pipelines using Go and the commandline.", + "tags" : "bioinformatics, bioinformatics-pipeline, cheminformatics, dataflow, fbp, go, golang, pipeline, scientific-workflows, scipipe, workflow, workflow-engine", + "category" : "system" + }, + + { + "title" : "signac-flow", + "url" : "/systems/signac-flow/", + "description" : "Workflow management for signac-managed data spaces.", + "tags" : "hacktoberfest, python, signac, workflow", + "category" : "system" + }, + + { + "title" : "Snakemake", + "url" : "/systems/snakemake/", + "description" : "This is the development home of the workflow management system Snakemake. For general information, see", + "tags" : "reproducibility, snakemake, workflow-management", + "category" : "system" + }, + + { + "title" : "StreamFlow", + "url" : "/systems/streamflow/", + "description" : "Towards Cloud-HPC Continuum", + "tags" : "workflows", + "category" : "system" + }, + + { + "title" : "swift-t", + "url" : "/systems/swift-t/", + "description" : "Swift/T: High Performance Parallel Scripting Language", + "tags" : "", + "category" : "system" + }, + + { + "title" : "TaskVine", + "url" : "/systems/taskvine/", + "description" : "An execution system for large scale data intensive dynamic workflows.", + "tags" : "", + "category" : "system" + }, + + { + "title" : "WATTS", + "url" : "/systems/watts/", + "description" : "Workflow and Template Toolkit for Simulation", + "tags" : "mcnp, nuclear-energy, openmc, python, simulation, templates, workflow-automation", + "category" : "system" + }, + + + { + "title" : "Exascale Supercomputer Software Container Engineer (RE1)", + "url" : "/jobs/bsc_exascale_research_engineer/", + "description" : "About BSCThe Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&amp;D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 770 staff from 55 countries.Look at the BSC experience: BSC-CNS YouTube Channel Let’s stay connected with BSC Folks!Context And MissionBSC is looking for a research engineer that contributes to the container support and to an ecosystem targeting RISC-V-based ISA for a European HPC accelerator. The position is funded by a project aiming to build the software infrastructure and toolchain for an FPGA-based emulator for an energy-efficient Exascale system.More specifically, the candidate will collaborate with the Workflows and Distributed Computing (WDC) group to validate container images running PyCOMPSs applications (compss.bsc.es). PyCOMPSs is a task-based programming model developed by the WDC group, that aims at easing the development of parallel applications for distributed computing. Between the applications to validate, the candidate will work with machine learning applications (dislib scripts, see dislib.bsc.es) parallelized with COMPSs. In addition, the candidate will support the whole project on its CD/CI infrastructure.Key Duties Validation of COMPSs container images for RISC-V architecture Validation of COMPSs applications on top of containers for RISC-V Validate machine learning applications on the RISC-V architecture Extend containers and the container ecosystem to RISC-V based hardware. Build and maintain high-performance runtime frameworks, libraries, and servicesRequirementsEducation Master in Computer Science, or related Engineering degree or equivalent level of professional experience.Essential Knowledge and Professional Experience Experience with container technologies, such as Docker and orchestration platforms like Kubernetes. Good knowledge of Linux OS (not necessarily all): Linux filesystems Image distribution Content storage and management Kernel and container security Linux containerization Additional Knowledge and Professional Experience Knowledge on parallel and distributed computing Experience with Continuous Integration/Continuous Deployment frameworks Agile development and open source development, deployment, and support, including GitHub or equivalent Open source software committer a plusCompetences Effective communication, multitasking, and working well on collaborative designs. Ability to think creatively. Ability to take initiative, prioritize and work under set deadlines and pressure. Fluency in English is essential, Spanish is welcome.Conditions The position will be located at BSC within the Computer Sciences Department We offer a full-time contract, a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, tickets restaurant, private health insurance, fully support to the relocation procedures Duration: Temporary - 31/12/2023 renewable Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona Starting date: ASAPApplications procedure and processAll applications must be made through BSC website and contain: A full CV in English including contact details A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be consideredIn accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.For more information follow this link.DeadlineThe vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.OTM-R principles for selection processesBSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.For more information follow this link.This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.", + "category" : "job" + }, + + { + "title" : "Post-Doc - COLMENA Project (R2)", + "url" : "/jobs/bsc_postdoc_colmena/", + "description" : "About BSCThe Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&amp;D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 800 staff from 55 countries.Look at the BSC experience: BSC-CNS YouTube Channel Let’s stay connected with BSC Folks!We are particularly interested for this role in the strengths and lived experiences of women and underrepresented groups to help us avoid perpetuating biases and oversights in science and IT research.Context And MissionThe Computer Sciences (CS) department of the Barcelona Supercomputing Center aims to carry out research and development to influence the way computing machines are built, programmed and used. The Workflows and Distributed Computing group at the Barcelona Supercomputing Center aims to carry out research on programming models for distributed computing. More specifically, this group will be contributing to the COLMENA project (Spanish funded project) which contributes to the definition of next-generation computing and data technologies by proposing a framework to ease the programming, deployment and maintenance of hyper-distributed applications on the device-edge-cloud Continuum.The group will have a significant effort devoted to the definition of the COLMENA programming model and its software platform.The new programming model environment will be inspired on organic colonies: collections of autonomous individuals with heterogeneous characteristics that cooperate forming different social organizations. In this new approach, each smart device (IoT sensor/actuators, network access point/router or Edge/Cloud server) composing a cyber-infrastructure is considered as an Autonomous ageNT (ANT) aware of its own IT capabilities (data processing power, storage capacity, sensors and actuators equipped, available network interfaces, etc.) and context (geo-location, owner, etc.). In such an environment, services will be described as a society with different roles. Each role is defined by behaviour (program logic), the necessary software dependencies and the hardware requirements to play it. The role composition of such a society will be defined by a set of rules that indicate the number of players of each role. ANTs autonomously pick one or more roles to play according to its characteristics, the requirements of each role and the current role distribution. Upon their decision, they contextualize themselves downloading the necessary software and start the execution.At any point, the infrastructure may change; a new ANT can join in or leave the Colony, the service may be in a peak or valley workload moment, or a network service may be disrupted. To rapidly adapt to these changes, ANTs constantly revisit their roles and consider any possible reconfiguration that may improve the service. The goal of the project is to develop a platform to create, deploy and operate services on the device-edge-cloud continuum. A programming framework capable of reducing the complexity of programming swarms. The “roles” will be programmable through simple, high-level programming interfaces, where no low level details are exposed. The project will also develop the necessary libraries and layers to support such an interface.For this research, the group is looking for an postdoc to contribute in this research, with the design and implementation of the COLMENA programming model and software platform. The job also includes active participation in the project, attending project meetings, collaborating with partners and writing deliverables.The financing entities are the Ministry of Economic Affairs and Digital Transformation and the European Union-NextGenerationEU, within the framework of the PRTR and the MRR, all in accordance with what is established in this regard, in particular, in accordance with the provisions of article 34.2 of Regulation (EU) 2021/241 of the European Parliament and of the Council, of February 12, 2021.Key Duties Design and development of the COLMENA programming model Design and development of the COLMENA software platform Development of tests to check the extensions with the COLMENA test infrastructure Contribution to COLMENA documentation to illustrates how to use the programming model and platform The candidate will work closely with other research members on the team of the Workflows and Distributed Computing groupRequirementsEducation PhD on Computer science degree or similarEssential Knowledge and Professional Experience Previous experience in runtime systems and system software Knowledge of Distributed Computing Good programming skills in Java and C, and/or PythonAdditional Knowledge and Professional Experience Previous experience in distributed programming models Experience in container management platforms (Docker, Kubernetes, …)Competences Fluency in spoken and written English, while fluency in other European languages will be also valuedConditions The position will be located at BSC within the Computer Sciences Department We offer a full-time contract (37.5h/week), a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, restaurant tickets, private health insurance, support to the relocation procedures Duration: Open-ended contract due to technical and scientific activities linked to the project and budget duration Holidays: 23 paid vacation days plus 24th and 31st of December per our collective agreement Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona Starting date: April 2023Applications procedure and processAll applications must be made through BSC website and contain: A full CV in English including contact details A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be consideredIn accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.For more information follow this link.DeadlineThe vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.OTM-R principles for selection processesBSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.For more information follow this link.This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.", + "category" : "job" + }, + + { + "title" : "Programming model developer - COLMENA Project (RE1)", + "url" : "/jobs/bsc_programming_model_developer_colmena/", + "description" : "About BSCThe Barcelona Supercomputing Center - Centro Nacional de Supercomputación (BSC-CNS) is the leading supercomputing center in Spain. It houses MareNostrum, one of the most powerful supercomputers in Europe, and is a hosting member of the PRACE European distributed supercomputing infrastructure. The mission of BSC is to research, develop and manage information technologies in order to facilitate scientific progress. BSC combines HPC service provision and R&amp;D into both computer and computational science (life, earth and engineering sciences) under one roof, and currently has over 800 staff from 55 countries.Look at the BSC experience: BSC-CNS YouTube Channel Let’s stay connected with BSC Folks!We are particularly interested for this role in the strengths and lived experiences of women and underrepresented groups to help us avoid perpetuating biases and oversights in science and IT research.Context And MissionThe Computer Sciences (CS) department of the Barcelona Supercomputing Center aims to carry out research and development to influence the way computing machines are built, programmed and used. The Workflows and Distributed Computing group at the Barcelona Supercomputing Center aims to carry out research on programming models for distributed computing. More specifically, this group will be contributing to the COLMENA project (Spanish funded project) which contributes to the definition of next-generation computing and data technologies by proposing a framework to ease the programming, deployment and maintenance of hyper-distributed applications on the device-edge-cloud Continuum.The group will have a significant effort devoted to the definition of the COLMENA programming model and its software platform.The new programming model environment will be inspired on organic colonies: collections of autonomous individuals with heterogeneous characteristics that cooperate forming different social organizations. In this new approach, each smart device (IoT sensor/actuators, network access point/router or Edge/Cloud server) composing a cyber-infrastructure is considered as an Autonomous ageNT (ANT) aware of its own IT capabilities (data processing power, storage capacity, sensors and actuators equipped, available network interfaces, etc.) and context (geo-location, owner, etc.). In such an environment, services will be described as a society with different roles. Each role is defined by behaviour (program logic), the necessary software dependencies and the hardware requirements to play it. The role composition of such a society will be defined by a set of rules that indicate the number of players of each role. ANTs autonomously pick one or more roles to play according to its characteristics, the requirements of each role and the current role distribution. Upon their decision, they contextualize themselves downloading the necessary software and start the execution.At any point, the infrastructure may change; a new ANT can join in or leave the Colony, the service may be in a peak or valley workload moment, or a network service may be disrupted. To rapidly adapt to these changes, ANTs constantly revisit their roles and consider any possible reconfiguration that may improve the service. The goal of the project is to develop a platform to create, deploy and operate services on the device-edge-cloud continuum. A programming framework capable of reducing the complexity of programming swarms. The “roles” will be programmable through simple, high-level programming interfaces, where no low level details are exposed. The project will also develop the necessary libraries and layers to support such an interface.For this research, the group is looking for an engineer to design and implement the COLMENA programming model and software platform. The job also includes active participation in the project, attending project meetings, collaborating with partners and writing deliverables.The financing entities are the Ministry of Economic Affairs and Digital Transformation and the European Union-NextGenerationEU, within the framework of the PRTR and the MRR, all in accordance with what is established in this regard, in particular, in accordance with the provisions of article 34.2 of Regulation (EU) 2021/241 of the European Parliament and of the Council, of February 12, 2021.Key Duties Design and development of the COLMENA programming model Design and development of the COLMENA software platform Supervision of the work performed by other partners in the project Contribution to the elaboration of project reports The candidate will work closely with other research members on the team of the Workflows and Distributed Computing groupRequirementsEducation Computer science degree or similar, or a student finalizing the studiesEssential Knowledge and Professional Experience Previous experience in runtime systems and system software Knowledge of Distributed Computing Good programming skills in Java and C, and/or PythonAdditional Knowledge and Professional Experience Previous experience in distributed programming models Experience in container management platforms (Docker, Kubernetes, …)Competences Fluency in spoken and written English, while fluency in other European languages will be also valuedConditions The position will be located at BSC within the Computer Sciences Department We offer a full-time contract (37.5h/week), a good working environment, a highly stimulating environment with state-of-the-art infrastructure, flexible working hours, extensive training plan, restaurant tickets, private health insurance, support to the relocation procedures Duration: Open-ended contract due to technical and scientific activities linked to the project and budget duration Holidays: 23 paid vacation days plus 24th and 31st of December per our collective agreement Salary: we offer a competitive salary commensurate with the qualifications and experience of the candidate and according to the cost of living in Barcelona Starting date: April 2023Applications procedure and processAll applications must be made through BSC website and contain: A full CV in English including contact details A Cover Letter with a statement of interest in English, including two contacts for further references - Applications without this document will not be consideredIn accordance with the OTM-R principles, a gender-balanced recruitment panel is formed for every vacancy at the beginning of the process. After reviewing the content of the applications, the panel will start the interviews, with at least one technical and one administrative interview. A profile questionnaire as well as a technical exercise may be required during the process.The panel will make a final decision and all candidates who had contacts with them will receive a feedback with details on the acceptance or rejection of their profile.At BSC we are seeking continuous improvement in our recruitment processes, for any suggestions or feedback/complaints about our Recruitment Processes, please contact recruitment@bsc.es.For more information follow this link.DeadlineThe vacancy will remain open until suitable candidate has been hired. Applications will be regularly reviewed and potential candidates will be contacted.OTM-R principles for selection processesBSC-CNS is committed to the principles of the Code of Conduct for the Recruitment of Researchers of the European Commission and the Open, Transparent and Merit-based Recruitment principles (OTM-R). This is applied for any potential candidate in all our processes, for example by creating gender-balanced recruitment planels and recognizing career breaks etc.BSC-CNS is an equal opportunity employer committed to diversity and inclusion. We are pleased to consider all qualified applicants for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability or any other basis protected by applicable state or local law.For more information follow this link.This position is reserved for candidates who meet the requirements and have the legal status of disabled persons with a degree of disability equal to or greater than 33%. In case there are no applicants with disabilities that meet the requirements, the rest of the candidates without declared disability will be evaluated.", + "category" : "job" + }, + + { + "title" : "Postdoctoral Fellow - Bioinformatics & Computational Biology", + "url" : "/jobs/missouri_postdoctoral_bioinformatics/", + "description" : "Job DescriptionPostdoctoral Fellow - Bioinformatics &amp; Computational Biology, position in Christopher S. Bond Life Science Center, University of Missouri-Columbia. Analyze diverse types of biological data, including next generation sequencing (NGS) such as RNA-seq, single cell RNA-seq, and others, multiomics data integration and microbiome data. Prepare and publish manuscripts and reports. Develop machine learning and deep learning methods and algorithms for high-throughput biological phenotypic data, in silico hypothesis generation and predictions. Develop and maintain standalone software and web services in bioinformatics and computational biology such as IMPRes, G2PDeep and others. Contribute towards web-based SoyKB and KBCommons framework and new tools development. Build automatic workflow or pipelines for specific biological problems using HPC and cloud storage. Assist in grant and proposal writing. Coordinate or participate in collaborative bioinformatics research and training workshop and graduate course development. Manage lab resources and train, supervise and review work of other lab members and students in the lab.QualificationsMinimum Qualification Applicant must have a PhD degree in Bioinformatics, Computer Science or related field.Candidates will be evaluated on: Experience in management and supervision of lab members and graduate and undergraduate students. In-depth capabilities in understanding, implementing and developing bioinformatics data analytics tools, computational methods and algorithms, databases, web-development, multiomics data integration, modern machine learning / deep learning methods and statistics inferences algorithms and related tools. Excellence in R, Python, Perl, JAVA, SQL, MongoDB and related web development in Unix/Linux environment. Working experience in analysis of high-throughput bulk and single cell genomics, multiomics and microbiome data. Knowledge of biological databases and their application for plant and biomedical sciences. In-depth knowledge in bioinformatics and systems biology algorithms. Experiences with workflow management systems like Pegasus, Snakemake etc., High Performance Computers, Cloud storage and GPU programming. Familiarity with use of Amazon web services (AWS) resources. In-depth experience of bioinformatics problem solving, tools design and development process. Proactive team player with excellent communication and presentation skills. Application Materials Complete online application; submit CV, 3 Recommendation letters, Publications 2-3Benefit EligibilityThis position is eligible for University benefits. The University offers a comprehensive benefits package, including medical, dental and vision plans, retirement, and educational fee discounts. For additional information on University benefits, please visit the Faculty &amp; Staff Benefits website at http://www.umsystem.edu/totalrewards/benefitsDiversity CommitmentThe University of Missouri is fully committed to achieving the goal of a diverse and inclusive academic community of faculty, staff and students. We seek individuals who are committed to this goal and our core campus values of respect, responsibility, discovery and excellence.Equal Employment OpportunityEqual Opportunity is and shall be provided for all employees and applicants for employment on the basis of their demonstrated ability and competence without unlawful discrimination on the basis of their race, color, national origin, ancestry, religion, sex, pregnancy, sexual orientation, gender identity, gender expression, age, disability, protected veteran status, or any other status protected by applicable state or federal law. This policy shall not be interpreted in such a manner as to violate the legal rights of religious organizations or the recruiting rights of military organizations associated with the Armed Forces or the Department of Homeland Security of the United States of America. For more information, call the Vice Chancellor of Human Resource Services/Affirmative Action officer at 573-882-4256.To request ADA accommodations, please call the Disability Inclusion and ADA Compliance Manager at 573-884-7278.EEO IS THE LAWTo read more about Equal Employment Opportunity (EEO) please use the following links: EEO is the Law English Version EEO is the Law Spanish Version EEO is the Law Chinese VersionColumbia Missouri InformationColumbia, Mo., is known as an ideal college town, combining small-town comforts, community spirit and low cost of living with big-city culture, activities and resources. Home to nationally renowned public schools and other colleges and educational centers, Columbia is packed with restaurants and entertainment venues and hosts more than a dozen annual cultural festivals.", + "category" : "job" + }, + + { + "title" : "Researcher – Scalable, Accelerated Applications and Frameworks for Advanced Computing", + "url" : "/jobs/nrel_researcher/", + "description" : "Posting Title: Researcher – Scalable, Accelerated Applications and Frameworks for Advanced ComputingLocation: CO - GoldenPosition Type: Limited Term (Fixed Term)Hours Per Week: 40COVID-19 Safety ProtocolsEmployment at NREL is contingent upon your compliance with all NREL and U.S. Department of Energy (DOE) safety protocols and mitigation efforts directed at the COVID-19 pandemic.Working at NRELThe National Renewable Energy Laboratory (NREL), located at the foothills of the Rocky Mountains in Golden, Colorado is the nation’s primary laboratory for research and development of renewable energy and energy efficiency technologies.From day one at NREL, you’ll connect with coworkers driven by the same mission to save the planet. By joining an organization that values a supportive, inclusive, and flexible work environment, you’ll have the opportunity to engage through our eight employee resource groups, numerous employee-driven clubs, and learning and professional development classes.NREL supports inclusive, diverse, and unbiased hiring practices that promote creativity and innovation. By collaborating with organizations that focus on diverse talent pools, reaching out to underrepresented demographics, and providing an inclusive application and interview process, our Talent Acquisition team aims to hear all voices equally. We strive to attract a highly diverse workforce and create a culture where every employee feels welcomed and respected and they can be their authentic selves.Our planet needs us! Learn about NREL’s critical objectives, and see how NREL is focused on saving the planet.Note: Research suggests that potential job seekers may self-select out of opportunities if they don’t meet 100% of the job requirements. We encourage anyone who is interested in this opportunity to apply. We seek dedicated people who believe they have the skills and ambition to succeed at NREL to apply for this role.Job DescriptionThe Complex Systems Simulation and Optimization Group in the NREL Computational Science Center has an opening for a full-time professional with competencies in advanced computing simulation, applied mathematics, optimization, machine learning and/or quantum computing research who will help to enable the effective utilization of scalable accelerated algorithms, applications, software, hardware, and/or workflows on advanced computing systems in support of clean energy research. Supported research projects may come from a variety of scientific domains and backgrounds but frequently include topics from energy systems integration, wind energy, solar energy, batteries, vehicle efficiency and electrification, electrification, power systems, buildings, chemistry, material science, fluid dynamics, structural analysis, engineering analysis, optimization, machine learning, resource analysis, durability, and resilience. We are particularly interested in a researcher with a background in one of the following: enabling scientific discovery, engineering innovation and credible energy analysis relying on advanced, parallel, scalable workflows, frameworks, simulations, optimization, machine learning and artificial intelligence frameworks and workflow deployment in high performance computing (HPC) or cloud environments. We are looking for a dynamic, motivated researcher with a strong technical background and an interest in the mission of NREL.The successful candidate will collaborate with partners including NREL staff and researchers, other national laboratory staff, university researchers, and corporate partners on efforts to effectively carry out research and development from the atomic scale to the national scale utilizing NREL’s advanced computing capabilities on- and off-premises. They will be part of small teams identifying, designing, deploying, and supporting solutions for research and development on advanced, scalable, accelerated computing hardware, which may require consideration of parallel application and workflow deployment and support, cloud architectures, hardware and library performance, utilization of machine learning, and/or advanced math and programming skills.Job duties and responsibilities of the position include: Operations and Research Support: Identifying, configuring, debugging, deploying, and supporting applications and workflows on scalable, accelerated advanced computing hardware and cloud architectures centered on simulations, optimization, and machine learning. Application collaboration: Collaborate with NREL and research partners to identify, design, implement, and carry out execution of applications and workflows in clean energy research. Research: Carry out computational and domain research, developing and using advanced algorithms, mathematics, modeling, simulation, optimization, and machine learning for clean energy systems research. Community development: engage with and educate the clean energy research community through consultations, meetups, and groups to identify opportunities for ML and AI to accelerate research. Evaluate and track the state of simulation, optimization, machine learning and artificial intelligence algorithms, frameworks, and workflows and their use of advanced, scalable, accelerated, and emerging computing architectures on premise and in the cloud. Publications and presentations: Author, present, and assist in the preparation of technical papers, reports, and conference proceedings on topics.Basic QualificationsRelevant PhD . Or, relevant Master’s Degree and 3 or more years of experience . Or, relevant Bachelor’s Degree and 5 or more years of experience . Demonstrates complete understanding and wide application of scientific technical procedures, principles, theories and concepts in the field. General knowledge of other related disciplines. Demonstrates leadership in one or more areas of team, task or project lead responsibilities. Demonstrated experience in management of projects. Very good technical writing, interpersonal and communication skills.*Must meet educational requirements prior to employment start date.Additional Required QualificationsPreferred Qualifications An interest in renewable energy, energy efficiency and supporting technologies; wind, solar, vehicles, biomass, hydrogen, buildings, batteries, and electric grid technologies. Ability to quickly learn new programming languages and frameworks and adapt to changing research demands and simulation scales in a fast-paced scientific, engineering and analysis environment. Demonstrated experience developing, programming, and/or utilizing algorithms and software for advanced, scalable, accelerated Linux computing systems. Interest in simulation, optimization, machine learning and/or energy analysis on advanced computing systems and potentially quantum computers. Background and experience in one or more of the following would be a plus: Background in scalable accelerated applications. Software engineering expertise coding and testing patterns, version control and CI/CD, engineering software platforms and large-scale simulation, learning and data workflows especially using open-source tools. Managing software dependencies in HPC and Cloud environments with commons tools such as Modules, Conda, Spack, and containerization. Developing workflows, including job scheduler integration, data management of big datasets, data movement, and data availability/sharing with remote users and systems. Machine learning and artificial intelligence on scalable, accelerated computing systems. Enabling user communities through documentation of best practices and community outreach. Annual Salary Range (based on full-time 40 hours per week) Job Profile: Researcher III / Annual Salary Range: $77,600 - $139,700 Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600 Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600 Job Profile: Researcher II / Annual Salary Range: $71,300 - $117,600NREL takes into consideration a candidate’s education, training, and experience, expected quality and quantity of work, required travel (if any), external market and internal value, including seniority and merit systems, and internal pay alignment when determining the salary level for potential new employees. In compliance with the Colorado Equal Pay for Equal Work Act, a potential new employee’s salary history will not be used in compensation decisions.Benefits SummaryBenefits include medical, dental, and vision insurance; short- and long-term disability insurance; pension benefits; 403(b) Employee Savings Plan with employer match; life and accidental death and dismemberment (AD&amp;D) insurance; personal time off (PTO) and sick leave; paid holidays; and tuition reimbursement. NREL employees may be eligible for, but are not guaranteed, performance-, merit-, and achievement- based awards that include a monetary component. Some positions may be eligible for relocation expense reimbursement. Limited-term positions are not eligible for long-term disability or tuition reimbursement.* Based on eligibility rulesSubmission GuidelinesPlease note that in order to be considered an applicant for any position at NREL you must submit an application form for each position for which you believe you are qualified. Applications are not kept on file for future positions. Please include a cover letter and resume with each position application.EEO PolicyNREL is an Equal Opportunity/Affirmative Action Employer. All qualified applicants will receive consideration for employment without regard basis of age (40 and over), color, disability, gender identity, genetic information, marital status, military or veteran status, national origin/ancestry, race, religion, creed, sex (including pregnancy, childbirth, breastfeeding), sexual orientation, and any other applicable status protected by federal, state, or local laws.", + "category" : "job" + }, + + { + "title" : "Lead Full Stack Software Developer", + "url" : "/jobs/ornl_lead_software_engineer/", + "description" : "OverviewThe Data Lifecycle and Scalable Workflows Group at Oak Ridge National Laboratory (ORNL) is seeking a Full Stack Software Developer to add to our team. In this position, you will provide products and services for scientific data management at leadership-class scale. The ideal candidate is a full-stack developer that is comfortable working across multiple technologies. Prior experience with C/C++/Python, data-heavy applications, distributed systems, and microservices is preferred but not required. To be successful in this role, you must be team oriented, well-versed in computer science fundamentals, and demonstrate a drive for self-learning. Our team has a diverse skill set and are natural problem solvers who share a passion about supporting scientists and enabling new discoveries for humanity, while working on some of the most challenging problems with cutting-edge technologies.This position is part of the Advanced Technologies Section within the National Center for Computational Sciences (NCCS) Division at ORNL. NCCS has a deep legacy in High Performance Computing (HPC) operating leadership-class systems, deploying the world’s first exascale system (Frontier) and largest parallel file system. Data is at the heart of science and workflows reduce a scientist’s cognitive overhead and increase science reproducibility - the Data Lifecycle and Scalable Workflows Group tackles these challenges for supercomputing facilities.Major Duties and Responsibilities Produce software applications and science-based systems to manage big data Collaborate with other research and technical professionals to develop new capabilities that execute on ORNL’s leading data and compute infrastructures Support multiple technology projects at the same time Develop, test, and deploy distributed high-throughput services Optimize software for speed and scalability Evaluate and test software that might be deployed in the futureBasic Qualifications Bachelor’s degree in Computer Science, Software Engineering, or related field 8+ years of software development experience (an equivalent combination of education and experience may be considered) Proficiency with any of the following languages: C/C++, Go, or Python Proficiency with any front-end languages (e.g., Javascript, AngularJS, React) Experience with containers (e.g., Docker) and container orchestration (e.g., Kubernetes) Experience with version control systems (e.g., Git)Desired Qualifications 10+ years of software development Experience with back end, middleware, and front-end Experience with CI/CD practices, test methodologies Knowledge of Agile development methodologies and tools Familiarity with open-source development tools and techniques Evaluating/integrating COTS/open-source software where appropriate (we don’t have time to reinvent the wheel) Highly skilled in people management/development, team oriented, collaborative Strong problem-solving skills Ability to think critically Excellent written and oral communication skills", + "category" : "job" + }, + + { + "title" : "PhD Positions in Cloud-Edge Computing", + "url" : "/jobs/university_innsbruck_phd/", + "description" : "About the jobThe Institute of Computer Science at the University of Innsbruck, Austria seeks for excellent PhD students to carry out research in Cloud and Edge computing.Your profileYou are enthusiastic about developing and investigating innovative research ideas and systems within the discipline of distributed systems? You have a master’s or equivalent degree in computer science with excellent performance? You are a highly skilled Java programmer? You have good knowledge in programming with scripting languages? You have a strong background in distributed systems, Cloud computing and virtualization techniques? You stand out from your peers because of strong commitment and independent work? You are a team player and communicative (excellent oral and written English skills, good ability to write scientific publications)?Our offer:Successful candidates will join a dynamic, international and world-wide highly regarded research team. As fully funded PhD students they will investigate novel Cloud and Edge techniques that are built based on Java, modern virtualization methods and serverless technologies. The particular research topics of interest include application development resilient and scalable runtime systems robust, secure and service agnostic resource management, data and work distribution, scheduling and optimization serverless architectures for distributed applications AI-enabled cloud-edge framework and cognitive services dynamic allocation of cloud services, automatic discovery and composition of services, orchestration and usage of services, and programming for Cloud and Edge infrastructures.The research of these PhD positions will be conducted as part of the APOLLO (application orchestration and runtime framework for leveraging the edge-cloud continuum - https://apollowf.github.io) system. Our PhD students are given the opportunity to work with some of the most advanced Cloud, Fog and Edge infrastructures in Europe and gain interdisciplinary expertise by participating in national and international (EU funded Horizon Europe) projects. Note that the working and study language as well as the entire PhD course and research program are held in English only. There is no need to learn German for these positions.Required Skills: Java (expert programmer) Docker git and GitHub experience with cloud platforms, e.g. AWSPreferred Qualifications: Eclipse VertX google guice JUnit Gradle scripting language (e.g. python or node/typescript) TerraForm Serverless (FaaS) platform edge and IoT computing infrastructures Experience with ML/RL/DL event-driven systemsThe University of Innsbruck (UIBK):Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment. We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/fog/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralized cloud to the edge and from network and computing infrastructure up to the application layer.Innsbruck and its Environment:The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.Your application:Candidates should submit their application as soon as possible.Application documents: Motivation letter (Why does your expertise and vision fit the profile of the open PhD position? Refer to all required and preferred skills) Full CV including at least 2 references Copy of BSc and MSc degrees Transcripts for all study programs If available provide TOEFL and GRE test resultsAll documents must be submitted in English. The documents must be merged into a single zip file and sent to thomas.fahringer@uibk.ac.at (subject line: Full-time PhD Position in Cloud and Edge computing). For additional files such as theses and publications please add a link to a cloud repository and make it accessible. The candidate will receive an e-mail confirming receipt of the application.Application Process and Interview: Interviews will take place in stages as soon as possible, perhaps via zoom. Applicants are encouraged to apply immediately as the position will be filled upon finding the right candidate. We reserve the right to hold applications on file for potential future job openings.Please direct questions to:Prof. Dr. Thomas FahringerInstitute of Computer Science, University of InnsbruckTechnikerstr. 21a, A-6020 Innsbruck, AustriaEmail: Thomas.Fahringer@uibk.ac.atURL: https://dps.uibk.ac.at", + "category" : "job" + }, + + { + "title" : "PhD Positions in Cloud-Edge Computing", + "url" : "/jobs/university_innsbruck_phd_cloud_edge/", + "description" : "About the jobThe Institute of Computer Science at the University of Innsbruck, Austria seeks for excellent PhD students to carry out research in Cloud and Edge computing.Your profileYou are enthusiastic about developing and investigating innovative research ideas and systems within the discipline of distributed systems? You have a master’s or equivalent degree in computer science with excellent performance? You are a highly skilled Java programmer? You have good knowledge in programming with scripting languages? You have a strong background in distributed systems, Cloud computing and virtualization techniques? You stand out from your peers because of strong commitment and independent work? You are a team player and communicative (excellent oral and written English skills, good ability to write scientific publications)?Required Skills: Java (expert programmer) Docker git and GitHub experience with cloud platforms, e.g. AWSPreferred Qualifications: Eclipse VertX Google Guice JUnit Gradle scripting language (e.g. python or node/typescript) TerraForm Serverless (FaaS) platform edge and IoT computing infrastructures Experience with ML/RL/DL event-driven systemsEnglish language skills:If you apply for a PhD study in computer science at UIBK, you must prove English language skills at level B2 of the Common European Framework of Reference for Languages (CEFR) at the time of application. For more information refer to this document (search for “Language of instruction English “)Our offer:Successful candidates will join a dynamic, international and world-wide highly regarded research team. As fully funded PhD students they will investigate novel Cloud and Edge techniques that are built based on Java and modern virtualization methods. The particular research topics of interest include robust, secure and service agnostic resource management, data and work distribution, serverless architectures for distributed applications AI-enabled cloud-edge framework and cognitive services dynamic allocation of cloud services, automatic discovery and composition of services, orchestration and usage of services, scheduling and optimization, resilient and secure runtime environments, application development environments, and programmingfor Cloud and Edge infrastructures.The research of these PhD positions will be conducted as part of the APOLLO (application orchestration and runtime framework for leveraging the edge-cloud continuum). Our PhD students are given the opportunity to work with some of the most advanced Cloud and Edge infrastructures in Europe and gain interdisciplinary expertise by participating in national and international (EU funded H2020) projects. Note that the working and study language as well as the entire PhD course and research program are held in English only. There is no need to learn German for these positions.The University of Innsbruck (UIBK):Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment (https://apollowf.github.io). We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralized cloud to the edge and from network and computing infrastructure up to the application layer.Innsbruck and its Environment:The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.Your application:Candidates should submit their application as soon as possible.Application documents: Motivation letter (Why does your expertise and vision fit the profile of the open PhD position?) Full CV including at least 2 references Copy of BSc and MSc degrees Transcripts for all study programs If available provide TOEFL and GRE test resultAll documents must be submitted in English. The documents must be merged into a single PDF file and sent to thomas.fahringer@uibk.ac.at (subject line: Full-time PhD Position in Cloud computing). For additional files such as theses and publications please add a link in the submitted pdf to a cloud repository and make it accessible. The candidate will receive an e-mail confirming receipt of the application.Application Process and Interview: Interviews will take place in stages as soon as possible, perhaps via Skype. Applicants are encouraged to apply immediately as the position will be filled upon finding the right candidate. We reserve the right to hold applications on file for potential future job openings.Please direct questions to:Prof. Dr. Thomas FahringerInstitute of Computer Science, University of InnsbruckTechnikerstr. 21a, A-6020 Innsbruck, AustriaEmail: Thomas.Fahringer@uibk.ac.atURL: https://dps.uibk.ac.at", + "category" : "job" + }, + + { + "title" : "Postdoctoral Research and Teaching Position in the field of Cloud-Edge Computing", + "url" : "/jobs/university_innsbruck_postdoctoral_researcher/", + "description" : "About the jobThe Institute of Computer Science at the University of Innsbruck, Austria, invites applications for a POSTDOCTORAL RESEARCH AND TEACHING POSITION IN THE FIELD OF CLOUD-EDGE COMPUTING.This position will start on February 1, 2023 or as early as possible thereafter and it will run for 6 years.Candidates with good background in distributed, cloud and edge computing and interested in one of the following research areas for cloud-edge infrastructures are encouraged to apply: programming APIs and application development for the cloud-edge continuum scalable, resilient and autonomous runtime systems resource management and provisioning serverless architectures for distributed applications distributed data management AI-enabled cloud-edge framework and cognitive services discovery, provisioning, orchestration and usage of edge-cloud services scheduling and optimization for energy efficiency, economic cost, and performance Quality of Service (QoS) provisioning and Service Level Agreements (SLA)Prerequisites:Applicants must hold a doctoral degree in computer science or in a similar field. Applicants must be willing to teach courses in English in distributed systems and programming both in bachelor and master degree programs. Furthermore, excellent written and oral communication skills in English as well as team and communication skills are expected.Required Skills: Java (expert programmer) Docker git and GitHub experience with cloud providers, e.g. AWSPreferred Qualifications: Eclipse VertX google guice JUnit Gradle scripting language (e.g. python or node/typescript) TerraForm Serverless (FaaS) platform edge and IoT computing infrastructures Experience with ML/RL/DL event-driven systemsProfile of our group:The Distributed and Parallel Systems Group (DPS) of the Institute of Computer Science focuses on simplifying the effective use of heterogeneous multiprocessor architectures and geographically distributed resources (including Cloud-Edge infrastructures), which will provide the basis for the next generation of AI-enabled performance-oriented applications. Our main research system is APOLLO (https://apollowf.github.io).Appointment:The appointment is for six years full-time employment but can also be shorter if preferred by the applicant. The employment will start at 2023-02-01, or as otherwise agreed. The position comes with a competitive salary and opportunities for teaching (up to 20% of full-time). The annual gross salary for this position is € 60.000,-Note that the working language and the research program is in English only. There is no need to learn German for this position.About the University of Innsbruck (UIBK):Founded in 1669 with several Nobel Prize winners, today the University of Innsbruck is the largest educational institution in Western Austria ranked as an international top-200 University in Computer Science. UIBK has a long history in distributed systems, and has been involved in a substantial number of national and international distributed systems projects. We are developing the Apollo application development and computing environment (https://apollowf.github.io). We have coordinated several EU projects on distributed and parallel systems including the edutain@grid, AllScale and the ENTICE project. We are currently investigating the cloud/fog/edge continuum which is changing from a pure elastic provisioning of virtual resources to a transparent and adaptive hosting environment that fully realizes the “everything as a service” provisioning concept, from centralised cloud to the edge and from network and computing infrastructure up to the application layer.Innsbruck and its Environment:The City of Innsbruck, which hosted the Olympic winter games twice, is located in the beautiful surroundings of the Tyrolean Alps. The combination of the Alpine environment and the urban life in this historically grown town provides a high quality of living.How to apply:Candidates should submit their application as soon as possible but no later than January 31, 2023.Application documents: Motivation letter (Why does your expertise and vision fit the profile of the open position? explicitly refer to the required and preferred skills) Full CV including at least 2 references Copy of BSc, MSc and PhD degrees Transcripts for all study programsAll documents must be submitted in English. The documents must be merged into a single PDF file and sent to thomas.fahringer@uibk.ac.at (subject line: Postdoc Position in Cloud-Edge Computing). For additional files such as theses and publications please add a link in the submitted pdf to a cloud repository and make it accessible or use WeTransfer. The candidate will receive an e-mail confirming receipt of the application.Direct questions to:Prof. Dr. Thomas FahringerInstitute of Computer Science, University of InnsbruckTechnikerstr. 21a, A-6020 Innsbruck, AustriaEmail: Thomas.Fahringer@uibk.ac.atURL: https://dps.uibk.ac.at", + "category" : "job" + }, + + + { + "title" : "Workflows Education: Underlying Computer Science Concepts", + "url" : "/stories/2022/05/16/workflow-education/", + "description" : "Workflow applications have become mainstream in many domains, including most of the sciences, engineering, as well as AI. It is thus crucial that educational and training opportunities be available to help grow an effective workflow workforce. Several institutions have already developed and made available training material for particular workflow systems, so that users can learn how to deploy and execute their workflow applications on hardware platforms on which these systems are installed. Less developed, but no less crucial, are pedagogic materials that target the fundamental concepts necessary to understand workflow applications and reason about their executions and the performance thereof. One of the reasons why these pedagogic materials are less developed is that many of the relevant concepts belong to “standard” parallel and distributed computing (PDC) topics, and it is assumed that these topics are already covered in university computer science curricula.This assumption is problematic for several reasons. First, it is well recognized that PDC is not sufficiently included in undergraduate computer science curricula, which has motivated the establishment of the NSF/IEEE-TCPP Curriculum Initiative on Parallel and Distributed Computing. Although progress is being made, many computer science college graduates still do not have sufficient, or any, PDC exposure. Second, many potential members of the workflow workforce will not be computer science graduates. Third, even if students have been taught the relevant concepts at different times throughout their education, they may not have retained them effectively. There is a thus need for a one-stop, self-contained ``these are the concepts needed for being able understand and reason about workflow executions” pedagogic package. This content of this package should draw from multiple sources, and should be curated and vetted by the Workflow Community Initiative. Its main use would be to provide “prerequisite concepts you need to know for workflows” to students (as a complement to or a component of university courses, before starting a workflow-related internship, before engaging on graduate-level workflow-related projects, etc.) and professionals (e.g., before beginning to use workflows, to better understand workflow behavior and performance in various professional contexts).NSF/IEEE-TCPP Curriculum Initiative on Parallel and Distributed Computing.A project that could provide useful components to include in this envisioned pedagogic package is EduWRENCH. EduWRENCH provides many pedagogic modules, each one including a pedagogic narrative, practice questions, open questions, and in-the-browser simulation-driven activities. Basic EduWRENCH modules target fundamental concepts of computation, I/O, and networking and explain how they drive application performance. Some modules focus on principles of parallel computation on multi-core machines, including notions of parallelism, speedup, efficiency, overhead, and load balancing. Other modules focus on principles of distributed computation over a network, including notions of data proximity. Several more advanced build on the aforementioned modules to teach workflow concepts and/or to use workflows as case-studies for more advanced topics such as scheduling, energy efficiency, etc. Most EduWRENCH modules have already been used effectively not only in university courses, but also to train beginning graduate students who are about to join a workflow research and development group. EduWRENCH by no means provides a comprehensive pedagogic package for workflows, but it may serve as a good starting point for the Workflow Community Initiative to define what such a package should and should not contain.EduWRENCH website.", + "category" : "story" + }, + + { + "title" : "A quick overview of Nextflow workflow system", + "url" : "/stories/2022/09/28/nextflow/", + "description" : "Workflow management systems are as diverse as the business and scientific processes they support – from engineering to research to process automation. This article describes Nextflow – an open-source workflow manager widely used in life sciences. It covers the motivations behind Nextflow, explains what it is, and describes what the future holds for the platform.Background and MotivationsLike similar open source efforts, Nextflow was born out of a need to solve specific problems while I was working as a research engineer in the Comparative Bioinformatics labs at the Centre for Genomics Regulation (CRG). Researchers were struggling with several issues that are all likely too familiar to workflows community members – complex, buggy scripts, long-running workflows that would suddenly fail, and challenges monitoring, managing, and maintaining workflows.While there were several available workflow managers at the time, none of them specifically addressed our requirement. A fundamental challenge in the lab at that time was data handling. Comparative bioinformatics involves studying genome and protein sequences across species, and population-level studies can involve massive amounts of data. We needed a simple yet powerful framework to deploy the executions of thousands of tasks, comparing different alignment methods and protein sequences each other.Some Key Ideas Behind NextflowNextflow was designed from scratch having clear in mind key ideas and best practices: Allow developers to reuse any existing piece of software without the need of intermediate interface or wrapper; the tool command line is the interface and Linux is the integration layer. Manage tasks as a functional and self-contained unit of work. This was a key requirement to enable the deployment across heterogeneous computing platforms and allow auto-retry execution policy on failure. Provides a high-level abstraction for tasks parallelisation that allows developers to write simple yet high-scalable application, without the need to struggle with low level problem such as race conditions and locks to access shared resources. Strongly decouple the scientific application logic from the configuration &amp; deployment setting, in order to streamline the deployment across different platforms and enable the migration to cloud environments. Remove unnecessary dependencies with external services and databases. We wanted a zero configuration experience both for the Nextflow runtime and the resulting pipelines. Enable debugging and recovering of failed executions. Bioinformatics pipeline can spin the execution of tens of thousands tasks. If something breaks we need a strategy that would allow the debugging of the failed task independently of the rest of the pipeline, and make it possible to recover the computation once the problem was solved from the last successfully computed tasks, to avoid throwing away days of computing resources.Between these, very likely, the most important design choice that distinguishes Nextflow compared to other workflow management systems is the adoption of the data flow programming paradigm.We often imagine workflows as a sequence of steps designed from the top down and including various dependencies, decision points, and sub-flows. There is another way to envision workflows, however, and that is from the perspective of the individual process steps. Individual steps have no notion of the overall flow. They have an input, perform some processing, and write data to an output, typically another step in the workflow.Using this programming model you can think a workflow behaving like spreadsheet. In a spreadsheet, users enter expressions in cells that depend on calculations in other cells. The dependencies between cells can be complex, but users don’t think about how the spreadsheet will sequence calculations. Instead, they concentrate on the logic in each cell. When a cell changes, the spreadsheet worries about how to propagate changes to dependent cells. Nextflow is described as reactive because task execution is triggered when inputs change or become valid. It turns out that this model works surprisingly well at scale, and opportunities for parallelism occur naturally without the workflow designer needing to think about them.From a technical point of view, Nextflow processes (aka tasks) can be thought of as reactive agents which run in parallel waiting for the input data that trigger their execution. It’s important to highlight that each of these processes are isolated from each other, and they can only communicate via asynchronous messages represented by dataflow variables.Along with these, another pillar component of Nextflow was the adoption of containers as a core feature of the framework. Nextflow abstracts away the containerisation of the pipeline execution in a declarative manner. This means the user is only required to specify the container that needs to be used to run specific workflow tasks. Nextflow takes care to use this information to run the task within the container depending on the target execution platform that can be, for example, AWS Batch, an HPC batch scheduler e.g. Slurm or a local computer. This choice was proven to be critical to enable the portability and reproducibility of the resulting data analysis workflow. Nextflow nowadays supports multiple container runtime technologies, including Docker, Podman, Singularity, Charliecloud among others.Nextflow TodayWhen Nextflow was launched as an open-source project in 2013, we couldn’t have imagined what it has become today. Today, Nextflow is downloaded over 55,000 times monthly and used by over 1,000 organizations, including some of the world’s largest pharmaceutical firms. Ideas like containers and support for source code managers (SCMs) are so thoroughly baked into Nextflow’s design that they seem commonplace.In Nextflow, we were careful to decouple workflow logic from the details of underlying computing environments. To achieve this, Nextflow supports an abstraction called an Executor. Executors are pluggable components that enable pipelines to run without modification across virtually any compute environment, from a local host to an on-prem HPC cluster to various cloud services. Shifting to a new compute environment is as simple as changing a few lines of code in a configuration file.Pipelines can be stored locally or pulled from a preferred SCM at runtime. While applications can still be installed locally, pulling containers encapsulating bioinformatics tools has become the norm. Nextflow handles all the details, including compute resources, data movement, and making datasets visible to containers at runtime. Intermediate results and data are also cached, making flows resilient and recoverable after a failed step.The nf-core CommunityThe nf-core community launched in 2018 marked a key milestone for the Nextflow community. nf-core is an independent effort to collect a curated set of analysis pipelines built using Nextflow. Significant effort has gone into developing tools, templates, and guidelines that enable domain experts to contribute to the community. The result is a set of high-quality pipelines that are portable, reproducible, fully documented, and cloud-ready. A recent State of the Workflow 2022 community survey showed that 62% of Nextflow users take advantage of these pipelines in their day-to-day research – a testament to their utility and the importance of this effort.Towards the FutureWe are fortunate to have vibrant user and developer communities actively engaged in Nextflow and helping to guide its evolution. We continue to support new computing environments, introduce new functionality, and improve throughput and scalability. I recently shared some plans for Nextflow in the article Evolution of the Nextflow runtime.We are also planning to further enhance the support for containers providing a better automation on the overall container management lifecycle and ease the provisioning of multi-containers required by modern data analysis pipelines.We are also improving our commercial Tower offering enabling improved collaboration, new data-related features, and features aimed at helping further optimize resource usage to reduce cloud spending.You can learn more about Nextflow or download it for free by visiting nextflow.io. Existing Nextflow users can test-drive Nextflow Tower in the cloud at tower.nf.", + "category" : "story" + }, + + { + "title" : "Widening Workflows usage: the eFlows4HPC project", + "url" : "/stories/2022/09/29/eflows4hpc/", + "description" : "The European High-Performance Computing Joint Undertaking (EuroHPC JU) aims at developing a World Class Supercomputing Ecosystem in Europe and, with this goal, is procuring and deploying pre-exascale and petascale systems in Europe. These systems will be capable of running large and complex applications. In this sense, the demand from the application stakeholders includes not only aspects related to High-Performance Computing (HPC) but also artificial intelligence (AI) and data analytics.The eFlows4HPC project has as objective to provide a software stack that makes easier the development of workflows that involve HPC, AI and data analytics components. The project aims to give support to dynamic workflows in the sense that the set of nodes in the graph of the workflow can change during its execution due to changes in the input data or context of the execution, and be reactive to events that may occur. The runtime systems supporting this execution should be able to perform efficient resource management, both in terms of time and energy.Another objective of the project is to provide mechanisms to make the use and reuse of HPC easier by wider communities. For this purpose, the HPC Workflows as a Service (HPCWaaS) methodology has been proposed. The goal is to provide methodologies and tools that enable sharing and reuse of existing workflows, and that assist when adapting workflow templates to create new workflow instances.eFlows4HPC software stack.The eFlows4HPC software stack includes components to develop the workflows at three levels: high-level topology of the workflows using extended TOSCA, required data transfers with the Data Logistic Pipelines and the computational aspects of the workflow with PyCOMPSs. Once a workflow has been developed, it is registered in the Workflow Registry. Similarly, the different components of the workflows, pre-trained AI models and data sets are registered in a set of catalogues and repositories. All these registries and catalogues are used by the HPCWaaS interface, which provides a REST API to deploy and execute the workflows. On execution, the stack also provides a set of runtime libraries to support the workflow execution and data management.HPCWaaS methodology.The eFlows4HPC developments are demonstrated in the project through three pillar applications in the areas of digital twins for manufacturing, climate modeling and prediction and urgent computing for natural hazards. Pillar I deals with the construction of digital twins for the prototyping of complex manufactured objects integrating state-of-the-art adaptive solvers with machine learning and data-mining, contributing to the Industry 4.0 vision. Pillar II develops innovative adaptive workflows for climate and for the study of tropical cyclones in the context of the CMIP6 experiment, including in-situ analytics. Pillar III explores the modelling of natural catastrophes – in particular, earthquakes and their associated tsunamis shortly after such an event is recorded.Coordinated by the Barcelona Supercomputing Center (BSC), the eFlows4HPC consortium comprises 16 partners from seven different countries with expertise in technical aspects: supercomputing and acceleration, workflow management and orchestration, machine learning, big data analytics, data management, and storage; together with expertise in the pillar workflows’ areas: manufacturing, climate, urgent computing.The initial results of the project are available under the project website in its deliverable section (see https://eflows4hpc.eu/deliverables/). The source code and documentation are publicly available as well (see https://github.com/eflows4hpc and https://eflows4hpc.readthedocs.io/en/latest/).", + "category" : "story" + }, + + { + "title" : "Covalent: Workflow Orchestration on Highly Heterogeneous Infrastructure", + "url" : "/stories/2022/10/24/covalent/", + "description" : "Workflow orchestration is a common operations framework in the field of distributed computing. As high performance computing (HPC) becomes more distributed and incorporates a greater degree of heterogeneous technologies, workflow orchestration will no doubt become a common practice in this space, as it has in adjacent spaces such as Machine Learning Operations (MLOps) and more recently in quantum computing. Users with repeatable sets of interdependent tasks (workflows) may wish to run them on a time-based schedule or, more commonly in research and development, they may wish to iterate on the design of one or more experimental workflows. This iteration can include different algorithms, different model hyperparameters, different compute backends, or even different compute frameworks entirely. With these options, it is increasingly possible to construct and optimize workflows which span across multiple on-premises supercomputers, multiple clouds, and even emerging technologies such as quantum computers.While so many options are a delight to workflow architects, they pose real challenges for operations. How are credentials managed and conveyed across such systems? How do researchers ensure workflow data pipelines are efficient and secure? How are logical tasks broken apart and rejoined (“packed”) to optimize information transfer across physically distant systems? When something fails, how easy is it to trace back errors across frameworks and to re-run portions of a workflow? There are certainly many other such challenges that workflow practitioners are familiar with.Covalent unifies tasks written in different languages and with heterogeneous compute requirements.Covalent is Agnostiq’s answer to these challenges. With roots in quantum computing applications, Agnostiq researchers quickly learned that the operational challenges in quantum research today consume the majority of a project’s time. Covalent was developed primarily to manage experiments and facilitate access to cloud compute resources for researchers with little or no cloud engineering background. Today, users can interact with a large variety of cloud resources – including Batch, Kubernetes, and Braket Hybrid Jobs – using Covalent’s AWS Plugins package.The release of a Slurm plugin further enabled our team to interact with partners’ supercomputing resources, in particular in federated or hybrid-cloud configurations. Such flexibility is increasingly in demand as scalability begins to hit a power-consumption barrier, and as more HPC vendors and users begin to incorporate cloud and other distributed compute platforms. As we realized these tools can benefit more than our organization, we decided to transform Covalent into a product in its own right, and to open-source the software on GitHub in January 2022.Covalent’s user interface enables users to easily visualize and interact with distributed workflows.Quantum computing, of course, introduces its own set of unique needs. Firmly rooted as a heterogeneous technology from the outset, quantum computers today mainly run Noisy Intermediate-Scale Quantum (NISQ) algorithms which are variational, or hybrid, in nature. These algorithms require classical and quantum resources working in tandem. Whereas traditional HPC workflows often involve loosely coupled tasks spanning many hours or days in a single location, variational quantum workflows are tightly coupled, with timescales sometimes under a single second per task. Since classical and quantum resources may not necessarily be physically located in the same data center, most of the execution time may in fact arise due to data transfer and requeuing – often thousands of times per workflow. A remedy to this requires collaboration among many parties in order to optimize the user experience and maximize hardware occupancy. With Covalent at the center of this conversation, Agnostiq hopes to stimulate a new discussion around how we think about workflows in highly heterogeneous environments.Users and providers interested in learning more about Covalent can view the source code on GitHub, join the Covalent Slack channel, follow us on Twitter, or reach out to the team for more information at contact@agnostiq.ai. We also welcome open-source contributions and discussions on GitHub. If you like what we are up to, please show your support by starring our repository.", + "category" : "story" + }, + + { + "title" : "The Elephant in the Data Center – Energy Consumption of Workflow Executions", + "url" : "/stories/2023/01/13/elephant-in-the-data-center/", + "description" : "The execution of scientific workflows consumes electric energy – and often quite a lot as workflow systems usually are employed especially for large data sets, complex analysis tasks, and distributed execution over sizeable compute clusters. While techniques to reduce this consumption have been researched for decades, they currently reach a new level of urgency, as energy costs skyrocket (at least in Europe) and the world more and more acknowledges that the era of low-cost energy production from carbon-heavy fuels will have to come to an end. Thus, it is high time for any workflow researcher and workflow user to ask herself – what can we do to save energy? The answer to this question has multiple facets.The classical response is “increasing efficiency of software and hardware”, and research in the past has almost exclusively focused on this idea. Efficiency in terms of energy can intuitively be understood as processing output per watt; increasing efficiency thus means producing more output for the same amount of energy or producing the same output at less energy (or, in an ideal world, both). Techniques typically focus on the latter, for instance by developing more energy-efficient algorithms (e.g. joule sort) or using more energy-efficient hardware (e.g. GPUs or FPGAs) for specific problems. More recently, the same idea is followed by works in machine learning, trying to achieve the same accuracy of predictions with much smaller models, which require less energy for training and application.However, from the perspective of a large data center, these approaches all too often fail to actually save energy, simply because a data center typically always runs at full load – no matter how many efficiency-enhancing tricks are applied. When codes get more efficient, a given analysis is finished in less time (thus requiring less energy), yet the freed time is typically not used to power down the cluster, but rather to run some other analysis that otherwise might not have been prioritized; in commercial clouds, such idle times are sold over the spot market. From a purely economic point of view, this historically made a lot of sense, as acquiring a cluster was much more expensive than running it (ignoring the cost of human administration which must be paid at a constant rate anyway), and thus all clusters should be used to their maximum degree to achieve a good return on investment. At this point we must notice the important difference between “increasing energy efficiency” and really “saving energy”: More efficient algorithms achieve the former but not the latter when the point of view is widened from a single workflow execution to a data center perspective.A similar effect can be observed with more energy-efficient hardware. Clearly, a data center built with modern low-energy chips can perform the same computation as one built with older high-energy chips at less energy, yet this effect is typically out-weighted by the trend that data centers simply become bigger and bigger and thus consume more energy again – an instance of Jevons Paradox. A similar effect exists with cars, where the average fuel consumption has been reduced only marginally over the last 20 years, despite the fact that more and more efficient engines were developed, simply because these are built into ever larger and heavier cars.The local perspective – developing individual workflowsNow – what can workflow research do to save energy and cost? From a single-workflow perspective, there are a few obvious measures along the line we just discussed. We can save energy by using more efficient codes and by running the workflow on more efficient hardware. We can save cost by energy-aware scheduling, i.e., running the workflow in times when energy is cheaper, thus exploiting price differences offered by the local energy provider; in the future (and partly already in the presence), it is quite conceivable that energy prices will become cheaper whenever it is produced in abundance, for instance by solar collectors on sunny or wind power plants on windy days, or when consumption is low, for instance at night and in summer. Even if such scheduling may not save lots of money, it would certainly help to reduce carbon emissions by trading “bad” energy for “better” energy.However, there are also less obvious measures for saving energy (and money), which revolve around the concept of “output” of a workflow. So far, we implicitly assumed that a workflow is a fixed set of computations turning some input data into a computational result. However, that is a very computer-science focused point of view – most users are much more interested in the scientific result than in the specific computation that was performed to produce it. This leads to the question whether we cannot have the same, or almost the same, scientific result with less computation? The answer very often is: Yes. One example was already mentioned before, i.e., the usage of smaller and thus lower-energy models in machine learning. However, in many types of analysis, many more ideas can be followed. For instance, classification or regression tasks often are evaluated in a k-fold cross-validation. The larger the k, the more energy is required, as k-fold cross-validation performs k rounds of training and testing. Thus, choosing smaller k’s typically saves energy; the price might be a less robust result. In NLP, training and fine-tuning in many tasks already have become so expensive that typical evaluations dropped the idea of cross-validation and use a single test partition instead; apparently, the “price” has been accepted by the community. Bootstrapping or Monte-Carlo-style analysis methods perform the same type of computations tens of thousands of times to achieve robust results; reducing the number of repetitions leads to a linear decrease in energy consumption, again at the cost of less robust results. Hyperparameter optimization also performs model training and evaluation repetitively with slightly different inputs (e.g. using grid search or Bayesian methods); again, reducing the number of runs leads to a linear decrease in energy consumption, at the peril of not finding a better parameterization and thus not having the best possible result. Iterative model improvements are pushed to their extremes in projects around AutoML, which often boil down to a hilarious number of trial and error computations with varying algorithms, input sets, hyperparameters, etc. Finally, sampling is a ubiquitous technique to reduce the computational cost of studying very large data sets; of course, smaller sample sizes also reduce energy costs. Note that none of these ideas leads to a provable “non-optimal” solution, but solutions typically improve (slightly) with more iterations or more samples; a workflow developer thus always has to decide at which point to stop. Probably, energy consumption should and will soon be a strong argument for stopping earlier; and the community should start accepting this argument when reviewing papers or project grants. An important start could be that we all start to report energy consumption figures with our analysis.The global perspective – data centers running multiple workflowsWhat can a data center do to save energy or reduce energy costs? The most obvious measure is to reduce services, for instance by switching off a cluster partly or entirely. This clearly is an extreme action that probably no data center manager will favor (unless forced to after comparing the electricity bills with the available funding); however, it will undoubtedly immediately save energy and energy costs at the same time. A less drastic and popular measure is to use DVFS techniques, which possibly leads to losing some performance, or to switch to more energy-efficient hardware. Especially the latter, however, again carries the danger that pressure is growing to invest the savings in energy in extensions of the cluster (see above), as long as the bill still can be paid, which will deprive the energy savings. Furthermore, one must not forget the resources necessary to build the hardware of the cluster; using existing hardware (and not replacing it) as long as feasible can actually be a proper means to save energy, even if a new generation of hardware might be more energy-efficient than the present one. Finding the sweet spot within this trade-off is the daily business of data center managers and currently shaken due to the changing proportions of costs for acquisition, maintenance, and operation.Another option is to put more effort into avoiding redundant computation across multiple workflows. In many fields of science, certain reference data sets exist that are used by many groups; examples in the life sciences are large genome data sets, e.g. The Cancer Genome Atlas, examples in remote sensing are series of images from satellites like LandSat; examples in astronomy are the images from large sky observations like the Sloan Digital Sky Survey. These data sets are typically published in a raw format, yet many downstream analyses require some form of pre-processing that is often very similar or even completely identical across multiple workflows. Performing such processing only once can save substantial energy, it requires either careful consultation of users or automatic means to identify identical computations across workflows; in a long-term vision, such pre-processing could even be shared across multiple data centers, not just multiple workflows. However, it must not be forgotten that keeping results for further access also costs energy (as long as it is not written to tape archives) to keep memory powered, SSDs responding, or disks spinning. Intelligent research data management and advanced workflow optimization thus can play an important role in saving energy.Putting it all together – turning every screwThe necessity for saving energy and energy cost is no longer a topic of the future or important only in small niches – it has become an urgent need for all of us now. This also affects workflow research and research performed with workflows, as executing workflows is particularly energy hungry. We discussed several approaches to these problems that differ in their focus (saving energy versus saving money) and their scope (individual workflows versus data centers). There are surely many more ideas than presented in this short commentary; we would be eager to learn about them, for instance by personal mail (leser@informatik.hu-berlin.de).From a 10,000-feet perspective, the approaches can all be considered variations of a common theme, extending the classical trade-off in high-performance computing (i.e., compute time versus compute costs) with a crucial third factor: energy consumption. We believe that this more complex landscape requires new lines of research in diverse areas such as scheduling, research data management, heterogeneous architecture, monitoring, and workflow optimization – now.", + "category" : "story" + }, + + { + "title" : "SmartSim: Combining Machine Learning and HPC Workflows", + "url" : "/stories/2023/04/02/smartsim/", + "description" : "Machine learning (ML) algorithms have been successfully applied to a wide variety of commercial applications. However, adoption of ML in traditional high performance computing (HPC) applications has lagged other segments because of differences in software ecosystems and cluster management tools. Specifically, these applications are typically written in Fortran, C, and C++ and leverage OpenMP and/or MPI parallelization to extract peak performance on HPC platforms. On the other hand, ML toolkits are generally Python-based. Moreover, HPC systems use advanced workload managers to schedule and manage bare-metal jobs. The SmartSim library (https://craylabs.org) was developed by Cray and HPE to overcome these challenges and help users create novel HPC workflows that mesh modern data science with machine learning capabilities.SmartSim OverviewSmartSim is an open-source software package developed by Hewlett Packard Enterprise (HPE) that helps users combine traditional engineering, scientific, and high-performance computing applications with machine learning tools and visualization packages. Internally, SmartSim consists of two libraries: an infrastructure library and a client library. The infrastructure library’s API enables users to configure scientific applications and to define and launch experiments (potentially including ensembles of simulations). As part of the machine learning infrastructure, SmartSim launches an in-memory database accessible across all applications in the workflow. Machine learning models can be executed inside the database or data can be streamed out of it for visualization and training. Machine learning infrastructure can be launched on CPU, GPU, or multi-GPU compute nodes, and the SmartSim library has features to help users achieve maximum workload throughput with all of these systems. SmartSim supports launching user-described workflows on several HPC workload managers including Slurm, PBS, LSF, and Cobalt. SmartSim also allows users to launch workflows locally on MacOS or Linux systems.The SmartSim client library, for its part, provides interfaces that can be embedded into any Fortran, C, C++, or Python application. With these clients, applications can transfer data to and from the in-memory database and they can execute ML tasks (such as inference) on this data. Also, because the database is accessible by all component applications in the workflow, data can be streamed into and out of the database for online analysis and ML model training. Further, the client library offers optimized aggregation methods that retrieve data from the database for tasks such as online visualization and online training. The SmartSim client library needs only a TCP/IP connection to communicate with the database so it is highly portable.Sample experiment showing a workflow with machine learning infrastructure launched by SmartSim and connected to online analysis and visualization via the in-memory database.SmartSim Usage Example: Embedding ML to Improve the Accuracy of Ocean ModelingWithin the oceanographic community, the behavior of the water in oceans is simulated via ocean general circulation models (OGCMs). OGCMs use the Navier-Stokes partial differential equations (PDEs) to represent the laws of conservation of mass, momentum, and energy. Parameterizations added to these PDEs account for physical processes that occur at scales smaller than the model grid, but their unconstrained use can violate the conservation laws. Modern ocean modeling theory considers eddy energy (EKE) to be a critical variable in these parameterizations. The current state of the art numerically solves a PDE that describes EKE; however, the estimation or omission of a number of terms leads to significant errors. To improve the quality of OGCMs, collaborators from HPE, the Canadian Centre for Climate Modelling and Analysis, and the National Center for Atmospheric Research (NCAR) used a data-driven approach with machine learning to replace the EKE PDE. SmartSim is the key technology that allowed this ML model to be meshed with existing OGCMs. As a result of these efforts, we were able to improve the simulation accuracy without impeding performance in large-scale climate simulations.In this work, we evaluated the results of our ML approach to the numerical approach using the Modular Ocean Model version 6 (MOM6). We compared the EKE estimated by each approach to the baseline EKE calculated by a third ‘eddy-resolving’ (ER) simulation with a spatial resolution of about 10 kilometers. This resolution is sufficient to resolve mesoscale eddies (turbulence) in the equator and mid-latitudes, but it is computationally expensive. The other two configurations coarsen the spatial resolution to 25 kilometers, which places them into an ‘eddy-permitting’ regime where modeling the impact of eddies on the rest of the simulation requires turbulence parameterization. The coarser configurations differ only in their eddy parameterization models: one uses the Mesoscale Eddy Kinetic Energy (MEKE), which represents the current state-of-the-art. The other uses “SmartSim-EKE”, which is based on a neural network trained to infer the eddy kinetic energy.In our demonstration, we used SmartSim’s ensemble capabilities to run 12 parallel SmartSim-EKE simulations thereby demonstrating the scalability and performance of SmartSim. In so doing we were able to evaluate the accuracy of EKE parameterizations, and estimate overall computational cost at scale. We computed each ensemble member for 10 simulated years on an aggregate total combining 10,920 Intel Skylake and Cascadelake processors cores along with 16 Nvidia P100 GPUs dedicated to the shared in-memory database. Figure 2 summarizes the MOM6 ensemble workflow and the translation of SmartSim workflow descriptions to launched jobs on the hardware cluster.Summary of MOM6 workflow developed with SmartSim.We compare SmartSim-EKE and MEKE to the “true” EKE calculated from ER in the images below. As shown in Figures 3 and 4 below, SmartSim-EKE tends to overestimate the extent of the equatorial (0 latitude) EKE, but otherwise provides a much more accurate predictions of large-scale trends compared to the MEKE state-of-the-art predictions. Importantly, these gains in accuracy from the SmartSim-EKE ML model did not incur significant computational penalties relative to the state-of-the-art. Specifically, we observed only a 1.5% slowdown in the simulation – negligible on modern systems with heterogeneous compute nodes and higher GPU counts. These results show that machine learning infused into traditional HPC workloads can provide significant improvements in accuracy and/or performance. Moreover, SmartSim enabled these ML-driven gains without extensive changes to the HPC application source code or requiring maintenance of a one-of-a-kind ML infrastructure. More detailed information on the accuracy and performance of this SmartSim use case can be found in the Journal of Computational Science (https://doi.org/10.1016/j.jocs.2022.101707).Eddy kinetic energy (EKE), averaged over the last year of each simulation, calculated from the most-accurate eddy-resolving (ER) simulation (a), inferred using SmartSim-EKE and averaged over all 12 ensemble members (b), and the current state-of-the-art MEKE parameterization (c).Zonally averaged EKE (on a log10 scale) as a function of latitude from the ER, SmartSim-EKE, and MEKE. Note that within 20 degrees of the equator MEKE computes a near-zero value for EKE.To stay up-to-date on new SmartSim features and release, please favorite (star) the SmartSim GitHub repository: https://github.com/CrayLabs/SmartSim.", + "category" : "story" + }, + + + { + "title" : "XLOOP 2024 (Workshop)", + "url" : "https://wordpress.cels.anl.gov/xloop-2024/", + "description" : "6th Annual Workshop on Extreme-Scale Experiment-in-the-Loop Computing", + "category" : "event" + }, + + { + "title" : "WORKS 2024 (Workshop)", + "url" : "https://works-workshop.org/", + "description" : "19th Workshop on Workflows in Support of Large-Scale Science", + "category" : "event" + }, + + { + "title" : "HiPES 2024 (Workshop)", + "url" : "https://www.hipes-workshop.org/", + "description" : "1st Workshop about High-Performance e-Science", + "category" : "event" + }, + + { + "title" : "WiDE 2024 (Workshop)", + "url" : "https://wide.hpc4ai.it/2024/", + "description" : "2nd International Workshop on Workflows in Distributed Environments", + "category" : "event" + }, + + { + "title" : "Nextflow Summit - Barcelona 2023 (Summit)", + "url" : "https://summit.nextflow.io", + "description" : "Nextflow Summit - Barcelona 2023", + "category" : "event" + }, + + { + "title" : "Nextflow Summit - Boston 2023 (Summit)", + "url" : "https://summit.nextflow.io/boston/", + "description" : "Nextflow Summit - Boston 2023", + "category" : "event" + }, + + { + "title" : "Nextflow foundational (basics) training (Workshop)", + "url" : "https://nf-co.re/events/2023/training-basic-2023", + "description" : "Nextflow foundational (basics) training", + "category" : "event" + }, + + { + "title" : "Nextflow advanced training (Workshop)", + "url" : "https://nf-co.re/events/2023/training-sept-2023", + "description" : "Nextflow advanced training", + "category" : "event" + }, + + { + "title" : "DOE Workflows Training (Workshop)", + "url" : "https://docs.google.com/forms/d/e/1FAIpQLSee89GYqzFdLvrdtUiUdPDz0-WqgybD8pUts-gupEHwf6VbPA/viewform", + "description" : "DOE Cross-facility Workflows Training", + "category" : "event" + }, + + { + "title" : "WiDE 2023 (Workshop)", + "url" : "https://ieeecompsac.computer.org/2023/wide-2023/", + "description" : "1st IEEE International Workshop on Workflows in Distributed Environments", + "category" : "event" + }, + + { + "title" : "CWL Community Conference (Conference)", + "url" : "https://cwl.discourse.group/c/cwlcon-2023/13", + "description" : "2023 Common Workflow Language community conference", + "category" : "event" + }, + + { + "title" : "CLOUD 2023 (Conference)", + "url" : "https://conferences.computer.org/cloud/2023/", + "description" : "IEEE International Conference on Cloud Computing", + "category" : "event" + }, + + { + "title" : "HPDC 2023 (Conference)", + "url" : "https://www.hpdc.org/2023", + "description" : "32nd ACM International Symposium on High-Performance Parallel and Distributed Computing", + "category" : "event" + }, + + { + "title" : "Euro-Par 2023 (Conference)", + "url" : "https://2023.euro-par.org/", + "description" : "29th International European Conference on Parallel and Distributed Computing", + "category" : "event" + }, + + { + "title" : "eScience 2023 (Conference)", + "url" : "https://www.escience-conference.org/2023/", + "description" : "19th IEEE International Conference on eScience", + "category" : "event" + }, + + { + "title" : "PASC 2023 (Conference)", + "url" : "https://pasc23.pasc-conference.org/", + "description" : "Platform for Advanced Scientific Computing", + "category" : "event" + }, + + { + "title" : "IPDPS 2023 (Conference)", + "url" : "https://www.ipdps.org/", + "description" : "37th IEEE International Parallel & Distributed Processing Symposium", + "category" : "event" + }, + + { + "title" : "CCGrid 2023 (Conference)", + "url" : "https://ccgrid2023.iisc.ac.in/", + "description" : "23rd IEEE/ACM international Symposium on Cluster, Cloud and Internet Computing", + "category" : "event" + }, + + { + "title" : "ICCS 2023 (Conference)", + "url" : "https://www.iccs-meeting.org/iccs2023/", + "description" : "International Conference on Computational Science", + "category" : "event" + }, + + { + "title" : "HTCondor Week (Conference)", + "url" : "https://indico.cern.ch/event/1174979/", + "description" : "European HTCondor Week 2022", + "category" : "event" + }, + + { + "title" : "Nextflow Summit (Summit)", + "url" : "https://summit.nextflow.io/", + "description" : "Nextflow Summit", + "category" : "event" + }, + + { + "title" : "ERROR 2022 (Workshop)", + "url" : "https://error-workshop.org/", + "description" : "2nd Workshop on E-science ReseaRch leading tO negative Results", + "category" : "event" + }, + + { + "title" : "Sci-k 2022 (Workshop)", + "url" : "https://sci-k.github.io/2022/", + "description" : "2nd International Workshop on Scientific Knowledge: Representation, Discovery, and Assessment", + "category" : "event" + }, + + { + "title" : "eScience 2022 (Conference)", + "url" : "https://escience-conference.org/2022", + "description" : "18th IEEE International Conference on e-Science", + "category" : "event" + }, + + { + "title" : "BOSC 2022 (Conference)", + "url" : "https://www.open-bio.org/events/bosc-2022/", + "description" : "Bioinformatics Open Source Conference", + "category" : "event" + }, + + { + "title" : "HPDC 2022 (Conference)", + "url" : "http://www.hpdc.org/2022/", + "description" : "31st International Symposium on High-Performance Parallel and Distributed Computing", + "category" : "event" + }, + + { + "title" : "SC'22 (Conference)", + "url" : "https://sc22.supercomputing.org/", + "description" : "The International Conference for High Performance Computing, Networking, Storage, and Analysis", + "category" : "event" + }, + + { + "title" : "Euro-Par 2022 (Conference)", + "url" : "https://2022.euro-par.org/", + "description" : "28th International European Conference on Parallel and Distributed Computing", + "category" : "event" + }, + + { + "title" : "CWL 2022 (Conference)", + "url" : "https://cwl.discourse.group/t/2022-cwl-conference-feb-28-mar-4-2022", + "description" : "2022 Common Workflow Language Conference", + "category" : "event" + }, + + { + "title" : "GCC2022 (Conference)", + "url" : "https://galaxyproject.org/events/gcc2022/", + "description" : "2022 Galaxy Community Conference", + "category" : "event" + }, + + { + "title" : "nf-core (Workshop)", + "url" : "https://nf-co.re/events/2022/hackathon-march-2022", + "description" : "March 2022 Hackathon", + "category" : "event" + }, + + { + "title" : "WORKS22 (Workshop)", + "url" : "https://works-workshop.org/", + "description" : "17th Workshop on Workflows in Support of Large-Scale Science", + "category" : "event" + }, + + { + "title" : "PASC 2022 (Conference)", + "url" : "https://pasc22.pasc-conference.org/", + "description" : "Platform for Advanced Scientific Computing", + "category" : "event" + }, + + { + "title" : "ISC 2022 (Conference)", + "url" : "https://www.isc-hpc.com", + "description" : "ISC High Performance", + "category" : "event" + }, + + { + "title" : "ReWords 2022 (Workshop)", + "url" : "https://sites.google.com/view/rewords22", + "description" : "2nd Workshop on Reproducible Workflows, Data Management, and Security", + "category" : "event" + }, + + { + "title" : "FDO 2022 (Conference)", + "url" : "https://www.fdo2022.org/", + "description" : "1st International Conference on FAIR Digital Objects", + "category" : "event" + }, + + { + "title" : "Parsl & funcX Fest 2022 (Workshop)", + "url" : "https://parsl-project.org/parslfest2022.html", + "description" : "Parsl & funcX Fest 2022", + "category" : "event" + }, + + { + "title" : "SSDBM 2023 (Conference)", + "url" : "https://ssdbm.org/2023/", + "description" : "35th International Conference on Scientific and Statistical Database Management", + "category" : "event" + }, + + { + "title" : "ReWoRDS 2023 ()", + "url" : "https://sites.google.com/vols.utk.edu/rewords23/home", + "description" : "3rd Workshop on Reproducible Workflows, Data Management, and Security", + "category" : "event" + }, + + { + "title" : "IEEE BigData 2023 (Conference)", + "url" : "https://bigdataieee.org/BigData2023", + "description" : "2023 IEEE International Conference on Big Data", + "category" : "event" + }, + + { + "title" : "FAIR Containerized Computational Software (Workshop)", + "url" : "https://www.nist.gov/news-events/events/2023/12/2nd-international-workshop-fair-containerized-computational-software", + "description" : "2nd International Workshop on FAIR Containerized Computational Software", + "category" : "event" + }, + + { + "title" : "IEEE BigData 2024 (Conference)", + "url" : "https://bigdataieee.org/BigData2024", + "description" : "2024 IEEE International Conference on Big Data", + "category" : "event" + }, + + { + "title" : "CWLCon2024 Session 1 Americas (Conference)", + "url" : "https://www.commonwl.org/conferences/2024/", + "description" : "2024 Common Workflow Language Conference, Session 1 (Americas friendly time)", + "category" : "event" + }, + + { + "title" : "CWLCon2024 Session 2 APAC-Americas (Conference)", + "url" : "https://www.commonwl.org/conferences/2024/", + "description" : "2024 Common Workflow Language Conference, Session 2 (Asia Pacific & Americas friendly time)", + "category" : "event" + }, + + { + "title" : "CWLCon2024 Session 3-5 (Conference)", + "url" : "https://www.commonwl.org/conferences/2024/", + "description" : "2024 Common Workflow Language Conference, Sessions 3-5", + "category" : "event" + }, + + { + "title" : "CWLCon2024 Hackathon (Hackathon)", + "url" : "https://www.commonwl.org/conferences/2024/", + "description" : "2024 CWLCon Co-working Day", + "category" : "event" + }, + + { + "title" : "eScience 2024 (Conference)", + "url" : "https://www.escience-conference.org/2024/", + "description" : "20th IEEE International Conference on eScience", + "category" : "event" + }, + + + { + "title" : "2023 ECP Annual Meeting BoF", + "url" : "/bof/ecpam23/", + "description" : "Jan 19, 2023
Exascale Workflows Community: A Post-ECP Roadmap for Workflow Systems and Applications", + "category" : "bof" + }, + + { + "title" : "SC22 BoF", + "url" : "/bof/sc22/", + "description" : "Nov 15, 2022
An Update on the Community Roadmap for HPC and AI Scientific Workflows Research and Development", + "category" : "bof" + }, + + { + "title" : "SC23 BoF", + "url" : "/bof/sc23/", + "description" : "Nov 14, 2023
Modern Workflows for Continuum and Cross-Facility Computing", + "category" : "bof" + }, + + { + "title" : "SC24 Data Streaming BoF", + "url" : "/bof/sc24-streaming/", + "description" : "Nov 19, 2024
Real-Time Scientific Data Streaming to HPC Nodes: Challenges and Innovations", + "category" : "bof" + }, + + { + "title" : "SC24 BoF", + "url" : "/bof/sc24/", + "description" : "Nov 19, 2024
Collaborative Pathways for Designing an Integrated Infrastructure for Research Excellence", + "category" : "bof" + }, + + + { + "title" : "Workflows Community Summit 2022", + "url" : "/summits/2022/", + "description" : "Nov 29, 2022
A Roadmap Revolution", + "category" : "summit" + } , + + { + "title" : "Workflows Community Summit 2024", + "url" : "/summits/2024/", + "description" : "Sep 03, 2024
Future Trends and Challenges in Scientific Workflows", + "category" : "summit" + } , + + { + "title" : "Workflows Community Summit 2021.1", + "url" : "/summits/community/", + "description" : "Jan 13, 2021
Bringing the Scientific Workflows Community Together", + "category" : "summit" + } , + + { + "title" : "Workflows Community Summit 2021.11", + "url" : "/summits/facilities/", + "description" : "Nov 08, 2021
Tightening the Integration between Computing Facilities and Scientific Workflows", + "category" : "summit" + } , + + { + "title" : "Workflows Community Summit 2021.4", + "url" : "/summits/technical/", + "description" : "Apr 07, 2021
Advancing the State-of-the-art of Scientific Workflows Management Systems Research and Development", + "category" : "summit" + } + +] diff --git a/sitemap.xml b/sitemap.xml new file mode 100644 index 0000000000..00ebdc12b2 --- /dev/null +++ b/sitemap.xml @@ -0,0 +1,343 @@ + + + +/bof/ecpam23/ +2025-01-25T01:07:05+00:00 + + +/bof/sc22/ +2025-01-25T01:07:05+00:00 + + +/bof/sc23/ +2025-01-25T01:07:05+00:00 + + +/bof/sc24-streaming/ +2025-01-25T01:07:05+00:00 + + +/bof/sc24/ +2025-01-25T01:07:05+00:00 + + +/jobs/bsc_exascale_research_engineer/ +2025-01-25T01:07:05+00:00 + + +/jobs/bsc_postdoc_colmena/ +2025-01-25T01:07:05+00:00 + + +/jobs/bsc_programming_model_developer_colmena/ +2025-01-25T01:07:05+00:00 + + +/jobs/missouri_postdoctoral_bioinformatics/ +2025-01-25T01:07:05+00:00 + + +/jobs/nrel_researcher/ +2025-01-25T01:07:05+00:00 + + +/jobs/ornl_lead_software_engineer/ +2025-01-25T01:07:05+00:00 + + +/jobs/university_innsbruck_phd/ +2025-01-25T01:07:05+00:00 + + +/jobs/university_innsbruck_phd_cloud_edge/ +2025-01-25T01:07:05+00:00 + + +/jobs/university_innsbruck_postdoctoral_researcher/ +2025-01-25T01:07:05+00:00 + + +/stories/2022/05/16/workflow-education/ +2022-05-16T00:00:00+00:00 + + +/stories/2022/09/28/nextflow/ +2022-09-28T00:00:00+00:00 + + +/stories/2022/09/29/eflows4hpc/ +2022-09-29T00:00:00+00:00 + + +/stories/2022/10/24/covalent/ +2022-10-24T00:00:00+00:00 + + +/stories/2023/01/13/elephant-in-the-data-center/ +2023-01-13T00:00:00+00:00 + + +/stories/2023/04/02/smartsim/ +2023-04-02T00:00:00+00:00 + + +/summits/2022/ +2025-01-25T01:07:05+00:00 + + +/summits/2024/ +2025-01-25T01:07:05+00:00 + + +/summits/community/ +2025-01-25T01:07:05+00:00 + + +/summits/facilities/ +2025-01-25T01:07:05+00:00 + + +/summits/technical/ +2025-01-25T01:07:05+00:00 + + +/systems/EE-Demo/ +2025-01-25T01:07:05+00:00 + + +/systems/SmartSim/ +2025-01-25T01:07:05+00:00 + + +/systems/aiida-core/ +2025-01-25T01:07:05+00:00 + + +/systems/common-workflow-language/ +2025-01-25T01:07:05+00:00 + + +/systems/compss/ +2025-01-25T01:07:05+00:00 + + +/systems/covalent/ +2025-01-25T01:07:05+00:00 + + +/systems/cromwell/ +2025-01-25T01:07:05+00:00 + + +/systems/dagonstar/ +2025-01-25T01:07:05+00:00 + + +/systems/dask/ +2025-01-25T01:07:05+00:00 + + +/systems/fireworks/ +2025-01-25T01:07:05+00:00 + + +/systems/galaxy/ +2025-01-25T01:07:05+00:00 + + +/systems/geoweaver/ +2025-01-25T01:07:05+00:00 + + +/systems/jobflow/ +2025-01-25T01:07:05+00:00 + + +/systems/libensemble/ +2025-01-25T01:07:05+00:00 + + +/systems/maestrowf/ +2025-01-25T01:07:05+00:00 + + +/systems/makeflow/ +2025-01-25T01:07:05+00:00 + + +/systems/merlin/ +2025-01-25T01:07:05+00:00 + + +/systems/mlflow/ +2025-01-25T01:07:05+00:00 + + +/systems/nextflow/ +2025-01-25T01:07:05+00:00 + + +/systems/nipype/ +2025-01-25T01:07:05+00:00 + + +/systems/parsl/ +2025-01-25T01:07:05+00:00 + + +/systems/pegasus/ +2025-01-25T01:07:05+00:00 + + +/systems/prefect/ +2025-01-25T01:07:05+00:00 + + +/systems/pyiron_base/ +2025-01-25T01:07:05+00:00 + + +/systems/radical.entk/ +2025-01-25T01:07:05+00:00 + + +/systems/scipipe/ +2025-01-25T01:07:05+00:00 + + +/systems/signac-flow/ +2025-01-25T01:07:05+00:00 + + +/systems/snakemake/ +2025-01-25T01:07:05+00:00 + + +/systems/streamflow/ +2025-01-25T01:07:05+00:00 + + +/systems/swift-t/ +2025-01-25T01:07:05+00:00 + + +/systems/taskvine/ +2025-01-25T01:07:05+00:00 + + +/systems/watts/ +2025-01-25T01:07:05+00:00 + + +/groups/benchmarking/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/best-practices/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/bibliography/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/events/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/resources/ +2025-01-25T01:07:05+00:00 + + +/groups/fair/training/ +2025-01-25T01:07:05+00:00 + + +/events/add + + +/frameworks/contribute + + +/jobs/add + + +/registries/contribute + + +/systems/contribute + + +/ + + +/about + + +/bof + + +/contact + + +/education + + +/events + + +/frameworks + + +/jobs + + +/members + + +/registries + + +/reports + + +/stories + + +/summits + + +/systems + + +/groups + + +/files/bof/bof_ecpam_23_opening_remarks.pdf +2025-01-25T01:06:14+00:00 + + +/files/bof/bof_sc22_ai_workflows.pdf +2025-01-25T01:06:14+00:00 + + +/files/bof/bof_sc22_ams.pdf +2025-01-25T01:06:14+00:00 + + +/files/bof/bof_sc22_european_initiatives.pdf +2025-01-25T01:06:14+00:00 + + +/files/bof/bof_sc22_iri.pdf +2025-01-25T01:06:14+00:00 + + +/files/bof/bof_sc22_opening_remarks.pdf +2025-01-25T01:06:14+00:00 + + diff --git a/stories.html b/stories.html new file mode 100644 index 0000000000..dd8a181f72 --- /dev/null +++ b/stories.html @@ -0,0 +1,398 @@ + + + + + Stories - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Stories +

+
+
+
+
+ +
+
+
+
+
+
+

+ Perspectives on workflows-related topics +

+
+
+
+ + + + + + +
+ + +
+

Apr 02, 2023

+

SmartSim: Combining Machine Learning and HPC Workflows

+

+ +

Matthew Ellis

+ HPE

+ +

Bill Scherer

+ HPE

+ +

Andrew Shao

+ HPE

+ +

+

View Story

+
+
+ + + + + +
+ + +
+

Jan 13, 2023

+

The Elephant in the Data Center – Energy Consumption of Workflow Executions

+

+ +

Ulf Leser

+ Humboldt-Universität zu Berlin

+ +

Lauritz Thamsen

+ University of Glasgow

+ +

+

View Story

+
+
+ + + + + +
+ + +
+

Oct 24, 2022

+

Covalent: Workflow Orchestration on Highly Heterogeneous Infrastructure

+

+ +

Will Cunningham

+ Agnostiq

+ +

+

View Story

+
+
+ + + + + +
+ + +
+

Sep 29, 2022

+

Widening Workflows usage: the eFlows4HPC project

+

+ +

Rosa M. Badia

+ Barcelona Supercomputing Center

+ +

+

View Story

+
+
+ + + + + +
+ + +
+

Sep 28, 2022

+

A quick overview of Nextflow workflow system

+

+ +

Paolo Di Tommaso

+ Nextflow creator and CTO of Seqera Labs

+ +

+

View Story

+
+
+ + + + + +
+ + +
+

May 16, 2022

+

Workflows Education: Underlying Computer Science Concepts

+

+ +

Henri Casanova

+ University of Hawaii

+ +

+

View Story

+
+
+ + +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2022/05/16/workflow-education/index.html b/stories/2022/05/16/workflow-education/index.html new file mode 100644 index 0000000000..0db63fc103 --- /dev/null +++ b/stories/2022/05/16/workflow-education/index.html @@ -0,0 +1,284 @@ + + + + + Workflows Education: Underlying Computer Science Concepts - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Education: Underlying Computer Science Concepts +

+
+
+
+
+ +
+
+
+
+
+
+ May 16, 2022
+
+ +
+ Henri Casanova
+
Henri Casanova
+
University of Hawaii
+
+ +
+
+
+ +
+

Workflow applications have become mainstream in many domains, including most of the sciences, engineering, as well as AI. It is thus crucial that educational and training opportunities be available to help grow an effective workflow workforce. Several institutions have already developed and made available training material for particular workflow systems, so that users can learn how to deploy and execute their workflow applications on hardware platforms on which these systems are installed. Less developed, but no less crucial, are pedagogic materials that target the fundamental concepts necessary to understand workflow applications and reason about their executions and the performance thereof. One of the reasons why these pedagogic materials are less developed is that many of the relevant concepts belong to “standard” parallel and distributed computing (PDC) topics, and it is assumed that these topics are already covered in university computer science curricula.

+ +

This assumption is problematic for several reasons. First, it is well recognized that PDC is not sufficiently included in undergraduate computer science curricula, which has motivated the establishment of the NSF/IEEE-TCPP Curriculum Initiative on Parallel and Distributed Computing. Although progress is being made, many computer science college graduates still do not have sufficient, or any, PDC exposure. Second, many potential members of the workflow workforce will not be computer science graduates. Third, even if students have been taught the relevant concepts at different times throughout their education, they may not have retained them effectively. There is a thus need for a one-stop, self-contained ``these are the concepts needed for being able understand and reason about workflow executions” pedagogic package. This content of this package should draw from multiple sources, and should be curated and vetted by the Workflow Community Initiative. Its main use would be to provide “prerequisite concepts you need to know for workflows” to students (as a complement to or a component of university courses, before starting a workflow-related internship, before engaging on graduate-level workflow-related projects, etc.) and professionals (e.g., before beginning to use workflows, to better understand workflow behavior and performance in various professional contexts).

+ +

NSF/IEEE-TCPP
+NSF/IEEE-TCPP Curriculum Initiative on Parallel and Distributed Computing.

+ +

A project that could provide useful components to include in this envisioned pedagogic package is EduWRENCH. EduWRENCH provides many pedagogic modules, each one including a pedagogic narrative, practice questions, open questions, and in-the-browser simulation-driven activities. Basic EduWRENCH modules target fundamental concepts of computation, I/O, and networking and explain how they drive application performance. Some modules focus on principles of parallel computation on multi-core machines, including notions of parallelism, speedup, efficiency, overhead, and load balancing. Other modules focus on principles of distributed computation over a network, including notions of data proximity. Several more advanced build on the aforementioned modules to teach workflow concepts and/or to use workflows as case-studies for more advanced topics such as scheduling, energy efficiency, etc. Most EduWRENCH modules have already been used effectively not only in university courses, but also to train beginning graduate students who are about to join a workflow research and development group. EduWRENCH by no means provides a comprehensive pedagogic package for workflows, but it may serve as a good starting point for the Workflow Community Initiative to define what such a package should and should not contain.

+ +

EduWRENCH
+EduWRENCH website.

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2022/09/28/nextflow/index.html b/stories/2022/09/28/nextflow/index.html new file mode 100644 index 0000000000..05ce5175f1 --- /dev/null +++ b/stories/2022/09/28/nextflow/index.html @@ -0,0 +1,327 @@ + + + + + A quick overview of Nextflow workflow system - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ A quick overview of Nextflow workflow system +

+
+
+
+
+ +
+
+
+
+
+
+ Sep 28, 2022
+
+ +
+ Paolo Di Tommaso
+
Paolo Di Tommaso
+
Nextflow creator and CTO of Seqera Labs
+
+ +
+
+
+ +
+

Workflow management systems are as diverse as the business and scientific processes they support – from engineering to research to process automation. This article describes Nextflow – an open-source workflow manager widely used in life sciences. It covers the motivations behind Nextflow, explains what it is, and describes what the future holds for the platform.

+ +

Background and Motivations

+ +

Like similar open source efforts, Nextflow was born out of a need to solve specific problems while I was working as a research engineer in the Comparative Bioinformatics labs at the Centre for Genomics Regulation (CRG). Researchers were struggling with several issues that are all likely too familiar to workflows community members – complex, buggy scripts, long-running workflows that would suddenly fail, and challenges monitoring, managing, and maintaining workflows.

+ +

While there were several available workflow managers at the time, none of them specifically addressed our requirement. A fundamental challenge in the lab at that time was data handling. Comparative bioinformatics involves studying genome and protein sequences across species, and population-level studies can involve massive amounts of data. We needed a simple yet powerful framework to deploy the executions of thousands of tasks, comparing different alignment methods and protein sequences each other.

+ +

Some Key Ideas Behind Nextflow

+ +

Nextflow was designed from scratch having clear in mind key ideas and best practices:

+ +
    +
  1. Allow developers to reuse any existing piece of software without the need of intermediate interface or wrapper; the tool command line is the interface and Linux is the integration layer.
    2. +
  2. Manage tasks as a functional and self-contained unit of work. This was a key requirement to enable the deployment across heterogeneous computing platforms and allow auto-retry execution policy on failure.
    3. +
  3. Provides a high-level abstraction for tasks parallelisation that allows developers to write simple yet high-scalable application, without the need to struggle with low level problem such as race conditions and locks to access shared resources.
    4. +
  4. Strongly decouple the scientific application logic from the configuration & deployment setting, in order to streamline the deployment across different platforms and enable the migration to cloud environments.
    5. +
  5. Remove unnecessary dependencies with external services and databases. We wanted a zero configuration experience both for the Nextflow runtime and the resulting pipelines.
    6. +
  6. Enable debugging and recovering of failed executions. Bioinformatics pipeline can spin the execution of tens of thousands tasks. If something breaks we need a strategy that would allow the debugging of the failed task independently of the rest of the pipeline, and make it possible to recover the computation once the problem was solved from the last successfully computed tasks, to avoid throwing away days of computing resources.
    7. +
+ +

Between these, very likely, the most important design choice that distinguishes Nextflow compared to other workflow management systems is the adoption of the data flow programming paradigm.

+ +

We often imagine workflows as a sequence of steps designed from the top down and including various dependencies, decision points, and sub-flows. There is another way to envision workflows, however, and that is from the perspective of the individual process steps. Individual steps have no notion of the overall flow. They have an input, perform some processing, and write data to an output, typically another step in the workflow.

+ +

Using this programming model you can think a workflow behaving like spreadsheet. In a spreadsheet, users enter expressions in cells that depend on calculations in other cells. The dependencies between cells can be complex, but users don’t think about how the spreadsheet will sequence calculations. Instead, they concentrate on the logic in each cell. When a cell changes, the spreadsheet worries about how to propagate changes to dependent cells. Nextflow is described as reactive because task execution is triggered when inputs change or become valid. It turns out that this model works surprisingly well at scale, and opportunities for parallelism occur naturally without the workflow designer needing to think about them.

+ +

From a technical point of view, Nextflow processes (aka tasks) can be thought of as reactive agents which run in parallel waiting for the input data that trigger their execution. It’s important to highlight that each of these processes are isolated from each other, and they can only communicate via asynchronous messages represented by dataflow variables.

+ +

Along with these, another pillar component of Nextflow was the adoption of containers as a core feature of the framework. Nextflow abstracts away the containerisation of the pipeline execution in a declarative manner. This means the user is only required to specify the container that needs to be used to run specific workflow tasks. Nextflow takes care to use this information to run the task within the container depending on the target execution platform that can be, for example, AWS Batch, an HPC batch scheduler e.g. Slurm or a local computer. This choice was proven to be critical to enable the portability and reproducibility of the resulting data analysis workflow. Nextflow nowadays supports multiple container runtime technologies, including Docker, Podman, Singularity, Charliecloud among others.

+ +

Nextflow Today

+ +

When Nextflow was launched as an open-source project in 2013, we couldn’t have imagined what it has become today. Today, Nextflow is downloaded over 55,000 times monthly and used by over 1,000 organizations, including some of the world’s largest pharmaceutical firms. Ideas like containers and support for source code managers (SCMs) are so thoroughly baked into Nextflow’s design that they seem commonplace.

+ +

In Nextflow, we were careful to decouple workflow logic from the details of underlying computing environments. To achieve this, Nextflow supports an abstraction called an Executor. Executors are pluggable components that enable pipelines to run without modification across virtually any compute environment, from a local host to an on-prem HPC cluster to various cloud services. Shifting to a new compute environment is as simple as changing a few lines of code in a configuration file.

+ +

Nextflow

+ +

Pipelines can be stored locally or pulled from a preferred SCM at runtime. While applications can still be installed locally, pulling containers encapsulating bioinformatics tools has become the norm. Nextflow handles all the details, including compute resources, data movement, and making datasets visible to containers at runtime. Intermediate results and data are also cached, making flows resilient and recoverable after a failed step.

+ +

The nf-core Community

+ +

The nf-core community launched in 2018 marked a key milestone for the Nextflow community. nf-core is an independent effort to collect a curated set of analysis pipelines built using Nextflow. Significant effort has gone into developing tools, templates, and guidelines that enable domain experts to contribute to the community. The result is a set of high-quality pipelines that are portable, reproducible, fully documented, and cloud-ready. A recent State of the Workflow 2022 community survey showed that 62% of Nextflow users take advantage of these pipelines in their day-to-day research – a testament to their utility and the importance of this effort.

+ +

Towards the Future

+ +

We are fortunate to have vibrant user and developer communities actively engaged in Nextflow and helping to guide its evolution. We continue to support new computing environments, introduce new functionality, and improve throughput and scalability. I recently shared some plans for Nextflow in the article Evolution of the Nextflow runtime.

+ +

We are also planning to further enhance the support for containers providing a better automation on the overall container management lifecycle and ease the provisioning of multi-containers required by modern data analysis pipelines.

+ +

We are also improving our commercial Tower offering enabling improved collaboration, new data-related features, and features aimed at helping further optimize resource usage to reduce cloud spending.

+ +

You can learn more about Nextflow or download it for free by visiting nextflow.io. Existing Nextflow users can test-drive Nextflow Tower in the cloud at tower.nf.

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2022/09/29/eflows4hpc/index.html b/stories/2022/09/29/eflows4hpc/index.html new file mode 100644 index 0000000000..dd87660595 --- /dev/null +++ b/stories/2022/09/29/eflows4hpc/index.html @@ -0,0 +1,292 @@ + + + + + Widening Workflows usage: the eFlows4HPC project - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Widening Workflows usage: the eFlows4HPC project +

+
+
+
+
+ +
+
+
+
+
+
+ Sep 29, 2022
+
+ +
+ Rosa M. Badia
+
Rosa M. Badia
+
Barcelona Supercomputing Center
+
+ +
+
+
+ +
+

The European High-Performance Computing Joint Undertaking (EuroHPC JU) aims at developing a World Class Supercomputing Ecosystem in Europe and, with this goal, is procuring and deploying pre-exascale and petascale systems in Europe. These systems will be capable of running large and complex applications. In this sense, the demand from the application stakeholders includes not only aspects related to High-Performance Computing (HPC) but also artificial intelligence (AI) and data analytics.

+ +

The eFlows4HPC project has as objective to provide a software stack that makes easier the development of workflows that involve HPC, AI and data analytics components. The project aims to give support to dynamic workflows in the sense that the set of nodes in the graph of the workflow can change during its execution due to changes in the input data or context of the execution, and be reactive to events that may occur. The runtime systems supporting this execution should be able to perform efficient resource management, both in terms of time and energy.

+ +

Another objective of the project is to provide mechanisms to make the use and reuse of HPC easier by wider communities. For this purpose, the HPC Workflows as a Service (HPCWaaS) methodology has been proposed. The goal is to provide methodologies and tools that enable sharing and reuse of existing workflows, and that assist when adapting workflow templates to create new workflow instances.

+ +

eFlows4HPC software stack
+eFlows4HPC software stack.

+ +

The eFlows4HPC software stack includes components to develop the workflows at three levels: high-level topology of the workflows using extended TOSCA, required data transfers with the Data Logistic Pipelines and the computational aspects of the workflow with PyCOMPSs. Once a workflow has been developed, it is registered in the Workflow Registry. Similarly, the different components of the workflows, pre-trained AI models and data sets are registered in a set of catalogues and repositories. All these registries and catalogues are used by the HPCWaaS interface, which provides a REST API to deploy and execute the workflows. On execution, the stack also provides a set of runtime libraries to support the workflow execution and data management.

+ +

HPCWaaS methodology
+HPCWaaS methodology.

+ +

The eFlows4HPC developments are demonstrated in the project through three pillar applications in the areas of digital twins for manufacturing, climate modeling and prediction and urgent computing for natural hazards. Pillar I deals with the construction of digital twins for the prototyping of complex manufactured objects integrating state-of-the-art adaptive solvers with machine learning and data-mining, contributing to the Industry 4.0 vision. Pillar II develops innovative adaptive workflows for climate and for the study of tropical cyclones in the context of the CMIP6 experiment, including in-situ analytics. Pillar III explores the modelling of natural catastrophes – in particular, earthquakes and their associated tsunamis shortly after such an event is recorded.

+ +

Coordinated by the Barcelona Supercomputing Center (BSC), the eFlows4HPC consortium comprises 16 partners from seven different countries with expertise in technical aspects: supercomputing and acceleration, workflow management and orchestration, machine learning, big data analytics, data management, and storage; together with expertise in the pillar workflows’ areas: manufacturing, climate, urgent computing.

+ +

The initial results of the project are available under the project website in its deliverable section (see https://eflows4hpc.eu/deliverables/). The source code and documentation are publicly available as well (see https://github.com/eflows4hpc and https://eflows4hpc.readthedocs.io/en/latest/).

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2022/10/24/covalent/index.html b/stories/2022/10/24/covalent/index.html new file mode 100644 index 0000000000..42c0cf736b --- /dev/null +++ b/stories/2022/10/24/covalent/index.html @@ -0,0 +1,290 @@ + + + + + Covalent: Workflow Orchestration on Highly Heterogeneous Infrastructure - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Covalent: Workflow Orchestration on Highly Heterogeneous Infrastructure +

+
+
+
+
+ +
+
+
+
+
+
+ Oct 24, 2022
+
+ +
+ Will Cunningham
+
Will Cunningham
+
Agnostiq
+
+ +
+
+
+ +
+

Workflow orchestration is a common operations framework in the field of distributed computing. As high performance computing (HPC) becomes more distributed and incorporates a greater degree of heterogeneous technologies, workflow orchestration will no doubt become a common practice in this space, as it has in adjacent spaces such as Machine Learning Operations (MLOps) and more recently in quantum computing. Users with repeatable sets of interdependent tasks (workflows) may wish to run them on a time-based schedule or, more commonly in research and development, they may wish to iterate on the design of one or more experimental workflows. This iteration can include different algorithms, different model hyperparameters, different compute backends, or even different compute frameworks entirely. With these options, it is increasingly possible to construct and optimize workflows which span across multiple on-premises supercomputers, multiple clouds, and even emerging technologies such as quantum computers.

+ +

While so many options are a delight to workflow architects, they pose real challenges for operations. How are credentials managed and conveyed across such systems? How do researchers ensure workflow data pipelines are efficient and secure? How are logical tasks broken apart and rejoined (“packed”) to optimize information transfer across physically distant systems? When something fails, how easy is it to trace back errors across frameworks and to re-run portions of a workflow? There are certainly many other such challenges that workflow practitioners are familiar with.

+ +

Covalent
+Covalent unifies tasks written in different languages and with heterogeneous compute requirements.

+ +

Covalent is Agnostiq’s answer to these challenges. With roots in quantum computing applications, Agnostiq researchers quickly learned that the operational challenges in quantum research today consume the majority of a project’s time. Covalent was developed primarily to manage experiments and facilitate access to cloud compute resources for researchers with little or no cloud engineering background. Today, users can interact with a large variety of cloud resources – including Batch, Kubernetes, and Braket Hybrid Jobs – using Covalent’s AWS Plugins package.

+ +

The release of a Slurm plugin further enabled our team to interact with partners’ supercomputing resources, in particular in federated or hybrid-cloud configurations. Such flexibility is increasingly in demand as scalability begins to hit a power-consumption barrier, and as more HPC vendors and users begin to incorporate cloud and other distributed compute platforms. As we realized these tools can benefit more than our organization, we decided to transform Covalent into a product in its own right, and to open-source the software on GitHub in January 2022.

+ +

Covalent
+Covalent’s user interface enables users to easily visualize and interact with distributed workflows.

+ +

Quantum computing, of course, introduces its own set of unique needs. Firmly rooted as a heterogeneous technology from the outset, quantum computers today mainly run Noisy Intermediate-Scale Quantum (NISQ) algorithms which are variational, or hybrid, in nature. These algorithms require classical and quantum resources working in tandem. Whereas traditional HPC workflows often involve loosely coupled tasks spanning many hours or days in a single location, variational quantum workflows are tightly coupled, with timescales sometimes under a single second per task. Since classical and quantum resources may not necessarily be physically located in the same data center, most of the execution time may in fact arise due to data transfer and requeuing – often thousands of times per workflow. A remedy to this requires collaboration among many parties in order to optimize the user experience and maximize hardware occupancy. With Covalent at the center of this conversation, Agnostiq hopes to stimulate a new discussion around how we think about workflows in highly heterogeneous environments.

+ +

Users and providers interested in learning more about Covalent can view the source code on GitHub, join the Covalent Slack channel, follow us on Twitter, or reach out to the team for more information at contact@agnostiq.ai. We also welcome open-source contributions and discussions on GitHub. If you like what we are up to, please show your support by starring our repository.

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2023/01/13/elephant-in-the-data-center/index.html b/stories/2023/01/13/elephant-in-the-data-center/index.html new file mode 100644 index 0000000000..3caa98085a --- /dev/null +++ b/stories/2023/01/13/elephant-in-the-data-center/index.html @@ -0,0 +1,305 @@ + + + + + The Elephant in the Data Center – Energy Consumption of Workflow Executions - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ The Elephant in the Data Center – Energy Consumption of Workflow Executions +

+
+
+
+
+ +
+
+
+
+
+
+ Jan 13, 2023
+
+ +
+ Ulf Leser
+
Ulf Leser
+
Humboldt-Universität zu Berlin
+
+ +
+ Lauritz Thamsen
+
Lauritz Thamsen
+
University of Glasgow
+
+ +
+
+
+ +
+

The execution of scientific workflows consumes electric energy – and often quite a lot as workflow systems usually are employed especially for large data sets, complex analysis tasks, and distributed execution over sizeable compute clusters. While techniques to reduce this consumption have been researched for decades, they currently reach a new level of urgency, as energy costs skyrocket (at least in Europe) and the world more and more acknowledges that the era of low-cost energy production from carbon-heavy fuels will have to come to an end. Thus, it is high time for any workflow researcher and workflow user to ask herself – what can we do to save energy? The answer to this question has multiple facets.

+ +

The classical response is “increasing efficiency of software and hardware”, and research in the past has almost exclusively focused on this idea. Efficiency in terms of energy can intuitively be understood as processing output per watt; increasing efficiency thus means producing more output for the same amount of energy or producing the same output at less energy (or, in an ideal world, both). Techniques typically focus on the latter, for instance by developing more energy-efficient algorithms (e.g. joule sort) or using more energy-efficient hardware (e.g. GPUs or FPGAs) for specific problems. More recently, the same idea is followed by works in machine learning, trying to achieve the same accuracy of predictions with much smaller models, which require less energy for training and application.

+ +

However, from the perspective of a large data center, these approaches all too often fail to actually save energy, simply because a data center typically always runs at full load – no matter how many efficiency-enhancing tricks are applied. When codes get more efficient, a given analysis is finished in less time (thus requiring less energy), yet the freed time is typically not used to power down the cluster, but rather to run some other analysis that otherwise might not have been prioritized; in commercial clouds, such idle times are sold over the spot market. From a purely economic point of view, this historically made a lot of sense, as acquiring a cluster was much more expensive than running it (ignoring the cost of human administration which must be paid at a constant rate anyway), and thus all clusters should be used to their maximum degree to achieve a good return on investment. At this point we must notice the important difference between “increasing energy efficiency” and really “saving energy”: More efficient algorithms achieve the former but not the latter when the point of view is widened from a single workflow execution to a data center perspective.

+ +

A similar effect can be observed with more energy-efficient hardware. Clearly, a data center built with modern low-energy chips can perform the same computation as one built with older high-energy chips at less energy, yet this effect is typically out-weighted by the trend that data centers simply become bigger and bigger and thus consume more energy again – an instance of Jevons Paradox. A similar effect exists with cars, where the average fuel consumption has been reduced only marginally over the last 20 years, despite the fact that more and more efficient engines were developed, simply because these are built into ever larger and heavier cars.

+ +

The local perspective – developing individual workflows

+ +

Now – what can workflow research do to save energy and cost? From a single-workflow perspective, there are a few obvious measures along the line we just discussed. We can save energy by using more efficient codes and by running the workflow on more efficient hardware. We can save cost by energy-aware scheduling, i.e., running the workflow in times when energy is cheaper, thus exploiting price differences offered by the local energy provider; in the future (and partly already in the presence), it is quite conceivable that energy prices will become cheaper whenever it is produced in abundance, for instance by solar collectors on sunny or wind power plants on windy days, or when consumption is low, for instance at night and in summer. Even if such scheduling may not save lots of money, it would certainly help to reduce carbon emissions by trading “bad” energy for “better” energy.

+ +

However, there are also less obvious measures for saving energy (and money), which revolve around the concept of “output” of a workflow. So far, we implicitly assumed that a workflow is a fixed set of computations turning some input data into a computational result. However, that is a very computer-science focused point of view – most users are much more interested in the scientific result than in the specific computation that was performed to produce it. This leads to the question whether we cannot have the same, or almost the same, scientific result with less computation? The answer very often is: Yes. One example was already mentioned before, i.e., the usage of smaller and thus lower-energy models in machine learning. However, in many types of analysis, many more ideas can be followed. For instance, classification or regression tasks often are evaluated in a k-fold cross-validation. The larger the k, the more energy is required, as k-fold cross-validation performs k rounds of training and testing. Thus, choosing smaller k’s typically saves energy; the price might be a less robust result. In NLP, training and fine-tuning in many tasks already have become so expensive that typical evaluations dropped the idea of cross-validation and use a single test partition instead; apparently, the “price” has been accepted by the community. Bootstrapping or Monte-Carlo-style analysis methods perform the same type of computations tens of thousands of times to achieve robust results; reducing the number of repetitions leads to a linear decrease in energy consumption, again at the cost of less robust results. Hyperparameter optimization also performs model training and evaluation repetitively with slightly different inputs (e.g. using grid search or Bayesian methods); again, reducing the number of runs leads to a linear decrease in energy consumption, at the peril of not finding a better parameterization and thus not having the best possible result. Iterative model improvements are pushed to their extremes in projects around AutoML, which often boil down to a hilarious number of trial and error computations with varying algorithms, input sets, hyperparameters, etc. Finally, sampling is a ubiquitous technique to reduce the computational cost of studying very large data sets; of course, smaller sample sizes also reduce energy costs. Note that none of these ideas leads to a provable “non-optimal” solution, but solutions typically improve (slightly) with more iterations or more samples; a workflow developer thus always has to decide at which point to stop. Probably, energy consumption should and will soon be a strong argument for stopping earlier; and the community should start accepting this argument when reviewing papers or project grants. An important start could be that we all start to report energy consumption figures with our analysis.

+ +

The global perspective – data centers running multiple workflows

+ +

What can a data center do to save energy or reduce energy costs? The most obvious measure is to reduce services, for instance by switching off a cluster partly or entirely. This clearly is an extreme action that probably no data center manager will favor (unless forced to after comparing the electricity bills with the available funding); however, it will undoubtedly immediately save energy and energy costs at the same time. A less drastic and popular measure is to use DVFS techniques, which possibly leads to losing some performance, or to switch to more energy-efficient hardware. Especially the latter, however, again carries the danger that pressure is growing to invest the savings in energy in extensions of the cluster (see above), as long as the bill still can be paid, which will deprive the energy savings. Furthermore, one must not forget the resources necessary to build the hardware of the cluster; using existing hardware (and not replacing it) as long as feasible can actually be a proper means to save energy, even if a new generation of hardware might be more energy-efficient than the present one. Finding the sweet spot within this trade-off is the daily business of data center managers and currently shaken due to the changing proportions of costs for acquisition, maintenance, and operation.

+ +

Another option is to put more effort into avoiding redundant computation across multiple workflows. In many fields of science, certain reference data sets exist that are used by many groups; examples in the life sciences are large genome data sets, e.g. The Cancer Genome Atlas, examples in remote sensing are series of images from satellites like LandSat; examples in astronomy are the images from large sky observations like the Sloan Digital Sky Survey. These data sets are typically published in a raw format, yet many downstream analyses require some form of pre-processing that is often very similar or even completely identical across multiple workflows. Performing such processing only once can save substantial energy, it requires either careful consultation of users or automatic means to identify identical computations across workflows; in a long-term vision, such pre-processing could even be shared across multiple data centers, not just multiple workflows. However, it must not be forgotten that keeping results for further access also costs energy (as long as it is not written to tape archives) to keep memory powered, SSDs responding, or disks spinning. Intelligent research data management and advanced workflow optimization thus can play an important role in saving energy.

+ +

Putting it all together – turning every screw

+ +

The necessity for saving energy and energy cost is no longer a topic of the future or important only in small niches – it has become an urgent need for all of us now. This also affects workflow research and research performed with workflows, as executing workflows is particularly energy hungry. We discussed several approaches to these problems that differ in their focus (saving energy versus saving money) and their scope (individual workflows versus data centers). There are surely many more ideas than presented in this short commentary; we would be eager to learn about them, for instance by personal mail (leser@informatik.hu-berlin.de).

+ +

From a 10,000-feet perspective, the approaches can all be considered variations of a common theme, extending the classical trade-off in high-performance computing (i.e., compute time versus compute costs) with a crucial third factor: energy consumption. We believe that this more complex landscape requires new lines of research in diverse areas such as scheduling, research data management, heterogeneous architecture, monitoring, and workflow optimization – now.

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/stories/2023/04/02/smartsim/index.html b/stories/2023/04/02/smartsim/index.html new file mode 100644 index 0000000000..50c2287392 --- /dev/null +++ b/stories/2023/04/02/smartsim/index.html @@ -0,0 +1,318 @@ + + + + + SmartSim: Combining Machine Learning and HPC Workflows - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SmartSim: Combining Machine Learning and HPC Workflows +

+
+
+
+
+ +
+
+
+
+
+
+ Apr 02, 2023
+
+ +
+ Matthew Ellis
+
Matthew Ellis
+
HPE
+
+ +
+ Bill Scherer
+
Bill Scherer
+
HPE
+
+ +
+ Andrew Shao
+
Andrew Shao
+
HPE
+
+ +
+
+
+ +
+

Machine learning (ML) algorithms have been successfully applied to a wide variety of commercial applications. However, adoption of ML in traditional high performance computing (HPC) applications has lagged other segments because of differences in software ecosystems and cluster management tools. Specifically, these applications are typically written in Fortran, C, and C++ and leverage OpenMP and/or MPI parallelization to extract peak performance on HPC platforms. On the other hand, ML toolkits are generally Python-based. Moreover, HPC systems use advanced workload managers to schedule and manage bare-metal jobs. The SmartSim library (https://craylabs.org) was developed by Cray and HPE to overcome these challenges and help users create novel HPC workflows that mesh modern data science with machine learning capabilities.

+ +

SmartSim Overview

+ +

SmartSim is an open-source software package developed by Hewlett Packard Enterprise (HPE) that helps users combine traditional engineering, scientific, and high-performance computing applications with machine learning tools and visualization packages. Internally, SmartSim consists of two libraries: an infrastructure library and a client library. The infrastructure library’s API enables users to configure scientific applications and to define and launch experiments (potentially including ensembles of simulations). As part of the machine learning infrastructure, SmartSim launches an in-memory database accessible across all applications in the workflow. Machine learning models can be executed inside the database or data can be streamed out of it for visualization and training. Machine learning infrastructure can be launched on CPU, GPU, or multi-GPU compute nodes, and the SmartSim library has features to help users achieve maximum workload throughput with all of these systems. SmartSim supports launching user-described workflows on several HPC workload managers including Slurm, PBS, LSF, and Cobalt. SmartSim also allows users to launch workflows locally on MacOS or Linux systems.

+ +

The SmartSim client library, for its part, provides interfaces that can be embedded into any Fortran, C, C++, or Python application. With these clients, applications can transfer data to and from the in-memory database and they can execute ML tasks (such as inference) on this data. Also, because the database is accessible by all component applications in the workflow, data can be streamed into and out of the database for online analysis and ML model training. Further, the client library offers optimized aggregation methods that retrieve data from the database for tasks such as online visualization and online training. The SmartSim client library needs only a TCP/IP connection to communicate with the database so it is highly portable.

+ +

SmartSim

+

Sample experiment showing a workflow with machine learning infrastructure launched by SmartSim and connected to online analysis and visualization via the in-memory database.

+ +

SmartSim Usage Example: Embedding ML to Improve the Accuracy of Ocean Modeling

+ +

Within the oceanographic community, the behavior of the water in oceans is simulated via ocean general circulation models (OGCMs). OGCMs use the Navier-Stokes partial differential equations (PDEs) to represent the laws of conservation of mass, momentum, and energy. Parameterizations added to these PDEs account for physical processes that occur at scales smaller than the model grid, but their unconstrained use can violate the conservation laws. Modern ocean modeling theory considers eddy energy (EKE) to be a critical variable in these parameterizations. The current state of the art numerically solves a PDE that describes EKE; however, the estimation or omission of a number of terms leads to significant errors. To improve the quality of OGCMs, collaborators from HPE, the Canadian Centre for Climate Modelling and Analysis, and the National Center for Atmospheric Research (NCAR) used a data-driven approach with machine learning to replace the EKE PDE. SmartSim is the key technology that allowed this ML model to be meshed with existing OGCMs. As a result of these efforts, we were able to improve the simulation accuracy without impeding performance in large-scale climate simulations.

+ +

In this work, we evaluated the results of our ML approach to the numerical approach using the Modular Ocean Model version 6 (MOM6). We compared the EKE estimated by each approach to the baseline EKE calculated by a third ‘eddy-resolving’ (ER) simulation with a spatial resolution of about 10 kilometers. This resolution is sufficient to resolve mesoscale eddies (turbulence) in the equator and mid-latitudes, but it is computationally expensive. The other two configurations coarsen the spatial resolution to 25 kilometers, which places them into an ‘eddy-permitting’ regime where modeling the impact of eddies on the rest of the simulation requires turbulence parameterization. The coarser configurations differ only in their eddy parameterization models: one uses the Mesoscale Eddy Kinetic Energy (MEKE), which represents the current state-of-the-art. The other uses “SmartSim-EKE”, which is based on a neural network trained to infer the eddy kinetic energy.

+ +

In our demonstration, we used SmartSim’s ensemble capabilities to run 12 parallel SmartSim-EKE simulations thereby demonstrating the scalability and performance of SmartSim. In so doing we were able to evaluate the accuracy of EKE parameterizations, and estimate overall computational cost at scale. We computed each ensemble member for 10 simulated years on an aggregate total combining 10,920 Intel Skylake and Cascadelake processors cores along with 16 Nvidia P100 GPUs dedicated to the shared in-memory database. Figure 2 summarizes the MOM6 ensemble workflow and the translation of SmartSim workflow descriptions to launched jobs on the hardware cluster.

+ +

SmartSim

+

Summary of MOM6 workflow developed with SmartSim.

+ +

We compare SmartSim-EKE and MEKE to the “true” EKE calculated from ER in the images below. As shown in Figures 3 and 4 below, SmartSim-EKE tends to overestimate the extent of the equatorial (0 latitude) EKE, but otherwise provides a much more accurate predictions of large-scale trends compared to the MEKE state-of-the-art predictions. Importantly, these gains in accuracy from the SmartSim-EKE ML model did not incur significant computational penalties relative to the state-of-the-art. Specifically, we observed only a 1.5% slowdown in the simulation – negligible on modern systems with heterogeneous compute nodes and higher GPU counts. These results show that machine learning infused into traditional HPC workloads can provide significant improvements in accuracy and/or performance. Moreover, SmartSim enabled these ML-driven gains without extensive changes to the HPC application source code or requiring maintenance of a one-of-a-kind ML infrastructure. More detailed information on the accuracy and performance of this SmartSim use case can be found in the Journal of Computational Science (https://doi.org/10.1016/j.jocs.2022.101707).

+ +

SmartSim

+

Eddy kinetic energy (EKE), averaged over the last year of each simulation, calculated from the most-accurate eddy-resolving (ER) simulation (a), inferred using SmartSim-EKE and averaged over all 12 ensemble members (b), and the current state-of-the-art MEKE parameterization (c).

+ +

SmartSim

+

Zonally averaged EKE (on a log10 scale) as a function of latitude from the ER, SmartSim-EKE, and MEKE. Note that within 20 degrees of the equator MEKE computes a near-zero value for EKE.

+ +

To stay up-to-date on new SmartSim features and release, please favorite (star) the SmartSim GitHub repository: https://github.com/CrayLabs/SmartSim.

+ +
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits.html b/summits.html new file mode 100644 index 0000000000..d227ef6efc --- /dev/null +++ b/summits.html @@ -0,0 +1,341 @@ + + + + + Workflows Community Summits - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summits +

+
+
+
+
+ +
+
+
+
+
+
+

+ This unique series of events gather researchers, developers, and users from distinct workflow systems and + applications + to identify crucial challenges in the workflow community +

+
+
+ +
+ + +
+
+
+
+ Sep 03, 2024 +
+

Workflows Community Summit 2024

+ Future Trends and Challenges in Scientific Workflows + + DOI + +
+
+
+ +
+
+
+
+ Nov 29, 2022 +
+

Workflows Community Summit 2022

+ A Roadmap Revolution + + DOI + +
+
+
+ +
+
+
+
+ Nov 08, 2021 +
+

Workflows Community Summit 2021.11

+ Tightening the Integration between Computing Facilities and Scientific Workflows + + DOI + +
+
+
+ +
+
+
+
+ Apr 07, 2021 +
+

Workflows Community Summit 2021.4

+ Advancing the State-of-the-art of Scientific Workflows Management Systems Research and Development + + DOI + +
+
+
+ +
+
+
+
+ Jan 13, 2021 +
+

Workflows Community Summit 2021.1

+ Bringing the Scientific Workflows Community Together + + DOI + +
+
+
+ +
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits/2022/index.html b/summits/2022/index.html new file mode 100644 index 0000000000..4a3402fa77 --- /dev/null +++ b/summits/2022/index.html @@ -0,0 +1,544 @@ + + + + + Workflows Community Summit 2022 - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summit 2022 +

+
+
+
+
+ +
+
+
+
+
+
+ A Roadmap Revolution +

Workflows Community Summit 2022

+
+

+ November 29 and 30, 2022
+ 8am-11am PST / 11am-2pm EST / 17:00-20:00 CET +

+ +

+ +

+

+ In the 2022 edition of the Workflows Community Summit, we will revisit the + 2021 community + roadmap, + discuss how things have evolved and propose an updated roadmap. This unique virtual event + invites + researchers and users of workflow management systems, and will seek to identify crucial challenges in the + workflow + community. +

+

+ We thank all participants for their valuable contributions. The event + report is available here: + DOI +

+

+

+

+
+ + +
+
+

Agenda

+
+
+

Day 1 - Nov 29, 2022

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeEvent
8:00-8:05am PST
11:00-11:05am + EST
17:00-17:05 CET		Welcome and Introductions
8:05-8:10am PST
11:05-11:10am + EST
17:05-17:10 CET		 + The Workflows Community Initiative overview +
+ Rafael Ferreira da Silva (ORNL) +
8:10-8:20am PST
11:10-11:20am + EST
17:10-17:20 CET		 + Remembering the 2021 Roadmap +
+ Rafael Ferreira da Silva (ORNL) +
8:20-8:50am PST
11:20-11:50am + EST
17:20-17:50 CET		 + Lightning talks
+
    +
  • Topic 1: Specifications, standards, and APIs +
    + Daniel Laney (LLNL), Kyle Chard (UChicago) +
    • +
  • Topic 2: AI workflows +
    + Shantenu Jha (BNL), Timo Bremer (LLNL) +
    • +
  • Topic 3: High performance data management and in situ workflows +
    + Silvina Caino-Lores (UTK), Frédéric Suter + (ORNL) +
    • +
+
8:50-9:00am PST
11:50am-noon + EST
17:50-18:00 CET		 + Break
+ (preparation for breakouts) +
9:00-10:30am PST
noon-1:30pm + EST
18:00-19:30 CET		 + Breakout sessions
+
    +
  • Topic 1: Specifications, standards, and APIs
    • +
  • Topic 2: AI workflows
    • +
  • Topic 3: High performance data management and in situ workflows
    • +
+
10:30-10:45am PST
1:30-1:45pm + EST
19:30-19:45 CET		 + Break +
10:45-11:00am PST
1:45-2:00pm + EST
19:45-20:00 CET		 + Reports from breakout sessions +
+
+ +
+

Day 2 - Nov 30, 2022

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeEvent
8:00-8:10am PST
11:00-11:10am + EST
17:00-17:10 CET		Welcome and Introductions
8:10-8:45am PST
11:10-11:45am + EST
17:10-17:45 CET		 + Lightning talks
+
    +
  • Topic 4: HPC and Quantum workflows +
    + Rosa Badia (BSC), Ian Buckley (Agnostiq), Venkat Bala + (Agnostiq) +
    • +
      +
    • Tensor Networks for Quantum Simulation +
      + Artur Garcia Saez (BSC)       +
      • +
    • Advances in Hybrid Quantum-Classical High-Performance + Computing +
      + Stefan Andersson (ParTec AG), Mathias Pütz (ParTec AG)       +
      • +
    • Workflow Scheduling Using Quantum Devices +
      + Justyna Zawalska (Academic Computer Centre CYFRONET AGH)       +
      • +
    • Mechanisms for Enhancing Reliability/Recovery and + Performance of Future Workloads +
      + Ryan E. Grant (Queen's University)       +
      • +
    • HPCQC System Workflows +
      + Martin Ruefenacht (Leibniz Supercomputing Centre)       +
      • +
    • Multi-Core Quantum Computing +
      + Aharon Brodutch (Entangled Networks)       +
      • +
    +
  • Topic 5: FAIR workflows +
    + Carole Goble (UManchester), Daniel S. Katz + (UIUC) +
    • +
  • Topic 6: Workflows for continuum and cross-facility computing +
    + Debbie Bard (NERSC), Tom Uram (ANL), Nick Tyler + (NERSC) +
    • +
+
8:45-9:00am PST
11:45am-noon + EST
17:45-18:00 CET		 + Break
+ (preparation for breakouts) +
9:00-9:15am PST
noon-12:15pm + EST
18:00-18:15 CET		 + Invited talk: A Translational Perspective on End-to-End Workflows +
+ Manish Parashar (Utah) + +
9:15-10:35am PST
12:15-1:35pm + EST
18:15-19:35 CET		 + Breakout sessions
+
    +
  • Topic 4: HPC and Quantum workflows
    • +
  • Topic 5: FAIR workflows
    • +
  • Topic 6: Workflows for continuum and cross-facility computing
    • +
+
10:35-10:45am PST
1:35-1:45pm + EST
19:35-19:45 CET		 + Break +
10:45-11:00am PST
1:45-2:00pm + EST
19:45-20:00 CET		 + Reports breakout sessions +
+
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + + + + +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits/2024/index.html b/summits/2024/index.html new file mode 100644 index 0000000000..923e0082c0 --- /dev/null +++ b/summits/2024/index.html @@ -0,0 +1,615 @@ + + + + + Workflows Community Summit 2024 - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summit 2024 +

+
+
+
+
+ +
+
+
+
+
+
+ Future Trends and Challenges in Scientific Workflows +

Workflows Community Summit 2024

+
+

+ Sep 3 and 4 (America / Europe / Africa) – 8am-11am (PDT), 11am-2pm (EDT), 5pm-8pm (CEST)
+ Sep 5 (Asia / Oceania) – 12:30 - 15:00 (AEST) +

+ +

+ +

+
+

+ The summit aims to explore the integration of AI and HPC workflows, coordination among multi-facility + resources, + near real-time data integration, user experience, heterogeneous HPC environments, and FAIR computational + workflows. Through interactive sessions and collaborative brainstorming, we will address the pressing + challenges + and opportunities in enhancing the efficiency, scalability, and resilience of scientific workflows. +

+

+ Topics: +

+
    +
  • Convergence of AI and HPC Workflows
    • +
  • Multi-Facility Workflows in Next-Generation Scientific Collaboration
    • +
  • Time-Sensitive Workflows
    • +
  • Heterogeneous HPC Environments
    • +
  • User Experience and Interfaces
    • +
  • FAIR Computational Workflows
    • +
+
+

+ We thank all participants for their valuable contributions.
+ The event report is available here: + DOI +

+

+
+ + +
+
+

Agenda

+
+
+

Day 1 - Sep 3, 2024

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeEvent
8:00-8:10am PDT
11:00-11:10am + EDT
17:00-17:10 CEST		Welcome and Introductions
8:10-8:20am PDT
11:10-11:20am + EDT
17:10-17:20 CEST		 + Frontiers in Scientific Workflows: Pervasive Integration with HPC +
+ http://dx.doi.org/10.1109/MC.2024.3401542 +
+ Rafael Ferreira da Silva (ORNL) +
8:20-8:50am PDT
11:20-11:50am + EDT
17:20-17:50 CEST		 + Lightning talks
+
    +
  • Topic 1: Time-Sensitive Workflows + +
    Utz-Uwe Haus (HPE), Shaun DeWitt (UKAEA) +
    • +
  • Topic 2: Convergence of AI and HPC Workflows + +
    Shantenu Jha (PPPL), Logan Ward (ANL) +
    • +
  • Topic 3: Multi-Facility Workflows in Next-Generation Scientific Collaboration + +
    Debbie Bard (LBNL), Tom Gibbs (NVIDIA) +
    • +
+
8:50-9:00am PDT
11:50am-noon + EDT
17:50-18:00 CEST		 + Break
+ (preparation for breakouts) +
9:00-10:30am PDT
noon-1:30pm + EDT
18:00-19:30 CEST		 + Breakout sessions
+
    +
  • Topic 1: Time-Sensitive Workflows
    • +
  • Topic 2: Convergence of AI and HPC Workflows
    • +
  • Topic 3: Multi-Facility Workflows in Next-Generation Scientific Collaboration
    • +
+
10:30-10:45am PDT
1:30-1:45pm + EDT
19:30-19:45 CEST		 + Break +
10:45-11:00am PDT
1:45-2:00pm + EDT
19:45-20:00 CEST		 + Reports from breakout sessions +
+
+ +
+

Day 2 - Sep 4, 2024

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeEvent
8:00-8:10am PDT
11:00-11:10am + EDT
17:00-17:10 CEST		Summary and Highlights of Day 1
+ Stephen Hudson (ANL)
8:10-8:45am PDT
11:10-11:45am + EDT
17:10-17:45 CEST		 + Lightning talks
+
    +
  • Topic 4: Heterogeneous HPC Environments + +
    William Godoy (ORNL), Stephen Hudson (ANL) +
    • +
  • Topic 5: User Experience and Interfaces + +
    Drew Paine (LBNL), Laila Los (UFreiburg) +
    • +
  • Topic 6: FAIR Computational Workflows + +
    Carole Goble (UManchester), Sean Wilkinson (ORNL) +
    • +
+
8:45-9:00am PDT
11:45am-noon + EDT
17:45-18:00 CEST		 + Break
+ (preparation for breakouts) +
9:00-9:20am PDT
12:00-12:20am + EDT
18:00-18:20 CEST		Invited Talk: AI-mediated Scientific Workflows +
+ Ian T. Foster (ANL/UChicago)
9:20-10:45am PDT
12:20-1:45pm + EDT
18:20-19:45 CEST		 + Breakout sessions
+
    +
  • Topic 4: Heterogeneous HPC Environments
    • +
  • Topic 5: User Experience and Interfaces
    • +
  • Topic 6: FAIR Computational Workflows
    • +
+
10:45-11:00am PDT
1:45-2:00pm + EDT
19:45-20:00 CEST		 + Reports breakout sessions +
+
+ +
+

Day 3 - Sep 5, 2024 — Special Event for Asia/Oceania timezones

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeEvent
12:30 - 12:35 AESTWelcome
+ Sean Wilkinson (ORNL), Johan Gustafsson (Australian BioCommons) +
12:35 - 12:45 AESTContext setting presentation for the WCI
+ Sean Wilkinson (ORNL)
12:45 - 12:55 AESTPerspective on Bioinformatics Workflows in Australia +
+ Johan Gustafsson (Australian BioCommons, University of Melbourne)
12:55 - 13:35 AEST + Lightning talks
+
    +
  • Workflows in Cancer Genomics +
    + Sehrish Kanwal (University of Melbourne) +
    • +
  • Heterogeneous HPC Environments + +
    Stephen Hudson (ANL) +
    • +
  • Workflow Execution with Seqera Platform + +
    Ziad Al Bkhetan (Australian BioCommons) +
    • +
  • + Migrating Complex Workflows to the Exascale: Challenges for Radio Astronomy + +
    Pascal Elahi (Pawsey Supercomputing Research Centre) +
    • +
+
13:35 - 13:40 AEST + Short Break +
13:40 - 14:40 AEST + Breakout sessions
+
    +
  • #1: Heterogeneous HPC Environments
    • +
  • #2: Multi-Facility Workflows
    • +
  • #3: What makes a Workflow Good?
    • +
+
14:40 - 15:00 AEST + Reports from groups +
+
+
+ +
+
+

Supporters

+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits/community/index.html b/summits/community/index.html new file mode 100644 index 0000000000..53a3292b94 --- /dev/null +++ b/summits/community/index.html @@ -0,0 +1,498 @@ + + + + + Workflows Community Summit 2021.1 - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summit 2021.1 +

+
+
+
+
+ +
+
+
+
+
+
+ Bringing the Scientific Workflows Community Together +

Workflows Community Summit 2021.1

+
+

+ Wed - Jan 13, 2021
+ 9am-noon PST / noon-3pm EST / 17:00-20:00 UTC +

+ +

+ The workflowsRI and ExaWorks projects are organizing the Workflows Community Summit. This + unique event will gather a select group of lead researchers from distinct workflow management systems, and will + seek to identify crucial challenges in the workflow community. This event will be the first of + a series of focused meetings, and will serve to define the strategic goals for upcoming meetings with the + science and workflow developer communities. +

+

+ We thank all participants for their valuable contributions. The event + report is available here: + DOI +

+

+ +

+
+ +
+
+

Agenda

+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeTopic
+ 9-9:05am PST
+ noon-12:05pm EST
+ 17:00-17:05 UTC + 		Welcome and introductions
Rafael Ferreira da Silva
+ 9:05-9:15am PST
+ 12:05-12:15pm EST
+ 17:05-17:15pm UTC + 		+ workflowsRI project overview +   + + + +
Rafael Ferreira da Silva +
+ 9:15-9:25am PST
+ 12:15-12:25pm EST
+ 17:15-17:25pm UTC + 		+ ExaWorks project overview +   + + + +
Dan Laney +
+ 9:25-9:55am PST
+ 12:25-12:55pm EST
+ 17:25-17:55pm UTC + 		+ Lightning talks + + + + + + + + + + + + + + + + + + + +
+ Theme 1: FAIR computational workflows +   + + + +
Carole Goble +
+ Theme 2: Training and education for workflow users +   + + + +
Lavanya Ramakrishnan +
+ Theme 3: AI workflows +   + + + +
Luc Peterson +
+ Theme 4: Exascale challenges and beyond +   + + + +
Bjoern Enders +
+ Theme 5: APIs, interoperability, reuse, and standards +   + + + +
Douglas Thain +
+ Theme 6: Building a workflows community +   + + + +
Ilkay Altintas +
+
+ 9:55-10:05am PST
+ 12:55-1:05pm EST
+ 17:55-18:05 UTC + 		10min Break (preparation for breakout sessions)
+ 10:05-10:35am PST
+ 1:05-1:35pm EST
+ 18:05-18:35pm UTC + 		+ Breakout Session 1 + + + + + + + + + + +
Theme 1: FAIR computational workflows
Theme 2: Training and education for workflow users
Theme 3: AI workflows
+
+ 10:35-10:50am PST
+ 1:35-1:50pm EST
+ 18:35-18:50pm UTC + 		Reports: Breakout Session 1
+ 10:50-11:05am PST
+ 1:50-2:05pm EST
+ 18:50-19:05 UTC + 		15min Break
+ 11:05-11:35am PST
+ 2:05-2:35pm EST
+ 19:05-19:35 UTC + 		+ Breakout Session 2 + + + + + + + + + + +
Theme 4: Exascale challenges and beyond
Theme 5: APIs, interoperability, reuse, and standards
Theme 6: Building a workflows community
+
+ 11:35-11:50am PST
+ 2:35-2:50pm EST
+ 19:35-19:50 UTC + 		Reports: Breakout Session 2
+ 11:50am-noon PST
+ 2:50-3pm EST
+ 19:50-20:00 UTC + 		Final remarks and moving forward
Kyle Chard
+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits/facilities/index.html b/summits/facilities/index.html new file mode 100644 index 0000000000..ff461f261e --- /dev/null +++ b/summits/facilities/index.html @@ -0,0 +1,377 @@ + + + + + Workflows Community Summit 2021.11 - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summit 2021.11 +

+
+
+
+
+ +
+
+
+
+
+
+ Tightening the Integration between Computing Facilities and Scientific Workflows +

Workflows Community Summit 2021.11

+
+
+ Mon - Nov 08, 2021
+ 10:30am-1:00pm PST / 1:30pm-4:00pm EST +
+ +

+ The third Workflows Community Summit will explore workflows challenges and opportunities from the perspective of + computing centers and facilities. The summit is the third in the series organized by the NSF workflowsRI and DOE + ExaWorks projects, and builds on two prior workshops that 1) + established a high level vision for workflows research; and 2) explored technical approaches for realizing that + vision. +

+ +

+ A summary of the previous workshops is available in two technical reports + ( + DOI + and + + DOI) + and an invited paper + (arXiv) at the WORKS workshop + describing the community roadmap. +

+ +

+ The third workshop will bring together a small group of facilities representatives (one per facility) with the + aim to understand how workflows are currently being used at each facility, how facilities would like to interact + with workflow developers and users, how workflows fit with facility roadmaps, and what opportunities there are + for tighter integration between facilities and workflows. +

+ +

+ We thank all participants for their valuable contributions. The event + report is available here: + DOI +

+ +

+
+ +
+
+

Agenda

+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeTopic
+ 10-30:45am PST
+ 1:30-1:45pm EST + 		+ Welcome and Introductions +
+ Rafael Ferreira da Silva (Oak Ridge National Laboratory) +
+ 10:45-11:45am PST
+ 1:45-2:45pm EST + 		+ Facility Perspectives on Workflows +
    +
  • What is a workflow for you?
    • +
  • What are some of the challenges you see supporting workflows?
    • +
  • What are your current practices to support workflows (e.g., documentation, native systems, etc.)?
    • +
+
+ 11:45-noon PST
+ 2:45-3:00pm EST + 		15min Break
+ noon-12:10pm PST
+ 3:00-3:10pm EST + 		+ ExaWorks Introduction +
+ Shantenu Jha (Brookhaven National Laboratory / Rutgers University) +
+ Kyle Chard (University of Chicago / Argonne National Laboratory) +
+ 12:10-1:00pm PST
+ 3:10-4:00pm EST + 		+ Review Roadmap Developed by Workflows User and Developer Communities +
+
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/summits/technical/index.html b/summits/technical/index.html new file mode 100644 index 0000000000..89290606f5 --- /dev/null +++ b/summits/technical/index.html @@ -0,0 +1,517 @@ + + + + + Workflows Community Summit 2021.4 - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Community Summit 2021.4 +

+
+
+
+
+ +
+
+
+
+
+
+ Advancing the State-of-the-art of Scientific Workflows Management Systems Research and Development +

Workflows Community Summit 2021.4

+
+

+ Wed - Apr 07, 2021
+ 10am-1pm PDT / 1pm-4pm EDT / 19:00-22:00 CEST +

+

+ The workflowsRI and ExaWorks projects held a very productive Workflows + Community + Summit in January. The focus was to identify broad challenges for the workflows community and to propose + a + vision for community activities to address these challenges. +

+

+ While the first summit focused on Establishing a high level vision, this second summit will explore + technical approaches for realizing (part of) that vision. Consequently, we hope to engage + participants who are actively involved in workflow system development. +

+ +

+ Based on the outcomes of the first summit, we have identified four technical topics for discussion (some align + with a single theme of the first summit, while others are cross-cutting): +

+
    +
  1. Definition of common workflow patterns and benchmarks (both for determining workflow system functionality + and for providing users with tutorial examples); +
    2. +
  2. Identifying paths toward interoperability of workflow systems; and
    3. +
  3. Improving workflow systems' interface with legacy and emerging HPC software and hardware stacks
    4. +
+ +

+ We thank all participants for their valuable contributions. The event + report is available here: + DOI +

+ +

+
+ +
+
+

Agenda

+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
TimeTopic
+ 10-10:05am PDT
+ 1:00-1:05pm EDT
+ 19:00-19:05 CEST + 		+ Welcome and Introductions +   + + + +
+ Rafael Ferreira da Silva (University of Southern California) +
+ 10:05-10:15am PDT
+ 1:05-1:15pm EDT
+ 19:05-19:15 CEST + 		+ Workflows Community Summit Report and Key Findings +   + + + +
+ Henri Casanova (University of Hawaii at Manoa)
+ + DOI + +
+ 10:15-10:30am PDT
+ 1:15-1:30pm EDT
+ 19:15-19:30 CEST + 		+ Lightning talks + + + + + + + + + + +
+ Theme 1: Definition of common workflow patterns and benchmarks +   + + + +
+ Dan Laney (Lawrence Livermore National Laboratory)
+ Dorran Howell (Tweag I/O) +
+ Theme 2: Identifying paths toward interoperability of workflow + systems +   + + + +
+ Ilkay Altintas (UC San Diego)
+ Stian Soiland-Reyes (The University of Manchester) +
+ Theme 3: Improving workflow systems' interface with legacy and emerging HPC + software and hardware stacks +   + + + +
+ Douglas Thain (University of Notre Dame)
+ Rosa Filgueira (Heriot-Watt University) +
+
+ 10:30-10:35am PDT
+ 1:30-1:35pm EDT
+ 19:30-19:35 CEST + 		5min Break
(preparation for breakout sessions)
+ 10:35-11:15am PDT
+ 1:35-2:15pm EDT
+ 19:35-20:15 CEST + 		+ Project Development Sessions + + + + + + + + + + +
+ Theme 1: Definition of common workflow patterns and benchmarks +
+ Theme 2: Identifying paths toward interoperability of workflow systems +
+ Theme 3: Improving workflow systems' interface with legacy and emerging HPC software + and + hardware stacks +
+
+ 11:15-11:30am PDT
+ 2:15-2:30pm EDT
+ 20:15-20:30 CEST + 		15min Break
+ 11:30-12:10pm PDT
+ 2:30-3:10pm EDT
+ 20:30-21:10 CEST + 		+ Project Roadmap Write Up Sessions + + + + + + + + + + +
+ Theme 1: Definition of common workflow patterns and benchmarks +
+ Theme 2: Identifying paths toward interoperability of workflow systems +
+ Theme 3: Improving workflow systems' interface with legacy and emerging HPC software + and + hardware stacks +
+
+ 12:10-12:25am PDT
+ 3:10-3:25pm EDT
+ 21:10-21:25 CEST + 		15min Break
+ 12:25-12:40pm PDT
+ 3:25-3:40pm EDT
+ 21:25-21:40 CEST + 		+ Reports: Project Roadmap Sessions +
+ Dan Laney (Lawrence Livermore National Laboratory)
+ Dorran Howell (Tweag I/O)
+ Ilkay Altintas (UC San Diego)
+ Stian Soiland-Reyes (The University of Manchester)
+ Douglas Thain (University of Notre Dame)
+ Rosa Filgueira (Heriot-Watt University) +
+ 12:40-12:50pm PDT
+ 3:40-3:50pm EDT
+ 21:40-21:50 CEST + 		+ Final Remarks and Moving Forward +   + + + +
+ Kyle Chard (University of Chicago) +
+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems.html b/systems.html new file mode 100644 index 0000000000..487fd56e7d --- /dev/null +++ b/systems.html @@ -0,0 +1,1193 @@ + + + + + Workflows Systems - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Workflows Systems +

+
+
+
+
+ +
+
+
+
+ + + + +
+
+

+ Collection of actively-developed open source workflow systems. Currently, 21 workflow systems provide WCI metadata. +

+ Contribute +
+
+ +
+ + +
+
+
+ +

+ + cctools + +

+ +

TaskVine

+
+ An execution system for large scale data intensive dynamic workflows. +
+

+ Python
+ + release/7.14.3
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + snakemake + +

+ +

Snakemake

+
+ This is the development home of the workflow management system Snakemake. For general information, see +
+

+ Python
+ + v8.27.1
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + streamflow + +

+ +

StreamFlow

+
+ Towards Cloud-HPC Continuum +
+

+ Python
+ + 0.2.0.dev11
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + aiida-core + +

+ +

AiiDA

+
+ A workflow manager for computational science with a strong focus on provenance, performance and extensibility. +
+

+ Python
+ + AiiDA v2.6.3
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + SmartSim + +

+ +

SmartSim

+
+ Machine learning workflows with HPC applications (Python, C++, C, and Fortran) +
+

+ Python
+ + 0.8.0
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + dagonstar + +

+ +

DagOnStar

+
+ DAGonStar is a simple Python-based workflow engine that runs jobs on everything from the local machine to distributed virtual HPC clusters hosted in private and public clouds. +
+

+ Python
+ + v1.0.2
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + cctools + +

+ +

Makeflow

+
+ Makeflow is a workflow system for parallel and distributed computing that uses a language very similar to Make. +
+

+ Make
+ + release/7.14.3
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + nextflow + +

+ +

Nextflow

+
+ A DSL for data-driven computational pipelines +
+

+ Groovy
+ + Version 24.12.0-edge
+ + 24 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + covalent + +

+ +

Covalent

+
+ Distributed workflows for quantum and HPC +
+

+ Python
+ + v0.237.0-rc.0
+ + 23 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + geoweaver + +

+ +

Geoweaver

+
+ a lightweight workflow software to easily orchestrate pipelines from Python and shell scripts and preserve history of every execution +
+

+ JavaScript
+ + v1.8.6
+ + 23 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + parsl + +

+ +

Parsl

+
+ Productive parallel programming in Python +
+

+ Python
+ + 1.2.0
+ + 22 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + nipype + +

+ +

nipype

+
+ Neuroimaging in Python: Pipelines and Interfaces +
+

+ Python3
+ + 1.8.4
+ + 22 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + scipipe + +

+ +

SciPipe

+
+ Robust, flexible and resource-efficient pipelines using Go and the commandline. +
+

+ Go
+ + v0.12.0: Important bugfix. Minor API change.
+ + 22 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + pyiron_base + +

+ +

pyiron

+
+ A workflow manager for scientific computing on high performance computing infrastructures +
+

+ python
+ + pyiron_base-0.11.0
+ + 21 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + maestrowf + +

+ +

Maestro Workflow Conductor

+
+ Orchestrate your HPC workflows with ease +
+

+ Python
+ + v1.1.10
+ + 20 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + libensemble + +

+ +

libEnsemble

+
+ Tool for running dynamic ensembles. +
+

+ Python
+ + 1.4.3
+ + 18 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + common-workflow-language + +

+ +

Common Workflow Language

+
+ Interoperable workflow execution of containerized command line tools +
+

+ YAML
+ + 1.2.0
+ + 13 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + compss + +

+ +

PyCOMPSs/COMPSs

+
+ Easy task-based parallelization and efficient execution in distributed infrastructures. +
+

+ ['Python', 'Java', 'C/C++']
+ + 3.3.1 Orchid Update
+ + 01 Jan 2025
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + merlin + +

+ +

Merlin

+
+ Enabling Machine Learning HPC Workflows +
+

+ Python
+ + Version 1.12.2
+ + 07 Dec 2024
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + watts + +

+ +

WATTS

+
+ Workflow and Template Toolkit for Simulation +
+

+ Python
+ + 0.5.1
+ + 10 Nov 2024
+ + + WCI metadata + +

+
+
+
+ +
+
+
+ +

+ + EE-Demo + +

+ +

Apollo Runtime System

+
+ A runtime system for the orchestration of workflows across the cloud-edge-Iot continuum. +
+

+ Polyglot for Functions, AFCL for workflows
+ + v1.1.0
+ + 13 Dec 2021
+ + + WCI metadata + +

+
+
+
+ + + + +
+
+
+ +

+ + dask + +

+ +

dask

+
+ Parallel computing with task scheduling +
+

+ Python
+ + 2024.12.1
+ + 25 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + mlflow + +

+ +

mlflow

+
+ Open source platform for the machine learning lifecycle +
+

+ Python
+ + MLflow 2.20.0
+ + 25 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + cromwell + +

+ +

cromwell

+
+ Scientific workflow engine designed for simplicity & scalability. Trivially transition between one off use cases to massive scale production environments +
+

+ Scala
+ + 87
+ + 24 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + prefect + +

+ +

prefect

+
+ Prefect is a workflow orchestration framework for building resilient data pipelines in Python. +
+

+ Python
+ + 3.1.15.dev1: Nightly Development Release
+ + 24 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + galaxy + +

+ +

galaxy

+
+ Data intensive science for everyone. +
+

+ Python
+ + v24.1.4
+ + 24 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + pegasus + +

+ +

pegasus

+
+ Pegasus Workflow Management System - Automate, recover, and debug scientific computations. +
+

+ Java
+ + 23 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + swift-t + +

+ +

swift-t

+
+ Swift/T: High Performance Parallel Scripting Language +
+

+ Java
+ + 23 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + fireworks + +

+ +

fireworks

+
+ The Fireworks Workflow Management Repo. +
+

+ Python
+ + v2.0.4
+ + 22 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + jobflow + +

+ +

jobflow

+
+ jobflow is a library for writing computational workflows. +
+

+ Python
+ + v0.1.19
+ + 20 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + radical.entk + +

+ +

radical.entk

+
+ The RADICAL Ensemble Toolkit +
+

+ Python
+ + v1.42.0
+ + 16 Jan 2025
+

+
+
+
+ +
+
+
+ +

+ + signac-flow + +

+ +

signac-flow

+
+ Workflow management for signac-managed data spaces. +
+

+ Python
+ + v0.29.0
+ + 02 Dec 2024
+

+
+
+
+ +
+ +
+
+

+ For a comprehensive lists of all known computational workflow systems, see Computational Data Analysis Workflow Systems + maintained by the CWL community. +

+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/EE-Demo/index.html b/systems/EE-Demo/index.html new file mode 100644 index 0000000000..bae7cc9ee1 --- /dev/null +++ b/systems/EE-Demo/index.html @@ -0,0 +1,312 @@ + + + + + Apollo Runtime System - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Apollo Runtime System +

+
+
+
+
+ +
+
+
+
+
+
+ None
+ Apollo Runtime System +

Apollo Runtime System

+ Last updated: 13 Dec 2021
+ v1.1.0 — Released on: 02 Mar 2022
+ + https://github.com/Apollo-Core/EE-Demo
+
+ https://www.youtube.com/channel/UCk3lsT2ImJl3hqhg7mc15Ag +
+ +
+

A runtime system for the orchestration of workflows across the cloud-edge-Iot continuum.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Polyglot for Functions, AFCL for workflows

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 4 +   |   + 0 +   |   + 0 +   |   + NOASSERTION +

+
+
+ stefanpedratscherChrisEngelhardt +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/SmartSim/index.html b/systems/SmartSim/index.html new file mode 100644 index 0000000000..677b85bff6 --- /dev/null +++ b/systems/SmartSim/index.html @@ -0,0 +1,312 @@ + + + + + SmartSim - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SmartSim +

+
+
+
+
+ +
+
+
+
+
+
+
+ SmartSim +

SmartSim

+ Last updated: 24 Jan 2025
+ 0.8.0 — Released on: 25 Sep 2024
+ + https://github.com/CrayLabs/SmartSim
+
+ +
+ +
+

SmartSim is a workflow library that makes it easier to use common Machine Learning (ML) libraries, like PyTorch and TensorFlow, in combination with High Performance Computing (HPC) simulations and applications. SmartSim launches ML infrastructure on HPC systems alongside user workloads and supports most HPC workload managers (e.g. Slurm, PBSPro, SGE). SmartSim also provides a set of client libraries in Python, C++, C, and Fortran. These client libraries allow users to send and receive data between user applications and the machine learning infrastructure. Moreover, the client APIs enable the execution of machine learning tasks like inference and online training from within user code. The exchange of data and execution of machine learning tasks is orchestrated by a high performance in-memory database that is launched and managed by SmartSim.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python API
  • Python Client API
  • C++ Client API
  • C Client API
  • Fortran Client API

  • Resource Managers

  • Slurm
  • PBSPro
  • SGE
  • Linux/MacOS

  • Transfer Protocols

  • TCP/IP
  • Unix Domain Sockets (UDS)
+ + +
+
+

Contributors

+

+ 37 +   |   + 237 +   |   + 59 +   |   + BSD-2-Clause +

+
+
+ al-rigazziSparteeMattToastEricGustinastatideashaoankonaamandarichardsonnmellis13jedwards4bctandon11billschereriiijuliaputkoAlyssaCoteben-albrechtbenjamin-robbinsrickybalinjstam-kurz +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/aiida-core/index.html b/systems/aiida-core/index.html new file mode 100644 index 0000000000..68c7926019 --- /dev/null +++ b/systems/aiida-core/index.html @@ -0,0 +1,314 @@ + + + + + AiiDA - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ AiiDA +

+
+
+
+
+ +
+
+
+
+
+
+ https://aiida-core.readthedocs.io
+ AiiDA +

AiiDA

+ Last updated: 24 Jan 2025
+ AiiDA v2.6.3 — Released on: 06 Nov 2024
+ + https://github.com/aiidateam/aiida-core
+ https://twitter.com/aiidateam
+ https://www.youtube.com/c/MaterialsCloud +
+ +
+

AiiDA is an open-source Python infrastructure to help researchers with automating, managing, persisting, sharing and reproducing +the complex workflows associated with modern computational science and all associated data. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python
  • Command Line
  • REST

  • Resource Managers

  • Slurm
  • LSF
  • PBS
  • SGE

  • Transfer Protocols

  • SCP
+ + +
+
+

Contributors

+

+ 192 +   |   + 442 +   |   + 471 +   |   + NOASSERTION +

+
+
+ sphubergiovannipizzicepellottiszoupanosmuhrinlekahltalirzgreschdDropDchrisjsewellfernandogargiulo1986dev-zerounkcpzCasperWAriccardosabatiniphisch124csadorfmbercxdanielhollasmerkysyakutovicharamirezfranciscofdependabot[bot]zhubonanagoscinskiGeigerJ2borellimConradJohnstonkhsralielsapassaro +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/common-workflow-language/index.html b/systems/common-workflow-language/index.html new file mode 100644 index 0000000000..87091785ee --- /dev/null +++ b/systems/common-workflow-language/index.html @@ -0,0 +1,319 @@ + + + + + Common Workflow Language - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Common Workflow Language +

+
+
+
+
+ +
+
+
+
+
+
+ https://www.commonwl.org
+ Common Workflow Language +

Common Workflow Language

+ Last updated: 13 Jan 2025
+ 1.2.0 — Released on: 07 Aug 2020
+ + https://github.com/common-workflow-language/common-workflow-language
+ https://twitter.com/commonwl
+ +
+ +
+

The Common Workflow Language (CWL) is an open standard for describing analysis workflows and tools +in a way that makes them portable and scalable across a variety of software and hardware environments, +from workstations to cluster, cloud, and high performance computing (HPC) environments. +CWL is designed to meet the needs of data-intensive science, such as Bioinformatics, Medical Imaging, +Astronomy, High Energy Physics, and Machine Learning. + +Multiple engines implements the CWL standard, making the workflows executable and interoperable with minimal or no changes. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

YAML

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Command Line
  • Web
  • REST APIs

  • Resource Managers

  • Local
  • AWS
  • GCP
  • Azure
  • Slurm
  • Google Cloud
  • Grid Engine
  • HTCondor
  • LSF
  • Mesos
  • OpenStack
  • PBS/Torque
  • Kubernetes
  • Singularity
  • Occam
+ + +
+
+

Contributors

+

+ 196 +   |   + 1457 +   |   + 242 +   |   + Apache-2.0 +

+
+
+ mr-ctetronmanu-chromastainjmchiltonhmenagerboyshatom-tankapilkd13otiai10manabuishiiguillermo-carrascopsafontThomasHickmandleehrsersorrelgijzelaerrportahmichael-kotliardenis-yuenporterjamesjkellrottwgerlachchapmanbpsaffrey-illuminacuremdmiller53tjelvar-olssonsinisa88abeconnelly +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/compss/index.html b/systems/compss/index.html new file mode 100644 index 0000000000..b2f931a1fe --- /dev/null +++ b/systems/compss/index.html @@ -0,0 +1,312 @@ + + + + + PyCOMPSs/COMPSs - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ PyCOMPSs/COMPSs +

+
+
+
+
+ +
+
+
+
+
+
+ https://compss.bsc.es
+ PyCOMPSs/COMPSs +

PyCOMPSs/COMPSs

+ Last updated: 01 Jan 2025
+ 3.3.1 Orchid Update — Released on: 05 Jun 2024
+ + https://github.com/bsc-wdc/compss
+ https://twitter.com/bsc_compss
+ https://www.youtube.com/channel/UCxx5hojMjCNqKRJclMaJbHQ +
+ +
+

COMP Superscalar (COMPSs) is a task-based programming model which aims to ease the development of applications for distributed infrastructures, such as large High-Performance Clusters (HPC), Clouds and Container managed clusters. PyCOMPSs is the Python binding of COMPSs.
COMPSs provides a programming interface for the development of the applications in Python/Java/C/C++, a runtime system that exploits the inherent parallelism of applications at execution time, and a rich ecosystem for the operation monitoring, performance evaluation and integration with Jupyter/Jupyterlab.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

['Python', 'Java', 'C/C++']

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Local
  • High Performance Cluster (HPC)
  • Clouds
  • Docker
  • Mesos

  • Resource Managers

  • SLURM
  • PBS
  • LSF
  • SGE
  • TCS

  • Transfer Protocols

  • NIO
  • SCP
+ + +
+
+

Contributors

+

+ 20 +   |   + 48 +   |   + 13 +   |   + Apache-2.0 +

+
+
+ flordanfjconejerocristianrcvkafkaslrsirventMarc43srgrrGabrielPuigdemuntcTaturamonamelalezzidanadriaaapclementFoyerMinimega12121martabertran8compsuperscalarnihadnessiraola +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/contribute.html b/systems/contribute.html new file mode 100644 index 0000000000..f4ac6f91a5 --- /dev/null +++ b/systems/contribute.html @@ -0,0 +1,359 @@ + + + + + Contribute: Workflows Systems - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Contribute: Workflows Systems +

+
+
+
+
+ +
+
+
+
+
+
+ Register an actively-developed open source workflow system +

How to Contribute with a Workflow System

+ All Systems +
+ +
+

+ The Workflows Community Initiative (WCI) provides a curated collection of actively-developed open + source workflow systems. The main goal of this collection is to showcase workflow system + capabilities developed + by the community. We invite all workflow system developers and users to share their workflow systems through + this + collection. +

+ +

Adding a Workflow System Repository

+

+ To add a workflow system repository, you only need to add the organization and repository names + into an + YAML + file hosted as part of the WCI GitHub repository. The preferred way to submit your changes is via creating a + pull + request + with the changes. To this end, these are the recommended steps for adding a workflow system: +

+
    +
  1. Fork the WCI GitHub repository
    2. +
  2. Clone your forked repository: + 
    git clone https://github.com/<your_username>/workflowscommunity.github.io
    +
    3. +
  3. Edit the _data/workflow_systems.yml file, and add the information + regarding + the workflow system repository: + 
    +- organization: <github-organization>
+  repository: <workflow-system-repository>
+  type: github
+  metadata: <relative-path-to-wci-yml-file> # relative path to the .wci.yml file in the repository
    +
    4. +
  4. Commit the changes, and create a pull request for the WCI GitHub + repository.
    5. +
  5. The WCI team will then evaluate your pull request, and merge the changes if the workflow system + repository + and examples are properly documented.
    6. +
+ + +

Providing a Rich Set of Information

+

+ Although the minimum requirement for publishing a workflow system is to only have an open source repository + with a + reasonable documentation, we strongly encourage workflow system developers to provide additional metadata. +

+

+ WCI seeks for a .wci.yml file in the root folder of the workflow system repository. This file + is expected + to contain metadata that would enrich the workflow system description at WCI. +

+

+ The following example summarizes the current list of available metadata keywords (all fields are optional): +

+ 
+name: <workflow_system_name> # will use GitHub repository name if not provided
+
+icon: <url_to_workflow_system_logo> # will use GitHub organization icon if not provided
+
+headline: <brief_description> # will use GitHub repository description if not provided
+
+description: <long_description> # will use GitHub repository description if not provided
+
+language: <workflow_system_language> # will attempt to fetch GitHub repository main language if not provided
+            
+release: # will attempt to fetch latest release from GitHub repository if not provided
+  version: <release_name> 
+  date: <release_date> # format: YYYY-MM-DD
+  url: <release_url>
+            
+documentation: # nothing will be used if not provided
+  general: <documentation_url>
+  installation: <installation_url>
+  tutorial: <tutorial_url>
+            
+social: # nothing will be used if not provided
+  twitter: <twitter_name>
+  youtube: <youtube_channel_url>
+            
+execution_environment: # nothing will be used if not provided
+  interfaces: # list of interfaces
+    - <interface_1>
+    - <interface_2>
+  resource_managers: # list of supported resource managers
+    - <resource_manager_1>
+    - <resource_manager_2>
+  transfer_protocols: # list of supported transfer protocols
+    - <transfer_protocol_1>
+    - <transfer_protocol_2>            
+
+ +

+ WCI uses GitHub actions to fetch repository information and build the workflow systems' pages. Updates to + the YAML files + are currently processed at every 12 hours. +

+
+
+
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/covalent/index.html b/systems/covalent/index.html new file mode 100644 index 0000000000..c82584be66 --- /dev/null +++ b/systems/covalent/index.html @@ -0,0 +1,320 @@ + + + + + Covalent - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Covalent +

+
+
+
+
+ +
+
+
+
+
+
+ https://www.covalent.xyz
+ Covalent +

Covalent

+ Last updated: 23 Jan 2025
+ v0.237.0-rc.0 — Released on: 23 Jan 2025
+ + https://github.com/AgnostiqHQ/covalent
+ https://twitter.com/covalentxyz
+ +
+ +
+

Covalent is a Pythonic workflow tool used to execute HPC and quantum tasks +in heterogenous environments. Users functionalize existing code, apply +Python decorators, and then dispatch workflows to the Covalent server. Users +can monitor job statuses and view metadata in the Covalent user interface, +or query information programmatically via REST API endpoints. Covalent is +designed for rapid prototyping and pre-production R&D workflows, so that +users can quickly identify optimal software parameters and hardware backends +for any particular application. +

+
+
+ +
+

Install

 + +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python API
  • REST API
  • Browser UI

  • Resource Managers

  • Slurm
  • NERSC Superfacility
  • AWS Batch
  • Amazon ECS
  • AWS Lambda
  • Amazon Braket
  • Azure Batch
  • Google Batch
  • Kubernetes

  • Transfer Protocols

  • rsync
  • HTTP
  • Amazon S3
  • Azure Blob Storage
  • Google Cloud Storage
+ + +
+
+

Contributors

+

+ 97 +   |   + 795 +   |   + 82 +   |   + Apache-2.0 +

+
+
+ wjcunningham7cjaokessler-frostAlejandroEsquivelFyzHsnvenkatBaladependabot[bot]Prasy12Andrew-S-Rosenmadhur-tandonEmmanuel289pre-commit-ci[bot]dwelsch-esiaraghukasjkanemAravind-psiogHaimHorowitzAgnostiqruihao-liscottwnvalkostadinovFilipBoltWingCodesayandipduttapoojithuraoAnnaGwenArunPsiogRaviPsiogsantoshkumarradhampvgithubUdayan853 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/cromwell/index.html b/systems/cromwell/index.html new file mode 100644 index 0000000000..f7fb980b0c --- /dev/null +++ b/systems/cromwell/index.html @@ -0,0 +1,312 @@ + + + + + cromwell - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ cromwell +

+
+
+
+
+ +
+
+
+
+
+
+ http://cromwell.readthedocs.io/
+ cromwell +

cromwell

+ Last updated: 24 Jan 2025
+ 87 — Released on: 07 May 2024
+ + https://github.com/broadinstitute/cromwell
+
+ +
+ +
+

Scientific workflow engine designed for simplicity & scalability. Trivially transition between one off use cases to massive scale production environments

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Scala

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 359 +   |   + 1009 +   |   + 793 +   |   + BSD-3-Clause +

+
+
+ cjllanwarnekshakirmcovarrHornethgeoffjentryscottfrazeraednicholsruchimjgainerdewardanbillssalonishah11rsaschkcibulTHWisemanfrancareskraefreiscala-stewardrhpvordermankpierre13breilly2cahrenselerchkatevosscoreonejsotobroadAlexITCtrinaap13JVThomasillusionaldelocalizer +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/dagonstar/index.html b/systems/dagonstar/index.html new file mode 100644 index 0000000000..c32a6b50c5 --- /dev/null +++ b/systems/dagonstar/index.html @@ -0,0 +1,312 @@ + + + + + DagOnStar - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ DagOnStar +

+
+
+
+
+ +
+
+
+
+
+
+
+ DagOnStar +

DagOnStar

+ Last updated: 24 Jan 2025
+ v1.0.2 — Released on: 18 Nov 2024
+ + https://github.com/DagOnStar/dagonstar
+
+ +
+ +
+

DAGonStar (Direct acyclic graph On anything) is a lightweight Python library implementing a workflow engine able to execute parallel jobs represented by direct acyclic graphs on any combination of local machines, on-premise high-performance computing clusters, containers, and cloud-based virtual infrastructures.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • CommandLine

  • Resource Managers

  • Local
  • SSH
  • Docker
  • SLURM
  • Cloud (AWS, Digital Ocean, Google Grid, Azure, OpenStack)

  • Transfer Protocols

  • SCP
+ + +
+
+

Contributors

+

+ 3 +   |   + 4 +   |   + 0 +   |   + Apache-2.0 +

+
+
+ ddomizzisgraffmontcirodevitaArmandoBarronjaviergarcia +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/dask/index.html b/systems/dask/index.html new file mode 100644 index 0000000000..b9551cdffd --- /dev/null +++ b/systems/dask/index.html @@ -0,0 +1,312 @@ + + + + + dask - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ dask +

+
+
+
+
+ +
+
+
+
+
+
+ https://dask.org
+ dask +

dask

+ Last updated: 25 Jan 2025
+ 2024.12.1 — Released on: 17 Dec 2024
+ + https://github.com/dask/dask
+
+ +
+ +
+

Parallel computing with task scheduling

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 1731 +   |   + 12878 +   |   + 1103 +   |   + BSD-3-Clause +

+
+
+ mrocklinphofljcristjrbourbeaucowlicksrjzamorajakirkhamjsignellTomAugspurgercrusaderkyfjettersinhrksmartindurantcpcloudhendrikmakaitfarrajotashoyerj-bennetcharlesblucamilesgrangerdependabot[bot]pentscheveriknwGenevieveBuckleymadsbkmarianotepperscharlottej13jacobtomlinsonpavithraesQuLogic +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/fireworks/index.html b/systems/fireworks/index.html new file mode 100644 index 0000000000..28288522b3 --- /dev/null +++ b/systems/fireworks/index.html @@ -0,0 +1,312 @@ + + + + + fireworks - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ fireworks +

+
+
+
+
+ +
+
+
+
+
+
+ https://materialsproject.github.io/fireworks
+ fireworks +

fireworks

+ Last updated: 22 Jan 2025
+ v2.0.4 — Released on: 22 Jan 2025
+ + https://github.com/materialsproject/fireworks
+
+ +
+ +
+

The Fireworks Workflow Management Repo.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 187 +   |   + 372 +   |   + 74 +   |   + NOASSERTION +

+
+
+ computronshyuepjanoshikondovxhqu1981matk86gpetrettombkumarjotelhamontoyjhardunnjakirkhamdependabot-preview[bot]dwinstondotsdlaykoldyllamtrichardjgowersmkhortonutfdanguntertschaumezhubonanwscullinlastepheyjmmshnsivonxayzulissitirkarthiflxb +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/galaxy/index.html b/systems/galaxy/index.html new file mode 100644 index 0000000000..1446ccce0e --- /dev/null +++ b/systems/galaxy/index.html @@ -0,0 +1,312 @@ + + + + + galaxy - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ galaxy +

+
+
+
+
+ +
+
+
+
+
+
+ https://galaxyproject.org
+ galaxy +

galaxy

+ Last updated: 24 Jan 2025
+ v24.1.4 — Released on: 11 Dec 2024
+ + https://github.com/galaxyproject/galaxy
+
+ +
+ +
+

Data intensive science for everyone.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 1014 +   |   + 1439 +   |   + 2409 +   |   + NOASSERTION +

+
+
+ dannonmvdbeekjmchiltonguerlernsoranzomartensonjdavcsdavelopeznatefoogregvonkusterblankenbergbernt-matthiascarlfeberhardbgrueningElectronicBlueberrydavebxitisAliRHjxtxhexylenaOlegZharkovVJaliliahmedhamidawanassuntad23anuprulezkanweiheisner-tillmannuwangNerdinacanfubar2pcm32 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/geoweaver/index.html b/systems/geoweaver/index.html new file mode 100644 index 0000000000..52469bf767 --- /dev/null +++ b/systems/geoweaver/index.html @@ -0,0 +1,312 @@ + + + + + Geoweaver - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Geoweaver +

+
+
+
+
+ +
+
+
+
+
+
+ https://geoweaver.dev
+ Geoweaver +

Geoweaver

+ Last updated: 23 Jan 2025
+ v1.8.6 — Released on: 21 Jan 2025
+ + https://github.com/esipfed/geoweaver
+
+ +
+ +
+

Geoweaver is a web system to allow users to automatically record history and manage complicated scientific workflows in web browsers involving the online spatial data facilities, high-performance computation platforms, and open-source libraries.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

JavaScript

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 45 +   |   + 84 +   |   + 36 +   |   + MIT +

+
+
+ ZihengSungokulprathin8meghanakr7saivivek116uhhmedVisheshSalujaJYOSHREDDYesip-labsrinijammulaVirginiaJRSBhargavijanga58chetana1997manasa123104dependabot[bot]itspa1saikiranAnnamAnuragVanamandrewmagilldidarul-csisssahulkrishnakvarun-TRhemanthghattamaneniImgBotAppFrijolChaosEx +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/jobflow/index.html b/systems/jobflow/index.html new file mode 100644 index 0000000000..cfcebe35b8 --- /dev/null +++ b/systems/jobflow/index.html @@ -0,0 +1,312 @@ + + + + + jobflow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ jobflow +

+
+
+
+
+ +
+
+
+
+
+
+ https://materialsproject.github.io/jobflow
+ jobflow +

jobflow

+ Last updated: 20 Jan 2025
+ v0.1.19 — Released on: 22 Nov 2024
+ + https://github.com/materialsproject/jobflow
+
+ +
+ +
+

jobflow is a library for writing computational workflows.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 27 +   |   + 98 +   |   + 38 +   |   + NOASSERTION +

+
+
+ utfdependabot[bot]janoshAndrew-S-Rosenjmmshndepend-a-lot-bot[bot]gpetrettosivonxayhrushikesh-sJaGeomcgalcodedavidwaroquiersmjwenFabiPi3mkhortonesoteric-ephemeraml-evsxuanxuxperrylinnchiang-yuan +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/libensemble/index.html b/systems/libensemble/index.html new file mode 100644 index 0000000000..e7e21a8068 --- /dev/null +++ b/systems/libensemble/index.html @@ -0,0 +1,322 @@ + + + + + libEnsemble - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ libEnsemble +

+
+
+
+
+ +
+
+
+
+
+
+ https://libensemble.readthedocs.io/
+ libEnsemble +

libEnsemble

+ Last updated: 18 Jan 2025
+ 1.4.3 — Released on: 16 Dec 2024
+ + https://github.com/Libensemble/libensemble
+
+ +
+ +
+

libEnsemble is a Python toolkit for running dynamic ensembles of calculations. + +Users write generator and simulator functions to express their ensembles. +A library of example functions is available which can be modified as needed. +These functions can submit unmodified external executables at any scale and +in a portable way. System details are detected, and resource management is +provided. + +libEnsemble can be used in a consistent manner on laptops, clusters, and +supercomputers with minimal required dependencies. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python API

  • Resource Managers

  • Slurm
  • LSF
  • Cobalt
  • PBS

  • Transfer Protocols

  • Globus
+ + +
+
+

Contributors

+

+ 26 +   |   + 65 +   |   + 36 +   |   + BSD-3-Clause +

+
+
+ jmlarson1jlnavshuds13dbindeldependabot[bot]mosesyhckaushikcfdMaxThevenetthchangAngelFPRemiLehewildsmnneveutmunsonBarrySmithmkstoyanovjucaleb4 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/maestrowf/index.html b/systems/maestrowf/index.html new file mode 100644 index 0000000000..50b8e9a9a5 --- /dev/null +++ b/systems/maestrowf/index.html @@ -0,0 +1,312 @@ + + + + + Maestro Workflow Conductor - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Maestro Workflow Conductor +

+
+
+
+
+ +
+
+
+
+
+
+ https://maestrowf.readthedocs.io
+ Maestro Workflow Conductor +

Maestro Workflow Conductor

+ Last updated: 20 Jan 2025
+ v1.1.10 — Released on: 06 Feb 2024
+ + https://github.com/LLNL/maestrowf
+
+ +
+ +
+

Maestro is an open-source HPC software tool that defines a YAML-based study specification for defining multistep workflows and automates execution of software flows on HPC resources. The core design tenants of Maestro focus on encouraging clear workflow communication and documentation, while making consistent execution easier to allow users to focus on science. Maestro's study specification helps users think about complex workflows in a step-wise, intent-oriented, manner that encourages modularity and tool reuse. These principles are becoming increasingly important as computational science is continuously more present in scientific fields and has started to require a similar rigor to physical experiment. Maestro is currently in use for multiple projects at Lawrence Livermore National Laboratory and has been used to run existing codes including MFEM, and other simulation codes. It has also been used in other areas including in the training of machine-learned models and more.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 42 +   |   + 142 +   |   + 75 +   |   + MIT +

+
+
+ FrankD412jwhite242jsemlerdinatale2kcatheyben-bayyoungjeffreydependabot[bot]gonsiecrkrennSteVwonderkoningIanLee1521doutriaux1adrienbernedebgunnar5kinowgrosa1hoetmaaierskennyweisstanimislamTobiasDuswaldtrwsrobinson96scottwedge +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/makeflow/index.html b/systems/makeflow/index.html new file mode 100644 index 0000000000..c9b26cec87 --- /dev/null +++ b/systems/makeflow/index.html @@ -0,0 +1,312 @@ + + + + + Makeflow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Makeflow +

+
+
+
+
+ +
+
+
+
+
+
+ http://ccl.cse.nd.edu
+ Makeflow +

Makeflow

+ Last updated: 24 Jan 2025
+ release/7.14.3 — Released on: 17 Jan 2025
+ + https://github.com/cooperative-computing-lab/cctools
+
+ +
+ +
+

Makeflow is a workflow engine for large scale distributed computing. It accepts a specification of a large amount of work to be performed, and runs it on remote machines in parallel where possible with support to several batch systems (e.g., HTCondor, SLURM, PBS, and Work Queue among others). It is fault-tolerant, so you can use it to coordinate very large tasks that may run for days or weeks in the face of failures. Makeflow is designed to be similar to Make , so if you can write a Makefile, then you can write a Makeflow.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Make

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 123 +   |   + 137 +   |   + 118 +   |   + NOASSERTION +

+
+
+ btovardthaintshaffe1nhazekamdpandiarpbuihaiyanmengrampantmonkeylyu2nkremerhstorelordcolinthomas-z80tphung3BarrySlyDelgadocshinavercharleszheng44JinZhou5042David-Simonetti-NDbatricksghuang19epyifanyrenemeJosephDuggan7jmrundlejblomerbwiseman77andreytobenjaminlyonsnicklocascio45NeilB879 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/merlin/index.html b/systems/merlin/index.html new file mode 100644 index 0000000000..a252f331df --- /dev/null +++ b/systems/merlin/index.html @@ -0,0 +1,312 @@ + + + + + Merlin - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Merlin +

+
+
+
+
+ +
+
+
+
+
+
+
+ Merlin +

Merlin

+ Last updated: 07 Dec 2024
+ Version 1.12.2 — Released on: 28 Oct 2024
+ + https://github.com/LLNL/merlin
+
+ +
+ +
+

The Merlin workflow framework targets large-scale scientific machine learning (ML) workflows in High Performance Computing (HPC) environments. Merlin is a producer-consumer workflow model that enables multi-machine, cross-batch job, dynamically allocated yet persistent workflows capable of utilizing surge-compute resources. Key features are a flexible and intuitive HPC-centric interface, low per-task overhead, multi-tiered fault recovery, and a hierarchical sampling algorithm that allows for highly scalable task execution and queuing to ensembles of millions of tasks.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 26 +   |   + 126 +   |   + 9 +   |   + MIT +

+
+
+ ben-baykoningbgunnar5lucpetersonAlexanderWinterLLNLryannovaymubarkaxorJaneKaseyNagleLLNLdependabot[bot]fixdockerrobinson96 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/mlflow/index.html b/systems/mlflow/index.html new file mode 100644 index 0000000000..8f1d8efe88 --- /dev/null +++ b/systems/mlflow/index.html @@ -0,0 +1,312 @@ + + + + + mlflow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ mlflow +

+
+
+
+
+ +
+
+
+
+
+
+ https://mlflow.org
+ mlflow +

mlflow

+ Last updated: 25 Jan 2025
+ MLflow 2.20.0 — Released on: 23 Jan 2025
+ + https://github.com/mlflow/mlflow
+
+ +
+ +
+

Open source platform for the machine learning lifecycle

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 4319 +   |   + 19310 +   |   + 1696 +   |   + Apache-2.0 +

+
+
+ harupydbczumarB-Step62BenWilson2serena-ruansmurchingWeichenXu123mlflow-automationdaniellok-dbsunishsheth2009aarondavprithvikannanmparkhetomasatdatabrickschenmoneygithubjerrylian-dbannzhang-dbapurva-kotisueannTomeHirataliangz1juntai-zhengandrewmchenankit-dbmateizgabrielfumichael-berkdmatrixshrinath-sureshjdlesage +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/nextflow/index.html b/systems/nextflow/index.html new file mode 100644 index 0000000000..31973a48e5 --- /dev/null +++ b/systems/nextflow/index.html @@ -0,0 +1,313 @@ + + + + + Nextflow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Nextflow +

+
+
+
+
+ +
+
+
+
+
+
+ http://nextflow.io
+ Nextflow +

Nextflow

+ Last updated: 24 Jan 2025
+ Version 24.12.0-edge — Released on: 20 Jan 2025
+ + https://github.com/nextflow-io/nextflow
+ https://twitter.com/nextflowio
+ https://www.youtube.com/c/Nextflow +
+ +
+

Nextflow is an open-source workflow orchestrator that simplifies writing and deploying containerised data pipelines in a portable and scalable manner. It supports deploying workflows on a variety of execution platforms including local computers, HPC batch schedulers, Kubernetes and cloud platforms such as AWS, Azure and Google Cloud. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Groovy

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • GitHub
  • GitLab
  • BitBucket

  • Resource Managers

  • Slurm
  • LSF
  • PBS/Torque
  • PBS Pro
  • SGE
  • Moab
  • HTCondor
  • Bridge
  • HyperQueue
  • GLS
  • NQSII
  • OAR
  • Local
  • AWS
  • GCP
  • Azure
  • Kubernetes

  • Transfer Protocols

  • HTTP
  • HTTPS
  • FTP
  • Amazon S3
  • Google Storage
  • Azure Storage
  • Git+HTTPS
+ + +
+
+

Contributors

+

+ 651 +   |   + 2832 +   |   + 518 +   |   + Apache-2.0 +

+
+
+ pditommasobentshermanewelsjorgeaguileraseqeramribeirodantasmanuelesimimarcodelapierreabhi18avrobsymejorgeeadamrtalbotLehmann-Fabianbmsanjuanemi80jordeuKevinSayersllewellyn-slevanflodenchristopher-hakkaarttom-seqeraxhejtmanpinin4fjordsJoseEspinosajchorlmes5kmaddenpphupephuesven1103vsoch +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/nipype/index.html b/systems/nipype/index.html new file mode 100644 index 0000000000..ec8a5c9fec --- /dev/null +++ b/systems/nipype/index.html @@ -0,0 +1,317 @@ + + + + + nipype - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ nipype +

+
+
+
+
+ +
+
+
+
+
+
+ https://nipype.readthedocs.org/en/latest/
+ nipype +

nipype

+ Last updated: 22 Jan 2025
+ 1.8.4 — Released on: 01 Sep 2022
+ + https://github.com/nipy/nipype
+
+ +
+ +
+

Nipype, an open-source, community-developed initiative under the umbrella of NiPy, is a Python project that +provides a uniform interface to existing neuroimaging software and facilitates interaction between these +packages within a single workflow. Nipype provides an environment that encourages interactive exploration of +algorithms from different packages (e.g., SPM, FSL, FreeSurfer, AFNI, Slicer, ANTS), eases the design of +workflows within and between packages, and reduces the learning curve necessary to use different packages. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python3

+
+
+
+
+ +

Execution Environment

  • Resource Managers

  • SLURM
  • Condor
  • DAGMan
  • LSF
  • OAR
  • PBS
  • SGE
  • Soma-workflow
+ + +
+
+

Contributors

+

+ 531 +   |   + 756 +   |   + 420 +   |   + NOASSERTION +

+
+
+ satrachrisgorgooestebaneffigiesmgxddjareckaswederikellisdgbpinsardcindeemmwaskommiykaelpintohutchalexsavioyarikopticdavclarkkesshijordanmick-dmnoergaardDimitriPapadopoulostsalohjmjohnsonblakedeweysalma1601byvernaultTheChymeracarlohamalainenrciricjosephmjepndni-builder +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/parsl/index.html b/systems/parsl/index.html new file mode 100644 index 0000000000..65a511b97c --- /dev/null +++ b/systems/parsl/index.html @@ -0,0 +1,321 @@ + + + + + Parsl - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Parsl +

+
+
+
+
+ +
+
+
+
+
+
+ http://parsl-project.org
+ Parsl +

Parsl

+ Last updated: 22 Jan 2025
+ 1.2.0 — Released on: 13 Jan 2022
+ + https://github.com/Parsl/parsl
+ https://twitter.com/ParslProject
+ +
+ +
+

Parsl is a flexible and scalable parallel programming library for Python. +Parsl augments Python with simple constructs for encoding parallelism. +Developers annotate Python functions to specify opportunities for +concurrent execution. These annotated functions, called apps, may represent +pure Python functions or calls to external applications. Parsl further +allows invocations of these apps, called tasks, to be connected by shared +input/output data (e.g., Python objects or files) via which Parsl +constructs a dynamic dependency graph of tasks to manage concurrent task +execution where possible. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python API

  • Resource Managers

  • Slurm
  • LSF
  • PBS
  • Flux
  • GridEngine
  • HTCondor
  • AWS
  • Google Cloud
  • Kubernetes

  • Transfer Protocols

  • Globus
  • HTTP
  • FTP
  • rsync
+ + +
+
+

Contributors

+

+ 199 +   |   + 523 +   |   + 460 +   |   + Apache-2.0 +

+
+
+ yadudocbencliffordannawoodardZhuozhaoLiConnorPiggdanielskatzbenhglukaszlacinskigarri1105kylechardkhk-globusWardLThategantphung3rjmellocolinthomas-z80btovarHarichandra-PrasathlgrayAymenFJAtylern4NishchayKarlesophie-buidaheisecms21Andrew-S-Rosenrc-gitmacintoshpiekumar0022matthewc2003 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/pegasus/index.html b/systems/pegasus/index.html new file mode 100644 index 0000000000..1d5709d759 --- /dev/null +++ b/systems/pegasus/index.html @@ -0,0 +1,312 @@ + + + + + pegasus - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ pegasus +

+
+
+
+
+ +
+
+
+
+
+
+ https://pegasus.isi.edu
+ pegasus +

pegasus

+ Last updated: 23 Jan 2025
+
+ + https://github.com/pegasus-isi/pegasus
+
+ +
+ +
+

Pegasus Workflow Management System - Automate, recover, and debug scientific computations.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Java

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 74 +   |   + 184 +   |   + 83 +   |   + Apache-2.0 +

+
+
+ vahiryngemayanijuverafaelfsilvaryantanakavoecklerfabiolsilvaBillMullinspapajimzaiyan-alamduncan-browndcbriggsmukundmurralilpottierduncanmmacleoddangunterSudarshanSedquisthariharan-devarajanspxiwhksbeattievedularaghuceward +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/prefect/index.html b/systems/prefect/index.html new file mode 100644 index 0000000000..2dfa003fc5 --- /dev/null +++ b/systems/prefect/index.html @@ -0,0 +1,312 @@ + + + + + prefect - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ prefect +

+
+
+
+
+ +
+
+
+
+
+
+ https://prefect.io
+ prefect +

prefect

+ Last updated: 24 Jan 2025
+ 3.1.15.dev1: Nightly Development Release — Released on: 24 Jan 2025
+ + https://github.com/PrefectHQ/prefect
+
+ +
+ +
+

Prefect is a workflow orchestration framework for building resilient data pipelines in Python.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 1695 +   |   + 18114 +   |   + 972 +   |   + Apache-2.0 +

+
+
+ zaniebpleek91jlowincicdwanticorrelatorznicholasbrownzangell44dependabot[bot]desertaxlezzstoatzzstackoverflowethdiscdiverzhen0peytonrunyanbunchesofdonaldchrisguidryserinamariebillpalombijakekaplanmarvin-robotabrookinstpdorseyahuang11anna-gellerdevinvillarosaaaazzamThatGalNataliegithub-actions[bot]marichka-offenjawnsy +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/pyiron_base/index.html b/systems/pyiron_base/index.html new file mode 100644 index 0000000000..de0b27befc --- /dev/null +++ b/systems/pyiron_base/index.html @@ -0,0 +1,312 @@ + + + + + pyiron - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ pyiron +

+
+
+
+
+ +
+
+
+
+
+
+ https://pyiron-base.readthedocs.io
+ pyiron +

pyiron

+ Last updated: 21 Jan 2025
+ pyiron_base-0.11.0 — Released on: 20 Jan 2025
+ + https://github.com/pyiron/pyiron_base
+ https://twitter.com/https://twitter.com/pyiron
+ https://www.youtube.com/@pyironIDE +
+ +
+

Originally developed for atomistic simulation in computational materials science, pyiron is more recently used as general purpose workflow manager for high performance computing (HPC) infrastructures. The core features of pyiron are (1) the data storage interface based on the hierarchical data format (HDF5), (2) support for python codes as well as codes written in other programming languages like C, C++ and Fortran and finally (3) advanced utility like map-reduce to efficiently prototype and upscale complex simulation protocols.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

python

+
+
+
+
+ +

Execution Environment

  • Resource Managers

  • slurm
  • lsf
  • moab
  • sge
  • torque

  • Transfer Protocols

  • SSH
+ + +
+
+

Contributors

+

+ 15 +   |   + 21 +   |   + 82 +   |   + BSD-3-Clause +

+
+
+ jan-janssenpmrvsudarsan-surendralalsamwasedaniklassiemerpyiron-runnerdependabot[bot]pre-commit-ci[bot]max-hassaniLeimerothliamhubergithub-actions[bot]dependabot-preview[bot]FeLochOvakefali13srmnitcraynol-dsouzafreysopyironlandingpageXzzXcodacy-badgerligerzero-aitnecnivkcotsyasser-sulaimanAhmed-AslamAlaukiksaxenaIceflowREprince-mathews +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/radical.entk/index.html b/systems/radical.entk/index.html new file mode 100644 index 0000000000..b767f9704d --- /dev/null +++ b/systems/radical.entk/index.html @@ -0,0 +1,312 @@ + + + + + radical.entk - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ radical.entk +

+
+
+
+
+ +
+
+
+
+
+
+ https://radical-cybertools.github.io/entk/index.html
+ radical.entk +

radical.entk

+ Last updated: 16 Jan 2025
+ v1.42.0 — Released on: 15 Dec 2023
+ + https://github.com/radical-cybertools/radical.entk
+
+ +
+ +
+

The RADICAL Ensemble Toolkit

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 17 +   |   + 29 +   |   + 8 +   |   + NOASSERTION +

+
+
+ vivek-balaandre-merzkyoleweidnerlee212mtitovmturillishantenujhawilkinsonAymenFJAkarahbitjdakkadalg24dotsdltirkarthimarksantcroosmingtaiha +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/scipipe/index.html b/systems/scipipe/index.html new file mode 100644 index 0000000000..61361b4d22 --- /dev/null +++ b/systems/scipipe/index.html @@ -0,0 +1,312 @@ + + + + + SciPipe - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ SciPipe +

+
+
+
+
+ +
+
+
+
+
+
+ https://scipipe.org
+ SciPipe +

SciPipe

+ Last updated: 22 Jan 2025
+ v0.12.0: Important bugfix. Minor API change. — Released on: 14 Oct 2021
+ + https://github.com/scipipe/scipipe
+ https://twitter.com/scipipe
+ +
+ +
+

SciPipe is a library for writing Scientific Workflows, sometimes also called "pipelines", in the Go programming language. When you need to run many commandline programs that depend on each other in complex ways, SciPipe helps by making the process of running these programs flexible, robust and reproducible. SciPipe also lets you restart an interrupted run without over-writing already produced output and produces an audit report of what was run, among many other things.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Go

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 72 +   |   + 1083 +   |   + 56 +   |   + MIT +

+
+
+ samuelldwmunstermikujonalvszliaoJakeHagendahlonyuerbisewskikerkomen +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/signac-flow/index.html b/systems/signac-flow/index.html new file mode 100644 index 0000000000..ba9fde9ab9 --- /dev/null +++ b/systems/signac-flow/index.html @@ -0,0 +1,312 @@ + + + + + signac-flow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ signac-flow +

+
+
+
+
+ +
+
+
+
+
+
+ https://signac.io/
+ signac-flow +

signac-flow

+ Last updated: 02 Dec 2024
+ v0.29.0 — Released on: 26 Mar 2024
+ + https://github.com/glotzerlab/signac-flow
+
+ +
+ +
+

Workflow management for signac-managed data spaces.

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 37 +   |   + 48 +   |   + 56 +   |   + BSD-3-Clause +

+
+
+ csadorfbdicevyasrdependabot[bot]b-butlerkidrahahjojoaanderpre-commit-ci[bot]cbkerrzhou-pjtcmoore3atravitzswerdfishklywangrosecersramanishsinghCharlottez112vishav1771shannon-moranac-optimusberceanuiblanco11981870javierbgmattwthompsonmikemhenryerinvchenseoulfoodjustinGilmermelodyyzhmichiboo +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/snakemake/index.html b/systems/snakemake/index.html new file mode 100644 index 0000000000..7d8b39dea8 --- /dev/null +++ b/systems/snakemake/index.html @@ -0,0 +1,312 @@ + + + + + Snakemake - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ Snakemake +

+
+
+
+
+ +
+
+
+
+
+
+ https://snakemake.github.io
+ Snakemake +

Snakemake

+ Last updated: 24 Jan 2025
+ v8.27.1 — Released on: 08 Jan 2025
+ + https://github.com/snakemake/snakemake
+ https://twitter.com/johanneskoester
+ +
+ +
+

This is the development home of the workflow management system Snakemake. For general information, see

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • Resource Managers

  • any DRM providing a script based submission interface (e.g. slurm, lsf, pbs, ...)
  • kubernetes
  • google life sciences API
  • tibanna
  • TES
+ + +
+
+

Contributors

+

+ 563 +   |   + 2362 +   |   + 1152 +   |   + MIT +

+
+
+ johanneskoestergithub-actions[bot]percyfaltomkinscstolpeorasmusagrentboothvsochHenningTimmchrisburrholtgrewedlaehnemannfgvieiramarcelmmbhall88dependabot[bot]DarwinAwardWinnerbowepruessemelundFelixMoelderboulundyesimonpvandykenHocnonsensedalerdcrootejfearkemalerenmdehollander +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/streamflow/index.html b/systems/streamflow/index.html new file mode 100644 index 0000000000..15b3111a91 --- /dev/null +++ b/systems/streamflow/index.html @@ -0,0 +1,312 @@ + + + + + StreamFlow - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ StreamFlow +

+
+
+
+
+ +
+
+
+
+
+
+ https://streamflow.di.unito.it
+ StreamFlow +

StreamFlow

+ Last updated: 24 Jan 2025
+ 0.2.0.dev11 — Released on: 07 May 2024
+ + https://github.com/alpha-unito/streamflow
+
+ +
+ +
+

The StreamFlow framework is a container-native Workflow Management System (WMS) written in Python 3 and based on the Common Workflow Language (CWL) open standard. It has been designed around two main principles: allow the execution of tasks in multi-container environments, in order to support concurrent execution of multiple communicating tasks in a multi-agent ecosystem, and relax the requirement of a single shared data space, in order to allow for hybrid workflow executions on top of multi-cloud or hybrid cloud/HPC infrastructures.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • CommandLine

  • Resource Managers

  • Local
  • SSH
  • Kubernetes
  • Docker
  • Docker Compose
  • Singularity
  • SLURM
  • PBS

  • Transfer Protocols

  • SCP
  • WebSocket (Kubernetes)
+ + +
+
+

Contributors

+

+ 13 +   |   + 56 +   |   + 11 +   |   + LGPL-3.0 +

+
+
+ dependabot[bot]GlassOfWhiskeyLanderOttopaolovivianikinowslyqvsoch +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/swift-t/index.html b/systems/swift-t/index.html new file mode 100644 index 0000000000..9ab2627992 --- /dev/null +++ b/systems/swift-t/index.html @@ -0,0 +1,312 @@ + + + + + swift-t - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ swift-t +

+
+
+
+
+ +
+
+
+
+
+
+ http://swift-lang.org/Swift-T
+ swift-t +

swift-t

+ Last updated: 23 Jan 2025
+
+ + https://github.com/swift-lang/swift-t
+
+ +
+ +
+

Swift/T: High Performance Parallel Scripting Language

+
+
+ +
+ + + +
+
+
+
+ +
+
+
+

Java

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 22 +   |   + 53 +   |   + 84 +   |   + Apache-2.0 +

+
+
+ j-woztimarmstrongketancmaheshwariwilkencollierazzaeaspagnuolocarmineetatarayadudocjozikandrew-weismanadammoodyskriederelliottslaughterjburgerajeejabsubeibnikolic +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/taskvine/index.html b/systems/taskvine/index.html new file mode 100644 index 0000000000..ae579f6ff2 --- /dev/null +++ b/systems/taskvine/index.html @@ -0,0 +1,312 @@ + + + + + TaskVine - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ TaskVine +

+
+
+
+
+ +
+
+
+
+
+
+ http://ccl.cse.nd.edu
+ TaskVine +

TaskVine

+ Last updated: 24 Jan 2025
+ release/7.14.3 — Released on: 17 Jan 2025
+ + https://github.com/cooperative-computing-lab/cctools
+
+ +
+ +
+

TaskVine is a system building large scale data intensive dynamic workflows that run on HPC clusters, GPU clusters, and commercial clouds. As tasks access external data sources and produce their own outputs, more and more data is pulled into local storage on workers. This data is used to accelerate future tasks and avoid re-computing exisiting results. Data gradually grows "like a vine" through the cluster. TaskVine can serve as an execution for other workflow systems such as Parsl and Dask.

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ + + + +
+
+

Contributors

+

+ 123 +   |   + 137 +   |   + 118 +   |   + NOASSERTION +

+
+
+ btovardthaintshaffe1nhazekamdpandiarpbuihaiyanmengrampantmonkeylyu2nkremerhstorelordcolinthomas-z80tphung3BarrySlyDelgadocshinavercharleszheng44JinZhou5042David-Simonetti-NDbatricksghuang19epyifanyrenemeJosephDuggan7jmrundlejblomerbwiseman77andreytobenjaminlyonsnicklocascio45NeilB879 +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/systems/watts/index.html b/systems/watts/index.html new file mode 100644 index 0000000000..b656f955f5 --- /dev/null +++ b/systems/watts/index.html @@ -0,0 +1,319 @@ + + + + + WATTS - Workflows Community Initiative + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+
+
+
+

+ WATTS +

+
+
+
+
+ +
+
+
+
+
+
+ https://watts.readthedocs.io
+ WATTS +

WATTS

+ Last updated: 10 Nov 2024
+ 0.5.1 — Released on: 11 Jul 2023
+ + https://github.com/watts-dev/watts
+
+ +
+ +
+

WATTS consists of a set of Python classes that can manage simulation workflows +for one or multiple codes. It provides: an isolated execution environment when +running a code; the ability to use placeholder values in input files that are +filled in programmatically; seamless unit conversions when working with +multiple codes; a managed database that simulation inputs and outputs are +automatically saved to; and Python classes that provide extra post-processing +and analysis capabilities. +

+
+
+ +
+

Install

 +

Tutorial

 +

Docs

 +
+
+
+
+ +
+
+
+

Python

+
+
+
+
+ +

Execution Environment

  • User Interfaces

  • Python API
+ + +
+
+

Contributors

+

+ 19 +   |   + 25 +   |   + 11 +   |   + MIT +

+
+
+ paulromanonstauffzhieejhia93JiaZhou-PUmiaoyinbsamgdotsonamandalunddanieletimpanolingzou-anl +
+
+ +
+ + + +
+
+
+ +
+
+
+
+
+

Workflows Community Initiative

+

Our goal is to bring the workflows community together (users, developers, researchers, and + facilities) to provide community resources and capabilities to enable + scientists + and workflow systems developers to discover software products, related efforts, events, + technical + reports, etc. and engage in community-wide efforts to tackle workflows grand challenges.

+
+
+
+
+ +
+
+
+
+
+ +

+ ©2022—2025 Workflows.Community Initiative +
+ This template is made with + by Colorlib + + +

+
+
+
+
+ + + + + + + + + + + + + + + + + + + + + + + + +